WO2010126670A2 - Compositions and methods for screening and using compounds antagonizing spore-surface interactions - Google Patents
Compositions and methods for screening and using compounds antagonizing spore-surface interactions Download PDFInfo
- Publication number
- WO2010126670A2 WO2010126670A2 PCT/US2010/028902 US2010028902W WO2010126670A2 WO 2010126670 A2 WO2010126670 A2 WO 2010126670A2 US 2010028902 W US2010028902 W US 2010028902W WO 2010126670 A2 WO2010126670 A2 WO 2010126670A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- spore
- composition
- protein
- seq
- microbial
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/40—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/33—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/32—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bacillus (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/48—Medical, disinfecting agents, disinfecting, antibacterial, germicidal or antimicrobial compositions
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/02—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
- C12Q1/18—Testing for antimicrobial activity of a material
Definitions
- the present invention is related to the field of infection control.
- the invention is related to compositions and methods for maintenance of antiseptic conditions, bacterial decontamination, and/or bacterial exposure prophylaxis.
- the invention contemplates infection control compositions that inhibit microbial spore binding to a substrate surface. For example, the inhibition disrupts and/or displaces an interaction, attachment, and/or stabilization of a microbial spore to a substrate surface.
- Spore-forming bacteria may be responsible for contaminations including, but not limited to, hospital infections, food spoilage and/or food-borne illness problems. As the production of minimally processed refrigerated products becomes more efficient and aseptic, background microflora are eliminated, and it is the spore-forming organism which eventually may limit the shelf-lives of these products. Spore-forming bacteria are suspected of being responsible for the spoilage of canned foods, bread, vacuum packed meats, pasteurized dairy products, and fruit juices. The presence of bacterial spores at high levels in ingredients going into any of these types of products may increase the potential for spoilage of the finished product.
- Clostridium difficile is a spore forming anaerobic bacterium which causes antibiotic associated diarrhea and pseudomembraneous colitis.
- the recent emergence of a highly pathogenic epidemic strain with increased attributable morbidity and mortality has further increased the importance of this nosocomial pathogen.
- Reductions in hospital staff-to-patient infectious transmission would be expected to drastically improve recovery times thereby resulting in accelerated patient release. This is beneficial from both patient health and societal cost viewpoints.
- the present invention is related to the field of infection control.
- the invention is related to compositions and methods for maintenance of antiseptic conditions, bacterial decontamination, and/or bacterial exposure prophylaxis.
- the invention contemplates infection control compositions that inhibit microbial spore binding to a substrate surface.
- the inhibition antagonizes, disrupts, and/or displaces an interaction, attachment, and/or stabilization of a microbial spore to a substrate surface.
- the present invention contemplates an infection control composition capable of blocking and/or inhibiting the binding of a microbial spore to a substrate surface.
- the composition comprises a small organic molecule.
- the composition comprises a protein.
- the peptide comprises a spore surface peptide..
- the peptide is derived from a Clostridia spore surface protein.
- the Clostridia spore surface protein comprises a Clostridia difficile spore surface protein.
- the peptide is derived from a Bacillus spore surface protein.
- the Bacillus spore surface protein comprises a Bacillus anthracis spore surface protein.
- the Clostridium difficile spore surface peptide comprises SEQ ID NO: 1 or a homologue of SEQ ID NO: 1.
- the spore surface peptide is selected from the group comprising SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, and SEQ ID NO: 15.
- the composition comprises an antibody.
- the antibody is a polyclonal antibody.
- the antibody is a monoclonal antibody.
- the composition comprises a synthetic peptide.
- the composition comprises an inorganic ion complex.
- the composition comprises a protein mimetic.
- the substrate surface comprises an inanimate surface. In one embodiment, comprises an animate surface.
- the animate surface comprises a body tissue surface.
- the body tissue surface comprises an epithelial surface.
- the epithelial surface comprises a mammalian skin surface.
- the inanimate surface comprises stainless steel.
- the inanimate surface comprises ceramic.
- the inanimate surface comprises vinyl.
- the inanimate surface comprises tile.
- the composition further comprises at least one antimicrobial drug.
- the composition further comprises a carrier, hi one embodiment, the carrier further comprises a detergent.
- the carrier is sterile and suitable for human administration.
- the carrier comprises an antimicrobial skin cleaner.
- the skin cleaner comprises a handwash cleaner.
- the carrier comprises an antimicrobial surface cleaner.
- the present invention contemplates an infection control composition comprising an amino acid sequence capable of blocking and/or inhibiting the binding of a microbial spore to a substrate surface, wherein the amino acid sequence has substantial homology to a microbial spore surface protein, hi one embodiment, the substantial homology comprises approximately 75% homology, preferably 85% homology, but most preferably 90% or 95% homology.
- the surface protein comprises a spore surface protein, hi one embodiment, the spore surface protein is a Clostridium spore surface protein. In one embodiment, the Clostridium spore surface protein is a C. difficile spore surface protein. In one embodiment, the spore surface protein is a Bacillus spore surface protein.
- the Bacillus spore surface protein is a B. anthracis spore surface protein, hi one embodiment, the spore surface protein comprises a spore surface peptide.. In one embodiment, the peptide is derived from a Clostridia surface protein. In one embodiment, the Clostridia surface protein comprises a Clostridia difficile surface protein. In one embodiment, the peptide is derived from a Bacillus surface protein. In one embodiment, the Bacillus surface protein comprises a Bacillus anthracis surface protein. In one embodiment, the Clostridium difficile spore surface peptide comprises SEQ ID NO: 1 or a homologue of SEQ ID NO: 1.
- the spore surface peptide is selected from the group comprising SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, and SEQ ID NO: 15.
- the amino acid sequence is derived from a C-terminal end of the spore surface protein.
- the amino acid sequence is derived from an N- terminal end of a spore surface protein.
- the composition further comprises a carrier.
- the carrier comprises a detergent.
- the composition further comprises at least one antimicrobial drug.
- the carrier is suitable for human administration.
- the composition further comprises an antimicrobial skin cleaner.
- the skin cleaner is a handwash cleaner.
- the composition further comprises an antimicrobial surface cleaner.
- the composition further comprises a skin barrier.
- the composition further comprises a surface barrier.
- the present invention contemplates an infection control composition comprising an antagonistic compound, wherein the compound has affinity for a microbial spore surface protein amino acid sequence.
- the affinity is directed at a substrate surface specific binding site region.
- the compound comprises an antibody.
- the compound comprises a small organic molecule.
- the spore surface protein amino acid sequence comprises a peptide fragment.
- the peptide fragment is derived from a C-terminal end of the spore surface protein.
- the peptide fragment is derived from an N-terminal end of the spore surface protein.
- the spore surface protein is a Clostridium spore surface protein.
- the Clostridium spore surface protein is a C. difficile spore surface protein. In one embodiment, the spore surface protein is a Bacillus spore surface protein. In one embodiment, the Bacillus spore surface protein is a B. anthracis spore surface protein, hi one embodiment, the composition further comprises at least one antimicrobial drug. In one embodiment, the composition further comprises a carrier. In one embodiment, the carrier is suitable for human administration. In one embodiment, the composition further comprises an antimicrobial hand cleaner. In one embodiment, the composition further comprises an antimicrobial surface cleaner.
- the present invention contemplates a method, comprising: a) providing: i) a subject at risk for exposure to a microbe, wherein the exposure is likely to result in a microbial infection; and ii) an infection control composition; b) administering the composition to the subject before the microbial exposure, under conditions such that a microbial infection barrier is formed.
- the microbial infection barrier reduces the microbial infection.
- the microbial infection barrier prevents the microbial infection.
- the microbe comprises a bacteria.
- the bacteria is selected from the group comprising Clostridia, Bacillus, Desulfotomaculum, Sporolactobacillus, Sporosarcina, or Thermoactinomyces .
- the bacteria comprises a bacterial spore.
- the bacterial spore comprises at least one spore surface protein.
- the Clostridium spore surface protein is a C. difficile spore surface protein.
- the Bacillus spore surface protein is a B. anthracis spore surface protein.
- the infection control composition comprises an amino acid sequence.
- the amino acid sequence is derived from a microbial spore surface protein.
- the amino acid sequence has substantial homology to a microbial spore surface protein.
- the infection control composition comprises is capable of inhibiting, antagonizing, disrupting, displacing, and/or blocking the binding of a microbial spore to a substrate surface.
- the infection control composition further comprises an antagonistic compound, wherein the compound has affinity for a microbial spore surface protein amino acid sequence.
- the composition further comprises a carrier, hi one embodiment, the infection control composition further comprises at least one antimicrobial drug.
- the subject at risk is a healthcare worker. In one embodiment, the subject at risk is a medical first responder. In one embodiment, the subject at risk is a medical patient.
- the patient is in a healthcare setting.
- the medical patient has been administered at least one antibiotic.
- the subject at risk is a fireman.
- the subject at risk is a policeman.
- the subject at risk is a military personnel.
- the subject at risk is a food handler.
- the subject at risk is an inanimate surface and/or object.
- the administering is selected from the group comprising topical, oral, parenteral, pulmonary, anal, vaginal, ocular, or intranasal.
- the present invention contemplates a method, comprising: a) providing: i) a subject having been exposed to a microbe, wherein the exposure resulted in a microbial infection; ii) an infection control composition; b) administering the composition to the subject after the microbial exposure, under conditions such that the microbial infection is reduced.
- the microbe comprises a bacteria.
- the bacteria is selected from the group comprising Clostridia, Bacillus, Desulfotomaculum, Sporolactobacillus, Sporosarcina, or Thermoactinomyces.
- the bacteria comprises a bacterial spore.
- the bacterial spore comprises at least one spore surface protein.
- the Clostridium spore surface protein is a C. difficile spore surface protein. In one embodiment, the Bacillus spore surface protein is a B. anthracis spore surface protein.
- the infection control composition comprises an amino acid sequence. In one embodiment, the amino acid sequence is derived from a microbial spore surface protein. In one embodiment, the amino acid sequence has substantial homology to a microbial spore surface protein. In one embodiment, the infection control composition is capable of inhibiting, antagonizing, disrupting, displacing and/or blocking the binding of a microbial spore to a substrate surface.
- the infection control composition further comprises an antagonistic compound, wherein the compound has affinity for a microbial spore surface protein amino acid sequence.
- the composition further comprises a carrier, hi one embodiment, the infection control composition further comprises at least one antimicrobial drug, hi one embodiment, the exposed subject is a healthcare worker.
- the exposed subject is a medical first responder.
- the exposed subject is a fireman.
- the exposed subject is a policeman, hi one embodiment, the exposed subject is a military personnel.
- the administering is selected from the group comprising topical, oral, parenteral, pulmonary, anal, vaginal, ocular, or intranasal.
- the exposed subject is an inanimate surface and/or object.
- the present invention contemplates a screening method comprising: a) providing; i) an isolated peptide, wherein the peptide is derived from a microbial spore surface protein; and ii) an infection control test compound suspected of having an interaction with the peptide; b) contacting the peptide with the infection control test compound; and c) detecting the interaction of the peptide with the infection control test compound.
- the method further comprises a substrate capable of attaching the isolated peptide.
- the substrate surface comprises pigskin.
- the peptide is derived from a Clostridia spore surface protein.
- the Clostridia spore surface protein comprises a Clostridia difficile exosporium.
- the peptide is derived from a Bacillus spore surface protein.
- the Bacillus exosporium comprises a Bacillus anthracis spore surface protein.
- the peptide comprises a spore surface peptide.
- the Clostridium difficile spore surface peptide comprises SEQ ID NO: 1 or a homologue of SEQ ID NO: 1.
- the spore surface peptide is selected from the group comprising SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, and SEQ ID NO: 15.
- the infection control test compound comprises a small organic molecule. In one embodiment, the infection control test compound comprises a synthetic peptide. In one embodiment, the infection control test compound comprises a protein mimetic. In one embodiment, the infection control test compound comprises an antibody.
- the present invention contemplates a method, comprising: a) providing; i) an isolated labeled microbial spore surface peptide, wherein said peptide creates a first fluorescent intensity pattern; and ii) an infection control test compound capable of interacting with said peptide; b) contacting said peptide with said compound to produce a contacted peptide having a second fluorescent intensity pattern; c) comparing said first intensity pattern with the second fluorescence intensity pattern.
- the method further comprises step d) detecting a difference between the first intensity pattern and the second intensity pattern. In one embodiment, the difference indicates that said compound binds to said peptide.
- the peptide is derived from a bacterial spore surface protein.
- the bacterial spore surface protein is derived from a Clostridia spore surface protein, hi one embodiment, the Clostridia spore surface protein comprises Clostridia difficile spore surface protein. In one embodiment, the bacterial spore surface protein is derived from a Bacillus spore surface protein. In one embodiment, the Bacillus spore surface protein comprises Bacillus anthracis spore surface protein. In one embodiment, the spore surface protein comprises a peptide fragment. Pn one embodiment, the peptide is selected from the group comprising SEQ ID NO: 1 , SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, or SEQ ID NO: 9.
- the label is selected from the group consisting of 4'-6- diamidino-2-phenylindole (DAPI), anilinonapthalene sulfonate (ANS), bis-ANS (Bis- anilinonapthalene sulfonate), N-phenyl-1 -naphthalene (NPN), ruthenium red, cresol violet, and 4-(dicyanovinyl)julolidine (DCVJ).
- DAPI 4'-6- diamidino-2-phenylindole
- ANS anilinonapthalene sulfonate
- bis-ANS Bis-ANS
- NPN N-phenyl-1 -naphthalene
- ruthenium red ruthenium red
- cresol violet cresol violet
- DCVJ 4-(dicyanovinyl)julolidine
- the present invention contemplates a method of screening for a compound, comprising: a) providing; i) a bacteria comprising a recombinant expression vector, wherein said vector comprises at least a portion of a spore surface oligonucleotide sequence; and ii) a compound suspected of having infection control activity; b) expressing said vector such that a spore surface protein is displayed on the bacterial membrane; c) contacting said bacteria with said compound; and d) detecting infection control activity of said compound.
- the infection control activity comprises forming a binding pair of said compound with said displayed protein.
- the oligonucleotide sequence comprises SEQ ID NO: 2.
- the recombinant expression vector further comprises a fusion sequence, wherein the fusion sequence comprises reporter sequence.
- the reporter sequence is a ⁇ - galactosidase sequence.
- the present invention contemplates a method for detecting the presence of polynucleotide sequences encoding at least a portion of a microbial spore surface protein gene in a sample, the method comprising: a) providing; i) at least a portion of SEQ ID NO: 2; and ii) a sample suspected of containing a spore surface oligonucleotide sequence; b) combining the SEQ ID NO: 2 portion and the sample under conditions such that a hybridization complex is formed between the SEQ ID NO: 2 portion and the spore surface oligonucleotide sequence; and c) detecting the hybridization complex.
- the spore surface oligonucleotide is derived from a microbial spore, hi one embodiment, the spore is derived from a Clostridia species. In one embodiment, the spore is derived from a Bacillus species. In one embodiment, the oligonucleotide sequence is RNA. In one embodiment, the oligonucleotide sequence is DNA.
- the present invention contemplates a method comprising; providing an infection control composition and a substrate surface comprising bacterial spores; applying the composition to the surface, wherein at least 50%, preferably 60%, more preferably 70%, even more preferably 80%, most preferably 90%, or 100% of the spores are removed from the surface.
- the surface may be selected from the group consisting of skin, body tissues, inorganic surfaces (i.e., for example, stainless steel, granite, plastic, tile, ceramic etc), gloves, laboratory coats, or medical instruments.
- the present invention contemplates a method comprising; providing an infection control composition and a substrate surface at high risk of bacterial spore binding; applying the composition to the surface, wherein at least 50%, preferably 60%, more preferably 70%, even more preferably 80%, most preferably 90%, or 100% of bacterial spore binding is prevented.
- the surface may be selected from the group consisting of skin, body tissues, inorganic surfaces (i.e., for example, stainless steel, granite, plastic, tile, ceramic etc.) or medical instruments.
- the present invention contemplates a method of screening a plurality of infection control compositions for binding to a microbial spore protein, comprising: a) providing a chromatography column comprising beads carrying said microbial spore proteins; b) contacting said plurality of infection control compositions with said beads under conditions such that at least one of said infection control compositions form a binding pair with said beads; c) controllably releasing said at least one bound infection control composition from said bead; d) detecting said at least one bound infection control composition.
- said binding pair comprises a microbial spore surface protein.
- the detecting of the at least one bound infection control composition comprises the production of a fluorescent signal.
- the detecting of the at least one bound infection control composition comprises the formation of an enzyme-substrate product.
- the step of controllably releasing comprises exposing the beads to a releasing agent.
- the releasing agent is selected from a group consisting of light, acid and base.
- the present invention contemplates an infection control composition
- a protein mimetic compound and a carrier, wherein the protein mimetic compound has a first specific binding site pattern on a substrate surface wherein the first binding pattern has at least 50% identity, preferably 60% identity, more preferably 70% identity, even more preferably 80% identity, most preferably 90% identity, or 100% identity to a second specific binding site pattern of an amino acid sequence, wherein the sequence has substantial homology to a microbial spore surface protein.
- the protein mimetic compound comprises a small organic molecule.
- the protein mimetic compound comprises a synthetic peptide.
- the protein mimetic compound comprises an inorganic ion complex.
- the surface protein comprises a spore surface protein.
- the microbial spore surface protein is derived from a Clostridium spore surface protein.
- the Clostridium spore surface protein is a C. difficile spore surface protein.
- the spore surface protein is derived from a Bacillus spore surface protein.
- the Bacillus spore surface protein is a B. anthracis spore surface protein.
- the amino acid sequence is derived from a C-terminal end of the microbial spore surface protein.
- the amino acid sequence is derived from a N-terminal end of the microbial spore surface protein.
- the substrate surface comprises an animate surface. In one embodiment, the substrate surface comprises an inanimate surface. In one embodiment, the animate surface comprises a body tissue surface. In one embodiment, the body tissue surface comprises a mammalian skin surface. In one embodiment, the inanimate surface comprises stainless steel. In one embodiment, the inanimate surface comprises ceramic. In one embodiment, the inanimate surface comprises vinyl. In one embodiment, the inanimate surface comprises tile. In one embodiment, the carrier comprises a detergent. In one embodiment, the composition further comprises at least one antimicrobial drug. In one embodiment, the carrier is sterile and suitable for human administration. In one embodiment, the composition further comprises an antimicrobial skin cleaner. In one embodiment, the composition further comprises an antimicrobial surface cleaner.
- pharmaceutically refers to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when administered to an animal or a human.
- pharmaceutically acceptable carrier includes any and all solvents, or a dispersion medium including, but not limited to, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils, coatings, isotonic and absorption delaying agents, liposome, commercially available cleansers, and the like. Supplementary bioactive ingredients also can be incorporated into such carriers.
- purified may refer to a peptide composition that has been subjected to treatment (i.e., for example, fractionation) to remove various other components, and which composition substantially retains its expressed biological activity.
- substantially purified this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the composition (i.e., for example, weight/weight and/or weight/ volume).
- purified to homogeneity is used to include compositions that have been purified to 'apparent homogeneity” such that there is single protein species (i.e., for example, based upon SDS-PAGE or HPLC analysis).
- a purified composition is not intended to mean that some trace impurities may remain.
- substantially purified refers to molecules, either nucleic or amino acid sequences, that are removed from their natural environment, isolated or separated, and are at least 60% free, preferably 75% free, and more preferably 90% free from other components with which they are naturally associated.
- An "isolated polynucleotide” is therefore a substantially purified polynucleotide.
- Nucleic acid sequence and “nucleotide sequence” as used herein refer to an oligonucleotide or polynucleotide, and fragments or portions thereof, and to DNA or RNA of genomic or synthetic origin which may be single- or double-stranded, and represent the sense or antisense strand.
- an isolated nucleic acid refers to any nucleic acid molecule that has been removed from its natural state (e.g., removed from a cell and is, in a preferred embodiment, free of other genomic nucleic acid).
- the term "functionally equivalent codon”, as used herein, refers to different codons that encode the same amino acid. This phenomenon is often referred to as “degeneracy" of the genetic code. For example, six different codons encode the amino acid arginine.
- amino acid sequence and “polypeptide sequence” as used herein, are interchangeable and to refer to a sequence of amino acids.
- spore surface protein refers to any protein or peptide fragment that is derived from, or has substantial similarity (i.e., is homologous) to, any bacterial spore exoporium protein. Microbial spore surface proteins are believed responsible for attaching, and immobilizing, a microbial spore to an inanimate and/or animate surface until conditions are sufficient to induce germination.
- BcIA or “BcIA polypeptide” or “BcIA protein” or “BcIA homologue” are used interchangeably to refer to the amino acid sequence of substantially purified Bacillus-like protein, obtained from any species, particularly bacterial species which include gram negative, gram positive, aerobic, and anaerobic bacteria, and obtained from any source whether natural, synthetic, semi-synthetic or recombinant.
- a Clostridium difficile BcIA homologue would have the same function and activity as a Bacillus anthracis BcIA peptide.
- a “variant" of a protein is defined as an amino acid sequence which differs by one or more amino acids from a polypeptide sequence (i.e., for example, SEQ ID NO: 1) or any homolog of the polypeptide sequence.
- the variant may have "conservative" changes, wherein a substituted amino acid has similar structural or chemical properties, e.g., replacement of leucine with isoleucine. More rarely, a variant may have "nonconservative" changes, e.g., replacement of a glycine with a tryptophan. Similar minor variations may also include amino acid deletions or insertions (i.e., additions), or both.
- Guidance in determining which and how many amino acid residues may be substituted, inserted or deleted without abolishing biological or immunological activity may be found using computer programs including, but not limited to, DNAStar ® software.
- a "variant" of a nucleotide is defined as a novel nucleotide sequence which differs from a reference oligonucleotide by having deletions, insertions and substitutions. These maybe detected using a variety of methods (e.g., sequencing, hybridization assays etc.).
- alterations to the genomic DNA sequence which encodes a Clostridium spore surface protein i.e., for example, by alterations in the pattern of restriction enzyme fragments capable of hybridizing to SEQ ID NO: 2 (RFLP analysis), the inability of a selected fragment of SEQ ID NO: 2 to hybridize under high stringency conditions to a sample of genomic DNA (e.g., using allele-specific oligonucleotide probes), and improper or unexpected hybridization, such as hybridization to a locus other than the normal chromosomal locus for a Clostridium spore surface gene (e.g., using fluorescent in situ hybridization (FISH)).
- FISH fluorescent in situ hybridization
- An "insertion” or “addition” is that change in a nucleotide or amino acid sequence which has resulted in the addition of one or more nucleotides or amino acid residues, respectively, as compared to, for example, the naturally occurring Clostridium spore surface protein.
- substitution results from the replacement of one or more nucleotides or amino acids by different nucleotides or amino acids, respectively.
- nucleic acid derivative refers to any chemical modification of a nucleic acid or an amino acid. Illustrative of such modifications would be replacement of hydrogen by an alkyl, acyl, or amino group.
- a nucleic acid derivative would encode a polypeptide which retains essential biological characteristics.
- portion when in reference to a protein (as in “a portion of a given protein”) refers to fragments of that protein.
- the fragments may range in size from four amino acid residues to the entire amino acid sequence minus one amino acid.
- a protein "comprising at least a portion of the amino acid sequence of SEQ ID NO:1" encompasses a full-length Clostridium spore surface protein and fragments thereof of four (4) amino acids or more.
- portion when used in reference to a nucleotide sequence refers to fragments of that nucleotide sequence.
- the fragments may range in size from 5 nucleotide residues to the entire nucleotide sequence minus one nucleic acid residue.
- biologically active refers to any molecule having structural, regulatory or biochemical functions.
- spore surface protein biological activity may be determined, for example, by restoration of wild-type growth in cells lacking spore surface protein activity (i.e., for example, spore surface protein null cells and/or "knock out" cells).
- Cells lacking spore surface protein activity may be produced by many methods (i.e., for example, point mutation and frame-shift mutation). Complementation is achieved by transfecting cells which lack spore surface protein activity with an expression vector which expresses spore surface protein, a derivative thereof, or a portion thereof.
- immunologically active defines the capability of a natural, recombinant or synthetic peptide (i.e., for example, a spore surface protein), or any oligopeptide thereof, to induce a specific immune response in appropriate animals or cells and/or to bind with specific antibodies.
- antigenic determinant refers to that portion of a molecule that is recognized by a particular antibody (i.e., an epitope).
- a protein or fragment of a protein is used to immunize a host animal, numerous regions of the protein may induce the production of antibodies which bind specifically to a given region or three-dimensional structure on the protein; these regions or structures are referred to as antigenic determinants.
- An antigenic determinant may compete with the intact antigen (i.e., the immunogen used to elicit the immune response) for binding to an antibody.
- immunogen refers to any substance capable of generating antibodies when introduced into an animal.
- an immunogen must contain at least one epitope (the specific biochemical unit capable of causing an immune response), and generally contains many more. Proteins are most frequently used as immunogens, but lipid and nucleic acid moieties complex ed with proteins may also act as immunogens. The latter complexes are often useful when smaller molecules with few epitopes do not stimulate a satisfactory immune response by themselves.
- antibody refers to immunoglobulin evoked in animals by an immunogen (antigen). It is desired that the antibody demonstrates specificity to epitopes contained in the immunogen.
- polyclonal antibody refers to immunoglobulin produced from more than a single clone of plasma cells; in contrast “monoclonal antibody” refers to immunoglobulin produced from a single clone of plasma cells.
- telomere binding when used in reference to the interaction of an antibody and a protein or peptide means that the interaction is dependent upon the presence of a particular structure (i.e., for example, an antigenic determinant or epitope) on a protein; in other words an antibody is recognizing and binding to a specific protein structure rather than to proteins in general.
- a particular structure i.e., for example, an antigenic determinant or epitope
- an antibody is recognizing and binding to a specific protein structure rather than to proteins in general.
- an antibody is specific for epitope "A”
- the presence of a protein containing epitope A (or free, unlabelled A) in a reaction containing labeled "A” and the antibody will reduce the amount of labeled A bound to the antibody.
- recombinant DNA molecule refers to a DNA molecule which is comprised of segments of DNA joined together by means of molecular biological techniques.
- recombinant protein or “recombinant polypeptide” as used herein refers to a protein molecule which is expressed using a recombinant DNA molecule.
- vector and “vehicle” are used interchangeably in reference to nucleic acid molecules that transfer DNA segment(s) from one cell to another.
- expression vector or "expression cassette” as used herein refers to a recombinant DNA molecule containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism.
- Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences.
- Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
- in operable combination refers to the linkage of nucleic acid sequences in such a manner that a nucleic acid molecule capable of directing the transcription of a given gene and/or the synthesis of a desired protein molecule is produced.
- the term also refers to the linkage of amino acid sequences in such a manner so that a functional protein is produced.
- transfection refers to the introduction of foreign DNA into cells.
- Transfection may be accomplished by a variety of means known to the art including calcium phosphate-DNA co -precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, lipofection, protoplast fusion, retroviral infection, biolistics (i.e., particle bombardment) and the like.
- the terms “complementary” or “complementarity” are used in reference to “polynucleotides” and “oligonucleotides” (which are interchangeable terms that refer to a sequence of nucleotides) related by the base-pairing rules.
- the sequence “C-A-G-T” is complementary to the sequence “G-T-C-A.”
- Complementarity can be “partial” or “total.”
- Partial complementarity is where one or more nucleic acid bases is not matched according to the base pairing rules.
- Total or “complete” complementarity between nucleic acids is where each and every nucleic acid base is matched with another base under the base pairing rules.
- the degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, as well as detection methods which depend upon binding between nucleic acids.
- nucleotide sequences refer to a degree of complementarity with other nucleotide sequences. There maybe partial homology or complete homology (i.e., identity).
- a nucleotide sequence which is partially complementary, i.e., “substantially homologous,” to a nucleic acid sequence is one that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid sequence. The inhibition of hybridization of the completely complementary sequence to the target sequence may be examined using a hybridization assay (Southern or Northern blot, solution hybridization and the like) under conditions of low stringency.
- a substantially homologous sequence or probe will compete for and inhibit the binding (i.e., the hybridization) of a completely homologous sequence to a target sequence under conditions of low stringency. This is not to say that conditions of low stringency are such that non-specific binding is permitted; low stringency conditions require that the binding of two sequences to one another be a specific (i.e., selective) interaction.
- the absence of non-specific binding may be tested by the use of a second target sequence which lacks even a partial degree of complementarity (e.g., less than about 30% identity); in the absence of non-specific binding the probe will not hybridize to the second non- complementary target.
- homologous refers to the degree of identity of the primary structure between two amino acid sequences. Such a degree of identity may be directed a portion of each amino acid sequence, or to the entire length of the amino acid sequence.
- Two or more amino acid sequences that are “substantially homologous” may have at least 50% identity, preferably at least 75% identity, more preferably at least 85% identity, most preferably at least 95%, or 100% identity.
- oligonucleotide sequence which is a "homolog" of a Clostridium spore surface protein nucleic acid sequence is defined herein as an oligonucleotide sequence which exhibits greater than or equal to 50% identity to the sequence of SEQ ID NO: 2 when sequences having a length of 100 bp or larger are compared.
- a homolog of SEQ ID NO: 2 is defined as an oligonucleotide sequence which encodes a biologically active Clostridium spore surface protein amino acid sequence.
- a Clostridium spore surface protein homolog may comprise a portion of an oligonucleotide sequence encoding a spore surface protein.
- Low stringency conditions comprise conditions equivalent to binding or hybridization at 42°C in a solution consisting of 5 x SSPE (43.8 g/1 NaCl, 6.9 g/1 NaH 2 PO 4 -H 2 O and 1.85 g/1 EDTA, pH adjusted to 7.4 with NaOH), 0.1 % SDS, 5x Denhardt's reagent ⁇ 50x Denhardt's contains per 500 ml: 5 g Ficoll (Type 400, Pharmacia), 5 g BSA (Fraction V; Sigma) ⁇ and 100 ⁇ g/ml denatured salmon sperm DNA followed by washing in a solution comprising 5x SSPE, 0.1% SDS at 42°C when a probe of about 500 nucleotides in length, is employed.
- 5 x SSPE 43.8 g/1 NaCl, 6.9 g/1 NaH 2 PO 4 -H 2 O and 1.85 g/1 EDTA, pH adjusted to 7.4 with NaOH
- low stringency conditions may also be employed to comprise low stringency conditions; factors such as the length and nature (DNA, RNA, base composition) of the probe and nature of the target ( DNA, RNA, base composition, present in solution or immobilized, etc.) and the concentration of the salts and other components (e.g., the presence or absence of formamide, dextran sulfate, polyethylene glycol), as well as components of the hybridization solution may be varied to generate conditions of low stringency hybridization different from, but equivalent to, the above listed conditions.
- conditions which promote hybridization under conditions of high stringency e.g., increasing the temperature of the hybridization and/or wash steps, the use of formamide in the hybridization solution, etc.
- high stringency e.g., increasing the temperature of the hybridization and/or wash steps, the use of formamide in the hybridization solution, etc.
- hybridization is used in reference to the pairing of complementary nucleic acids using any process by which a strand of nucleic acid joins with a complementary strand through base pairing to form a hybridization complex.
- Hybridization and the strength of hybridization is impacted by such factors as the degree of complementarity between the nucleic acids, stringency of the conditions involved, the T m of the formed hybrid, and the G:C ratio within the nucleic acids.
- hybridization complex refers to a complex formed between two nucleic acid sequences by virtue of the formation of hydrogen bounds between complementary G and C bases and between complementary A and T bases; these hydrogen bonds may be further stabilized by base stacking interactions.
- the two complementary nucleic acid sequences hydrogen bond in an antiparallel configuration.
- a hybridization complex may be formed in solution (e.g., C 0 1 or Ro t analysis) or between one nucleic acid sequence present in solution and another nucleic acid sequence immobilized to a solid support (e.g., a nylon membrane or a nitrocellulose filter as employed in Southern and Northern blotting, dot blotting or a glass slide as employed in in situ hybridization, including FISH (fluorescent in situ hybridization)).
- a solid support e.g., a nylon membrane or a nitrocellulose filter as employed in Southern and Northern blotting, dot blotting or a glass slide as employed in in situ hybridization, including FISH (fluorescent in situ hybridization)).
- T n is used in reference to the "melting temperature.”
- the melting temperature is the temperature at which a population of double-stranded nucleic acid molecules becomes half dissociated into single strands.
- T 11 , 81.5 + 0.41 (% G+C)
- stringency is used in reference to the conditions of temperature, ionic strength, and the presence of other compounds such as organic solvents, under which nucleic acid hybridizations are conducted. "Stringency” typically occurs in a range from about T m to about 20 0 C to 25°C below T m .
- a “stringent hybridization” can be used to identify or detect identical polynucleotide sequences or to identify or detect similar or related polynucleotide sequences.
- fragments of SEQ ID NO: 2 when fragments of SEQ ID NO: 2 are employed in hybridization reactions under stringent conditions the hybridization of fragments of SEQ ID NO: 2 which contain unique sequences (i.e., regions which are either non-homologous to or which contain less than about 50% homology or complementarity with SEQ ID NOs: 2) are favored.
- conditions of "weak” or “low” stringency when conditions of "weak" or “low” stringency are used hybridization may occur with nucleic acids that are derived from organisms that are genetically diverse (i.e., for example, the frequency of complementary sequences is usually low between such organisms).
- amplifiable nucleic acid is used in reference to nucleic acids which may be amplified by any amplification method. It is contemplated that "amplifiable nucleic acid” will usually comprise "sample template.”
- sample template refers to nucleic acid originating from a sample which is analyzed for the presence of a target sequence of interest.
- background template is used in reference to nucleic acid other than sample template which may or may not be present in a sample. Background template is most often inadvertent. It maybe the result of carryover, or it may be due to the presence of nucleic acid contaminants sought to be purified away from the sample. For example, nucleic acids from organisms other than those to be detected may be present as background in a test sample.
- Amplification is defined as the production of additional copies of a nucleic acid sequence and is generally carried out using polymerase chain reaction. Dieffenbach C. W. and G. S. Dveksler (1995) In: PCR Primer, a Laboratory Manual. Cold Spring Harbor Press, Plainview, N.Y.
- PCR polymerase chain reaction
- PCR it is possible to amplify a single copy of a specific target sequence in genomic DNA to a level detectable by several different methodologies (e.g., hybridization with a labeled probe; incorporation of biotinylated primers followed by avidin-enzyme conjugate detection; incorporation of 32 P-labeled deoxynucleotide triphosphates, such as dCTP or dATP, into the amplified segment).
- any oligonucleotide sequence can be amplified with the appropriate set of primer molecules.
- the amplified segments created by the PCR process itself are, themselves, efficient templates for subsequent PCR amplifications.
- the term "primer” refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced, (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH).
- the primer is preferably single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products.
- the primer is an oligodeoxyribonucleotide.
- the primer must be sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. The exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.
- probe refers; to an oligonucleotide (i.e., a sequence of nucleotides), whether occurring naturally as in a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, which is capable of hybridizing to another oligonucleotide of interest.
- a probe may be single-stranded or double-stranded. Probes are useful in the detection, identification and isolation of particular gene sequences.
- any probe used in the present invention will be labeled with any "reporter molecule,” so that is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA, as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. It is not intended that the present invention be limited to any particular detection system or label.
- the terms "restriction endonucleases” and “restriction enzymes” refer to bacterial enzymes, each of which cut double-stranded DNA at or near a specific nucleotide sequence. DNA molecules are said to have "5' ends” and “3' ends” because mononucleotides are reacted to make oligonucleotides in a manner such that the 5' phosphate of one mononucleotide pentose ring is attached to the 3' oxygen of its neighbor in one direction via a phosphodiester linkage.
- an end of an oligonucleotide is referred to as the "5' end” if its 5' phosphate is not linked to the 3' oxygen of a mononucleotide pentose ring.
- An end of an oligonucleotide is referred to as the "3 1 end” if its 3' oxygen is not linked to a 5' phosphate of another mononucleotide pentose ring.
- a nucleic acid sequence even if internal to a larger oligonucleotide, also may be said to have 5' and 3' ends, hi either a linear or circular DNA molecule, discrete elements are referred to as being "upstream” or 5' of the "downstream” or 3' elements.
- This terminology reflects the fact that transcription proceeds in a 5' to 3 1 fashion along the DNA strand.
- the promoter and enhancer elements which direct transcription of a linked gene are generally located 5' or upstream of the coding region. However, enhancer elements can exert their effect even when located 3' of the promoter element and the coding region. Transcription termination and polyadenylation signals are located 3' or downstream of the coding region.
- an oligonucleotide having a nucleotide sequence encoding a gene means a nucleic acid sequence comprising the coding region of a gene, i.e. the nucleic acid sequence which encodes a gene product.
- the coding region may be present in a cDNA, genomic DNA or RNA form.
- the oligonucleotide maybe single-stranded (i.e., the sense strand) or double-stranded.
- Suitable control elements such as enhancers/promoters, splice junctions, polyadenylation signals, etc.
- the coding region utilized in the expression vectors of the present invention may contain endogenous enhancers/promoters, splice junctions, intervening sequences, polyadenylation signals, etc. or a combination of both endogenous and exogenous control elements.
- regulatory element refers to a genetic element which controls some aspect of the expression of nucleic acid sequences.
- a promoter is a regulatory element which facilitates the initiation of transcription of an operably linked coding region.
- Other regulatory elements are splicing signals, polyadenylation signals, termination signals, etc.
- Promoters and enhancers consist of short arrays of DNA sequences that interact specifically with cellular proteins involved in transcription. Maniatis, T. et al., Science 236:1237 (1987). Promoter and enhancer elements have been isolated from a variety of eukaryotic sources including genes in plant, yeast, insect and mammalian cells and viruses (analogous control elements, i.e., promoters, are also found in prokaryotes). The selection of a particular promoter and enhancer depends on what cell type is to be used to express the protein of interest.
- Splicing signals mediate the removal of introns from the primary RNA transcript and consist of a splice donor and acceptor site.
- poly A site or "poly A sequence” as used herein denotes a DNA sequence which directs both the termination and polyadenylation of the nascent RNA transcript. Efficient polyadenylation of the recombinant transcript is desirable as transcripts lacking a poly A tail are unstable and are rapidly degraded.
- the poly A signal utilized in an expression vector may be "heterologous” or "endogenous.” An endogenous poly A signal is one that is found naturally at the 3' end of the coding region of a given gene in the genome. A heterologous poly A signal is one which is isolated from one gene and placed 3' of another gene.
- Efficient expression of recombinant DNA sequences in eukaryotic cells involves expression of signals directing the efficient termination and polyadenylation of the resulting transcript. Transcription termination signals are generally found downstream of the polyadenylation signal and are a few hundred nucleotides in length.
- transfection or "transfected” refers to the introduction of foreign DNA into a cell.
- nucleic acid molecule encoding refers to the order or sequence of deoxyribonucleotides along a strand of deoxyribonucleic acid. The order of these deoxyribonucleotides determines the order of amino acids along the polypeptide (protein) chain. The DNA sequence thus codes for the amino acid sequence.
- antisense is used in reference to RNA sequences which are complementary to a specific RNA sequence (e.g., mRNA).
- Antisense RNA may be produced by any method, including synthesis by splicing the gene(s) of interest in a reverse orientation to a viral promoter which permits the synthesis of a coding strand. Once introduced into a cell, this transcribed strand combines with natural mRNA produced by the cell to form duplexes. These duplexes then block either the further transcription of the mRNA or its translation. In this manner, mutant phenotypes may be generated.
- the term “antisense strand” is used in reference to a nucleic acid strand that is complementary to the "sense" strand.
- the designation (-) (i.e., "negative") is sometimes used in reference to the antisense strand, with the designation (+) sometimes used in reference to the sense (i.e., "positive") strand.
- the term "Southern blot” refers to the analysis of DNA on agarose or acrylamide gels to fractionate the DNA according to size, followed by transfer and immobilization of the DNA from the gel to a solid support, such as nitrocellulose or a nylon membrane. The immobilized DNA is then probed with a labeled oligodeoxyribonucleotide probe or DNA probe to detect DNA species complementary to the probe used.
- the DNA may be cleaved with restriction enzymes prior to electrophoresis.
- Southern blots are a standard tool of molecular biologists. J. Sambrook et al. (1989) In: Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, NY, pp 9.31-9.58.
- the term "Northern blot” as used herein refers to the analysis of RNA by electrophoresis of RNA on agarose gels to fractionate the RNA according to size followed by transfer of the RNA from the gel to a solid support, such as nitrocellulose or a nylon membrane.
- RNA species complementary to the probe used are then probed with a labeled oligodeoxyribonucleotide probe or DNA probe to detect RNA species complementary to the probe used.
- Northern blots are a standard tool of molecular biologists. J. Sambrook, J. et al. (1989) supra, pp 7.39-7.52.
- reverse Northern blot refers to the analysis of DNA by electrophoresis of DNA on agarose gels to fractionate the DNA on the basis of size followed by transfer of the fractionated DNA from the gel to a solid support, such as nitrocellulose or a nylon membrane.
- a solid support such as nitrocellulose or a nylon membrane.
- the immobilized DNA is then probed with a labeled oligoribonuclotide probe or RNA probe to detect DNA species complementary to the ribo probe used.
- coding region when used in reference to a structural gene refers to the nucleotide sequences which encode the amino acids found in the nascent polypeptide as a result of translation of a mRNA molecule.
- the coding region is bounded, in eukaryotes, on the 5' side by the nucleotide triplet "ATG” which encodes the initiator methionine and on the 3' side by one of the three triplets which specify stop codons (i.e., TAA, TAG, TGA).
- structural gene refers to a DNA sequence coding for RNA or a protein.
- regulatory genes are structural genes which encode products which control the expression of other genes (e.g., transcription factors).
- the term “gene” means the deoxyribonucleotide sequences comprising the coding region of a structural gene and including sequences located adjacent to the coding region on both the 5 1 and 3' ends for a distance of about 1 kb on either end such that the gene corresponds to the length of the full-length mRNA.
- the sequences which are located 5' of the coding region and which are present on the mRNA are referred to as 5' non-translated sequences.
- the sequences which are located 3' or downstream of the coding region and which are present on the mRNA are referred to as 3' non-translated sequences.
- the term “gene” encompasses both cDNA and genomic forms of a gene.
- a genomic form or clone of a gene contains the coding region interrupted with non-coding sequences termed "introns” or “intervening regions” or “intervening sequences.”
- Introns are segments of a gene which are transcribed into heterogeneous nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers. Introns are removed or “spliced out” from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript.
- mRNA messenger RNA
- genomic forms of a gene may also include sequences located on both the 5' and 3' end of the sequences which are present on the RNA transcript. These sequences are referred to as "flanking" sequences or regions (these flanking sequences are located 5 ' or 3' to the non-translated sequences present on the mRNA transcript).
- the 5' flanking region may contain regulatory sequences such as promoters and enhancers which control or influence the transcription of the gene.
- the 3' flanking region may contain sequences which direct the termination of transcription, posttranscriptional cleavage and polyadenylation.
- sample as used herein is used in its broadest sense and includes environmental and biological samples.
- Environmental samples include material from the environment such as soil and water.
- Biological samples may be animal, including, human, fluid (e.g., blood, plasma and serum), solid (e.g., stool), tissue, liquid foods (e.g., milk), and solid foods (e.g., vegetables).
- a biological sample suspected of containing nucleic acid encoding a spore surface protein may comprise a cell, tissue extract, body fluid, chromosomes or extrachromosomal elements isolated from a cell, genomic DNA (in solution or bound to a solid support such as for Southern blot analysis), RNA (in solution or bound to a solid support such as for Northern blot analysis), cDNA (in solution or bound to a solid support) and the like.
- infection control composition refers to any compound or compounds which prevent and/or reduce the rate of growth of an organism (i.e., for example, a microbial organism, including spores derived from a microbial organism) compared to the rate of growth of the organism in the absence of the composition.
- An infection control composition can be natural (e.g., derived from a microbe such as a bacteria, virus, fungi, algae, mold etc.), synthetic, or recombinant.
- An infection control composition may be a competitive inhibitor of a microbial spore protein and/or a microbial spore surface protein.
- an infection control composition may form stable and/or transient binding pairs with microbial spore proteins and/or microbial spore surface proteins.
- An 'infection control composition may also include antibacterial and/or antimicrobial agents and/or drugs (i.e., for example, antibiotics). Consequently, "infection control activity" is interpreted to mean any reduction and/or prevention of microbial growth as a result of the application of an infection control composition to a surface.
- antibacterial and “antimicrobial” are used interchangeably to refer to a composition which prevents and/or reduces the rate of growth of an organism compared to the rate of growth of the organism in the absence of the composition.
- An antibacterial and/or antimicrobial composition can be bacteriostatic, bactericidal, both, or neither.
- An antibacterial and/or antimicrobial composition is bacteriostatic if it inhibits cell division without affecting the viability of the inhibited cell.
- An antibacterial and/or antimicrobial composition is bactericidal if it causes cell death. Cell death is commonly detected by the absence of cell growth in liquid growth medium (e.g., absence of turbidity) or on a solid surface (e.g., absence of colony formation on agar).
- An antibacterial and/or antimicrobial composition may be effective to reduce the growth rate and/or cause cell death for viruses, molds, and fungi.
- a composition which is bacteriostatic at a given concentration may be bactericidal at a higher concentration, while other certain bacteriostatic compositions are not bactericidal at any concentration.
- the term "bacteria” and "bacterium” refer to all prokaryotic organisms, including those within all of the phyla in the Kingdom Procaryotae. It is intended that the term encompass all microorganisms considered to be bacteria including, but not limited to, Clostridia, Bacillus, Mycoplasma, Chlamydia, Actinomyces, Streptomyces, and Rickettsia.
- Gram negative bacteria are bacteria which retain the primary dye used in the Gram stain, causing the stained cells to appear dark blue to purple under the microscope.
- Gram negative bacteria do not retain the primary dye used in the Gram stain, but are stained by a counter stain. Thus, gram negative bacteria appear red.
- test agent refers to an agent that is to be screened in one or more of the assays described herein.
- the agent can be virtually any chemical compound. It can exist as a single isolated compound or can be a member of a chemical (e.g., combinatorial) library. In a particularly preferred embodiment, the test agent will be a small organic molecule.
- small organic molecule refers to any molecule of a size comparable to those organic molecules generally used in pharmaceuticals.
- Preferred small organic molecules range in size from approximately 10 Da up to about 5000 Da, more preferably up to 2000 Da, and most preferably up to about 1000 Da.
- label or “detectable label” are used herein, to refer to any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
- labels include biotin for staining with labeled streptavidin conjugate, magnetic beads (e.g., Dynabeads ), fluorescent dyes (e.g., fluorescein, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3 H, 125 1, 35 S, 14 C, or 32 P), enzymes (e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and calorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, latex, etc.) beads.
- fluorescent dyes e.g., fluorescein, texas red, rhodamine, green fluorescent protein, and the like
- Patents teaching the use of such labels include, but are not limited to, U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241 (all herein incorporated by reference).
- the labels contemplated in the present invention may be detected by many methods. For example, radiolabels may be detected using photographic film or scintillation counters, fluorescent markers maybe detected using a photodetector to detect emitted light.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting, the reaction product produced by the action of the enzyme on the substrate, and calorimetric labels are detected by simply visualizing the colored label.
- primary surfactant means any surfactant which acts upon or in conjunction with a substituted phenol to enhance further, or at the least, to not significantly reduce infection control activity of a substituted phenol.
- inhibitor refers to any means wherein a microbial spore and/or microbial spore surface protein is removed from, and/or prevented from attaching to, a substrate surface.
- an antagonist refers to any compound that is capable of preventing the attachment of a microbe (i.e., for example, bacteria, virus, mold, fungi etc) and/or a reproductive component of the microbe (i.e., for example, a spore) to a surface.
- the 'antagonist' may prevent attachment by either competitive displacement or by forming a binding pair (i.e., for example, stable or transient) with the microbe and/or reproductive component of the microbe.
- an antagonist may prevent the attachment of a bacterial spore to a surface by binding to a spore surface protein.
- binding antagonist refers to any compound that is capable of forming a binding pair with either a microbial spore nap layer protein (i.e., for example, a Clostridium spore surface protein) or a substrate surface. A formation of either binding pair prevents and/or displaces the attachment of a microbial spore to a substrate surface.
- substrate surface refers to any material comprising a binding site for a microbial spore surface protein attachment.
- a substrate surface may including but not limited to, an animate surface and/or an inanimate surface.
- an inanimate surface refers to any non-living material.
- an inanimate surface may include but is not limited to, vinyl, stainless steel, plastic, wood, ceramic, glass, chrome, tile etc.
- Such surfaces commonly encountered including but not limited to countertops, chairs, tables, surgical equipment, medical devices, floors, walls, windows, sinks, cabinets etc.
- an animate surface refers to any living material.
- an animate surface may include but is not limited to, epidermal skin surfaces, mucosal epithelial tissue surfaces, and/or internal organ surfaces.
- the term “animate surface” also comprises vegetative surfaces including but not limited to, fruit surfaces (i.e., for example, strawberries, apples, oranges, tangerines etc.), vegetable surfaces (eggplant, squash, tomatoes, potato etc), legume surfaces (i.e., for example, peanuts, cashews, beans etc), grain surfaces (i.e., for example, wheat, soy, rice, rye etc), flower surfaces, stem surfaces, stalk surfaces, leaf surfaces, bark surfaces, limb surfaces, branch surfaces, etc.
- fruit surfaces i.e., for example, strawberries, apples, oranges, tangerines etc.
- vegetable surfaces eggplant, squash, tomatoes, potato etc
- legume surfaces i.e., for example, peanuts, cashews, beans etc
- grain surfaces i.e., for example, wheat
- interaction antagonist refers to any compound that is capable of interfering with the formation of a microbial spore nap layer protein/substrate surface binding pair.
- binding refers to any interaction between an infection control composition and a surface. Such as surface is defined as a "binding surface”. Binding may be reversible or irreversible. Such binding may be, but is not limited to, non-covalent binding, covalent bonding, ionic bonding, Van de Waal forces or friction, and the like.
- An infection control composition is bound to a surface if it is impregnated, incorporated, coated, in suspension with, in solution with, mixed with, etc.
- infection control test composition refers to the collection of compounds that are to be screened for their ability to prevent microbial spore binding to a surface.
- test compositions may include, but are not limited to, a wide variety of different compounds, including chemical compounds, mixtures of chemical compounds, e.g., polysaccharides, small organic or inorganic molecules, biological macromolecules, e.g., peptides, proteins, nucleic acids, or an extract made from biological materials such as bacteria, plants, fungi, or animal cells or tissues, naturally occurring or synthetic compositions.
- At risk refers to any person or inanimate surface having a more than average probability (i.e., greater than 50%) of becoming contaminated with a microbe.
- 'At risk' probabilities of exposure may be found in vocations such as first responders including, but not limited to, fireman, policeman, emergency medical personnel.
- 'At risk' probabilities of exposure may also be found in vocations such as healthcare workers including, but not limited to, doctors, nurses, orderlies, hospital janitorial staff and the like.
- 'At risk' probabilities of exposure may also be found in vocations such as military personnel including, but not limited to, Army personnel, Navy personnel, Air Force personnel, Marine personnel, National Guard personnel, Coast Guard personnel.
- 'At risk' probabilities of exposure may also be found in medical patients, including, but not limited to, immunocompromised patients, burn patients, gunshot patients etc.
- binding site pattern refers to any reproducible set of binding sites on either a body surface or inanimate surface. Such binding sites have inherent affinity for compositions including, but not limited to, microbial spores, infection control compositions, or small organic molecules as discussed herein. Although it is not necessary to understand the mechanism of an invention, it is believed that such a binding pattern is a result of unique arrangements of surface chemical groups and/or topography that is three-dimensionally compatible (i.e., for example, via stereospecific chemical group interactions) with a composition. It is further believed that a specific binding site pattern predicts an arrangement of non-specific binding (i.e., that binding not mediated via a dedicated receptor) within a designated surface area.
- Figure 1 presents an exemplary scanning electron micrograph of a C. sporogens endospores (S) having long, sinuous, or filiform exosporial membrane projections (arrows). Projections facing the surface form tenacious contacts.
- Figure 2 presents an exemplary electron micrograph showing C. difficile 43594 smooth-surfaced, elliptical endospore before activation (insert), and covered with exosporial projections (arrows) following activation.
- Figure 3 presents an exemplary electron micrograph showing a C. difficile 43594 spore as germination proceeds wherein an exosporial membrane is covered with low bumps and a thick anchoring structure at one pole, designated the tail (T) region.
- Figure 4 presents exemplary data showing an SDS-PAGE gel identifying the total spore proteins present in the 18 kDa band (see arrow). This 18 kDa band corresponds with Western Blot 18kDa bands capable of hybridizing C. difficile antibodies.
- Figure 5 presents exemplary data showing an SDS-PAGE gel identifying the total spore proteins present in the 140, 150, and 160 kDa bands (see pi, p2, and ⁇ 3, respectively). These 140, 150, and 160 kDa bands correspond with Western Blot 140, 150, and 160 kDa bands capable of hybridizing C. difficile antibodies.
- Figure 6A presents exemplary data showing an SDS-PAGE gel used to identify C. difficile exosporium proteins at approximately 300 kDa (arrow 1); 275 kDa (arrow 2); 250 kDa (arrow 3); 160 kDa (arrow 4); 150 kDa (arrow 5); 140 kDa (arrow 6); 35 kDa (arrow 7); 28 kDa (arrow 8); and 15 kDa (arrow 9).
- Six other non-hybridizing bands (arrows 10-15) were also identified to determine the non-immunoreactive exosporium proteins.
- Figures 6B and 6C present exemplary data showing Western blots demonstrating C difficile antibody hybridization to 300 kDa (arrow 1); 275 kDa (arrow 2); 250 kDa (arrow 3); 160 kDa (arrow 4); 150 kDa (arrow 5); 140 kDa (arrow 6); 35 kDa (arrow 7); 28 kDa (arrow 8); and 15 kDa (arrow 9) bands corresponding to those bands shown in Figure 6A.
- Figure 7 presents one embodiment of a structure for: BcIA (green) and CIq (mauve) monomers (A and B), respectively and their superposition (C). The N and C termini and the ⁇ -strands are labeled.
- Figure 8 presents one embodiment of BcIA (A) and CIq (B) trimers viewed from the side and from above.
- the three monomers comprising each trimer are colored blue, green, and red.
- Figure 9A presents an exemplary transmission electron micrographs of a B. cereus
- Figure 9B presents an exemplary transmission electron micrograph of a B. anthracis spore showing a nap layer projecting from the exosporium.
- Figure9C presents an exemplary close-up of a B. anthracis exosporium layer showing the BcIA nap layer and the interior basal layer.
- Figure 10 presents an illustration of embodiments showing microbial spore interactions with surface substrates (i.e., for example, skin surfaces).
- Figure 1OA illustrates the attachment of a microbial spore nap layer (i.e., for example, by spore surface protein projections) to the epithelial layer of mammalian skin.
- Figure 1 OB illustrates the attachment of a microbial spore surface protein (i.e., for example a native to a surface substrate and various infection control compositions capable of disrupting the attachment of the microbial spore surface proteins to a surface substrate.
- Figure 11 presents a schematic of one embodiment of a pET-19b plasmid comprising a spore surface protein gene.
- Figure 12 presents exemplary data showing an SDS-PAGE electrophoretic separation of recombinant CD 1067 (red arrow) expression from a pET-19b vector.
- Lane 1 MW standards ladder.
- Lane 2 1 hour sample.
- Lane 3 2 hour sample.
- Lane 4 3 hour sample:
- Lane 5 4 hour sample:
- Lane 6 5 hour sample.
- Lane 7 6 hour sample.
- Protein Stain Coomassie Blue.
- Figure 13 presents exemplary data showing Western Blot analysis of recombinant CDl 067 (red arrows) expression from a pET-19b vector.
- Lane 1 MW standards ladder.
- Lane 2 1 hour sample.
- Lane 3 2 hour sample.
- Lane 4 3 hour sample:
- Lane 5 4 hour sample:
- Lane 6 5 hour sample.
- Lane 7 6 hour sample.
- Figure 13A Detection using F 1373 anti-C. difficile antibody.
- Figure 13B Detection using anti-HIS antibody.
- Figure 14 presents exemplary data showing an SDS-PAGE electrophoretic separation of recombinant CD3620 (red arrow) expression from a pET-19b vector. Lane 1 : MW standards ladder. Lane 2: 0 hour sample. Lane 3: 1 hour sample. Lane 4: 2 hour sample: Lane 5: 3 hour sample: Lane 6: 4 hour sample. Lane 7: 4.5 hour sample. Protein Stain: Coomassie Blue.
- Figure 15 presents exemplary data showing Western Blot analysis of recombinant
- CD3620 red arrows expression from a pET-19b vector.
- Lane 1 MW standards ladder.
- Lane 2 0 hour sample.
- Lane 3 1 hour sample.
- Lane 4 2 hour sample:
- Lane 5 3 hour sample:
- Lane 6 4 hour sample.
- Lane 7 4.5 hour sample.
- Figure 15 A Detection using Fl 373 anti-C. difficile antibody.
- Figure 15B Detection using anti-HIS antibody.
- Figure 16 presents exemplary data showing antibody detection control data for recombinant CD3620 (red arrows) expression from a pET-19b vector.
- Lane 1 MW standards ladder.
- Lane 2 6 hour pJEB02 sample.
- Lane 3 4.5 hour pJEB03 sample.
- Figure 16A SDS-PAGE Coomassie Blue reference electrophoresis separation identifying recombinant CD 1067 (top red arrow) and recombinant CD3620 (bottom red arrow).
- Figure 16B Western Blot analysis using preimmune F 1373 detection.
- Figure 16C Western Blot analysis using preimmune F 1997 detection.
- Figure 16D Western Blot analysis using F 1997 anti-C. difficile antibody detection.
- Figure 17 illustrate several embodiments of a method to remove a C. difficile exosporium coat (see, Example IV).
- Figure 18A depicts a representative C. difficile 630 spore that may be used as starting material.
- Figure 18B depicts a representative C. difficile 630 spore after exosporium stripping.
- Figure 18C depicts a purified and concentrated representative C. difficile 630 spore exoporium after stripping.
- the present invention is related to the field of infection control.
- the invention is related to compositions and methods for maintenance of antiseptic conditions, bacterial decontamination, and/or bacterial exposure prophylaxis.
- the invention contemplates infection control compositions that inhibit microbial spore binding to a substrate surface. For example, the inhibition disrupts and/or displaces an interaction, attachment, and/or stabilization of a microbial spore to a substrate surface.
- antibiotics For approximately 70 years, the first line of defense against bacterial infection has been antibiotics. The first antibiotics were used clinically in the 1940s and 1950s, and their use has been increasing significantly since this period. Although an invaluable advance, antibiotic and antimicrobial therapy suffers from several problems. First, antibiotics are ineffective against spores. Second, the development of antibiotic resistance is a serious and life-threatening event of worldwide importance. For example, some microbial strains are known to be immune to a majority of available antibiotics. (Travis, Science 264:360-362 (1994). Among other drug resistant organisms are: pneumococci that cause pneumonia and meningitis; Cryptosporidium and E. coli that cause diarrhea; and enterococci that cause blood-stream, surgical wound and urinary tract infections.
- the present invention contemplates compositions and methods directed towards solving problems regarding contamination control of microbial spores and the clinical resistance of microbial infection to conventional antibiotic administration.
- Bacterial Spores Some microbes shed spores that enter a dormant phase when exposed to environments that do not favor growth and proliferation. Spore survival is enhanced when attachment and/or adhesion to a solid surface is made. When the environmental conditions again change to favor growth and proliferation the microbial spore germinates and proceeds to contaminate the surrounding area. A person or animal coming into contact with the proliferating new microbial growth then becomes infected from an area previously unknown to be contaminated. In some cases, a person and/or animal may come into contact with the microbial spore wherein germination and infection proceeds after contact. Alternatively, such undetected spore germination can result in food spoilage thereby initiating food-borne illness outbreaks.
- the hydrophobicity of bacterial spores can be determined by applying methodologies used for measuring vegetative cell hydrophobicity.
- Established techniques for measuring surface hydrophobicity include, but are not limited to: i) adherence to hydrocarbons (Beck et al., "Effect of growth on surface charge and hydrophobicity of Staphylococcus aureus” Ann. Inst. Pasteur -/Microbiol.
- the present invention contemplates compositions and methods to improve surface sanitation, sterilization of equipment and/or packaging materials used in the medical, pharmaceutical, and/or food industries. In one embodiment, the present invention contemplates compositions and methods to improve skin sanitation.
- This genus survives well under adverse conditions by forming dehydrated endospores that are highly resistant to heat, chemicals, and radiation. These spores can be found in soil, carried by the wind, recovered from mammalian digestive and urogenital tracts, and have the ability to remain dormant for very extended periods of time until conditions for growth support spore activation and germination.
- C. difficile spores are prevalent within healthcare and hospital environments. C. difficile spores survive on animate and/or inanimate surfaces for a prolonged period, are resistant to many disinfectants and antibiotics, and are easily transmitted from patient to patient. Understanding C. difficile spore attachment to surfaces, as well as sporulation and germination, will help in the prevention, control, and treatment of C. difficile- associated disease.
- C. difficile lacks several genes that are involved in the phospho-relay system that triggers the sporulation process in Bacillus species; this, and other aspects of the sporulation system in Clostridia spp have recently been reviewed. Paredes et al., "A comparative genomic view of clostridial sporulation and physiology" Nat. Rev.
- C. difficile also lacks a tricistronic ger operon that are usually present in most Bacillus and Clostridium species.. Moir et al., "Spore germination” Cell MoI Life Sci. 59:403-409 (2002); and Broussolle et al., "Molecular and physiological characterisation of spore germination in Clostridium botulinum and C. sporogenes” Anaerobe 8:89-100 (2002). These observations suggest that the C. difficile germinant receptors are substantially different from, and should not be identified on the basis of sequence similarity to, other Clostridium spp. and Bacillus spp.
- Clostridium difficile infection in hospitals and nursing homes presents a serious epidemiologic problem because spores are found on walls, floors, utensils, bed sheets, and on the hands of caregivers in health facilities.
- the spores easily seem to infect individuals including, but not limited to, those who have: i) an altered intestinal flora from antibiotic therapy; ii) a compromised immune system, or iii) require multiple enemas in relation to diagnostic testing or treatment.
- the exosporia from two species of Clostridium spores may play a role in attachment, germination, and/or colonization.
- Panessa-Warren et al. "Exosporial membrane plasticity of Clostridium sporogens and Clostridium difficile” Tissue & Cell 29:449-461 (1997).
- Ultrastructural change was associated with germination and outgrowth of C. bifermentans spore appendages but no specific function was determined.
- Transmission electron microscopy thin-section reconstruction is known to have significant problems when observing and interpreting an exosporial morphology of numerous spores at one time, and the problems associated with obtaining thin-section slices of such small, delicate, and poorly staining, spore attachments to a nutritive substrate.
- C. sporogenes spores may exhibit specific morphological stages once dormancy is broken, and that the exosporium seems to play an active role in successful germination, outgrowth, vegetative proliferation, and colonization of a substrate surface binding site.
- Panessa-Warren et al. "Electron microscopy of C. sporogenes endospore attachment and germination” Scanning 16, 227-240 (1994).
- a Clostridium exosporium is believed to be an outer 'membranous' layer of a spore, has been described as a passive participant in germination. However, once dormancy is broken, C.
- sporogenes ATCC 3584 spores appear to produce very specific exosporial morphological structures visible by scanning electron microscopy (SEM), which seem to facilitate attachment of a spore to a substrate or to other spores (i.e., for example, spore co-aggregation). Exosporial projections are later replaced by a single stalk extending from the distal (i.e., for example, the tail region) of the spore, which appears to anchor the spore during the final stages of vegetative cell development and outgrowth.
- SEM scanning electron microscopy
- C difficile has a reduced number of attached spores and requires a longer incubation time to allow attachment to take place.
- Dormant C. difficile spores are small (approximately 2.0 gm long x 1.1 gm wide), elliptical, and predominantly smooth. See, Figure 2, insert. Once activation had begun, spores exhibited low prominences covering the exosporium. See, Figure 3.
- C. difficile 43594 developed exosporial bumps and knobs covering the entire surface of the elongate spore. These spores developed more elongate exosporial projections at the tail region, which were replaced later during the germination cycle by a thickened attachment structure.
- Figure 3 black arrows.
- C. difficile exhibits fewer exosporial membrane extensions but produces a thickened exosporial membrane extension that developed at the tail end of the spore.
- C. difficile 43594 appears unique in that the spores attach very slowly. However, C. difficile may have an adaptive response that accelerates attachment following exposure to an animate surface. For example, an increased incidence of C. difficile nosocomial infection have been reported in patients having increased intestinal motility and those who have undergone multiple enemas. Bartlett, J. "Introduction” In: Clostridium Difficile: Its Role in Intestinal Disease , Ed. R. Rolfe and S. Finegold). Academic Press, New York, pp. 1- 13 (1988); Silva, J.
- Clostridium difficile spores may be routinely found in the digestive tract of healthy, non-symptomatic individuals.
- a triggering mechanism that initiates attachment to the gut and begins the infective process may be a combination of the loss of normal flora (i.e., for example, caused by antibiotics, disease, or repeated enemas) and/or hypermobility of the colon.
- Clostridium spore exosporium attachment outgrowths typically have a diameter of approximately 7 run and may vary in length between 0.1 and 2.9 nm. These outgrowths comprise fibrils that are usually less than 200 nm in length and can be extremely delicate. Hancock, I, "Microbial cell surface architecture" In: Microbial Cell Surface Analysis , Ed. N. Mozes, P. Handley, H. Busscher and P. Rouxhet, VCH Publishers, New York, pp. 23-59 (1991). Usually, exosporium outgrowths of C. sporogenes measure 85 to 1015 nm in width, however, some outgrowths, especially those also comprising co-aggregation attachments, can be as long as 2000 nm in length.
- Knob-like protrusions from C. sporogenes exosporium can range from 68 to 75 nm in diameter, and swollen projections seen in the late stages of germination can be as large as 180 to 240 nm in diameter.
- a C. difficile protein is derived from an exosporium surface layer, wherein the exosporium layer comprises the outermost protein of a C. difficile spore.
- the present invention contemplates a composition comprising at least one outermost surface protein of the Clostridium difficile spore.
- the surface protein comprises a spore surface protein.
- Clostridium difficile exosporium proteins can be used to define molecular attachment interactions including, but not limited to: i) between the spore and animate surfaces; and ii) between the spore and inanimate surfaces. Size characterizations of Clostridium difficile exosporium proteins are presented in Table I.
- Clostridium difficile proteins may be identified by probing total spore protein preparations with antibodies directed against purified, intact, C. difficile spores, to created a hybridized protein-antibody complex.
- a C. difficile spore surface protein includes, but is not limited to, CD1067, CD3620, CD 1581, CD 598, or CD 2401.
- C. difficile enzymes are associated with C. difficile spore surface protein preparations.
- a Clostridium hypothetical protein may be isolated as a hybridized antibody-protein complex comprising a molecular weight including, but not limited to, 18, 140, 150, or 160 kDa. See, Figures 4-6.
- the hypothetical protein ( ⁇ 20 kDa) comprises an amino acid sequence of SEQ ID NO:1 (Accession Numbers YP_001088081, GI: 126699184):
- a Clostridium hypothetical protein may be isolated as a hybridized antibody-protein complex comprising a molecular weight including, but not limited to, 140, 150, and 160 kDa. See, Figures 5 ,6 .
- the hypothetical protein ( ⁇ 47 kDa) comprises an amino acid sequence of SEQ ID NO: 3 (Accession Numbers YP_001087551; GI: 126698654):
- a Clostridium hypothetical protein may be isolated as a hybridized antibody-protein complex comprising a molecular weight including, but not limited to, 140 kDa. See, Figures 5 & 6.
- the hypothetical protein ( ⁇ 14 kDa) comprises an amino acid sequence of SEQ ID NO: 5 (Accession Numbers YP_001090143; GI: 126701246):
- a Clostridium hypothetical protein (CD 1613) maybe isolated as a hybridized antibody-protein complex.
- the hypothetical protein comprises an amino acid sequence of SEQ ID NO: 7 (Accession Number YP 001088114):
- a Clostridium hypothetical protein (CD 1711) may be isolated as a hybridized antibody-protein complex.
- the hypothetical protein comprises an amino acid sequence of SEQ ID NO: 9:
- a Clostridium hypothetical protein (CD 0881) may be isolated as a hybridized antibody-protein complex.
- the hypothetical protein comprises an amino acid sequence of SEQ ID NO: 11 :
- a Clostridium hypothetical protein (CD 1511) maybe isolated as a hybridized antibody-protein complex.
- the hypothetical protein comprises an amino acid sequence of SEQ ID NO: 13:
- B. Clostridium difficile Collagen-Like Proteins The B. anthracis exosporium protein BcIA was compared to the C. difficile genome, wherein three C. difficile genomic areas were identified as homologous to B. anthracis BcIA (i.e., for example, spore surface genomic areas).
- a Clostridium spore surface homolog protein comprises an amino acid sequence of SEQ ID NO: 15 (Accession Number CAJ67154):
- a Clostridium spore surface homolog protein comprises an amino acid sequence of SEQ ID NO: 17 (Accession Number CAJ70248):
- a Clostridium putative spore protein (CD 2401) may be isolated as a hybridized antibody-protein complex comprising a molecular weight including, but not limited to, 140, 150, or 160 kDa. See, Figures 5 & 6.
- the hypothetical protein ( ⁇ 22 kDa) comprises an amino acid sequence of SEQ ID NO: 21 (Accession Numbers YP_OO1O88913; GI: 126700016):
- a Clostridium putative spore surface protein (CD 589) maybe isolated as a hybridized antibody-protein complex comprising a molecular weight including, but not limited to, 140, 150, or 160 kDa. See, Figures 5 & 6.
- a hypothetical protein ( ⁇ 22 kDa) comprises an amino acid sequence of SEQ ID NO: 23 (Accession Numbers YP 001087073; GI: 126698176):
- a Clostridium spore protein comprises a pyruvate-flavodoxin oxidoreductase protein (CD 2682) described by the amino acid sequence of SEQ ID NO: 25 (Accession Numbers YP OO 1089193; GI: 126700296):
- a Clostridium spore protein comprises a ⁇ -aminobutyrate metabolism dehydratase/isomerase protein (CD 2341) described by the amino acid sequence of SEQ ID NO: 27 (Accession Numbers YP 001088856; GI: 126699959):
- a Clostridium spore protein comprises a butyryl-CoA dehydrogenase protein (CD 1054) described by the amino acid sequence of SEQ ID NO: 29 (Accession Numbers YP_001087535; GI: 126698638):
- a Clostridium spore protein comprises an amino acid aminotransferase protein (CD 3664) described by the amino acid sequence of SEQ ID NO: 31 (Accession Numbers YPJ)Ol 090189; GI: 126701292): i MAVKYAKRMQ GLQGSEIREL LKLTQQPQII SFAGGMPAPE LFPVEEMKKV
- a Clostridium spore protein comprises a succinic- semialdehyde dehydrogenase protein (CD 2342) described by the amino acid sequence of SEQ ID NO: 33 (Accession Numbers YPJ)01088857; GI: 126699960):
- a Clostridium spore protein comprises a rubrerythrin protein (CD 1524) described by the amino acid sequence of SEQ ID NO: 35 (Accession Numbers YP__001088025; GI: 126699128):
- a Clostridium spore protein comprises a flavoprotein alpha subunit protein (CD 1056) described by the amino acid sequence of SEQ ID NO: 37 (Accession Numbers YP OO 1087535; GI: 126698640):
- a Clostridium spore protein comprises a 2-ketoisovalerate ferrodoxin reductase protein (CD 116) described by the amino acid sequence of SEQ ID NO: 39 (Accession Numbers YP OOl 086585; GI: 126697688):
- Bacillus The genus Bacillus is composed of rod-shaped, gram-positive, aerobic or (under some conditions) anaerobic bacteria widely found in soil and water. Most strains of Bacillus are not pathogenic for humans and only infect them incidentally in their role as soil organisms. A notable exception, however, is Bacillus anthracis. B. anthracis is believed to cause anthrax in humans and domestic animals. In addition to its role as a naturally occurring pathogen, Bacillus anthracis may also be used as a biological weapon. The spore form of B. anthracis is one of the most likely organisms to be used as a biological weapon. B.
- anthracis spores are well known to be highly resistant to most disinfectants, wherein effective killing usually requires the use of toxic and irritating chemicals such as formaldehyde or sodium hypochlorite (i.e., bleach). Consequently, improvements to current decontamination procedures for both domestic and military applications are urgently needed, the present invention contemplates methods and compositions to provide effective and non-toxic Bacillus contamination control, and especially B. anthracis decontamination procedures for both animate and inanimate surfaces.
- toxic and irritating chemicals such as formaldehyde or sodium hypochlorite (i.e., bleach).
- a B. anthracis BcIA spore surface protein comprises an amino acid sequence (Accession Number AAY15450; SEQ ID NO:41):
- B. anthracis BcIA nucleic acid (Accession Number AY995120; SEQ ID NO: 42):
- the BcIA protein is believed to be highly glycosylated and an immunodominant antigen of the B. anthracis spore surface providing a structural component of exosporium filaments. Daubenspeck et al., J. Biol. Chem. 279:30945-30953 (2004).
- the length of the gene bcla differs between strains of B. anthracis, encoding proteins of different sizes.
- Most BcIA proteins possess an internal spore surface region (CLR) of GXX repeats of variable length (i.e., for example, from approximately 17 to 91 GXX repeats), which include a large proportion of GPT triplets.
- CLR internal spore surface region
- BcIA spore surface region is responsible for the variation in filament length.
- Boydston et al. "Orientation within the exosporium and structural stability of the collagen-like glycoprotein BcIA of Bacillus anthracis ' " J. Bacteriol 187, 5310-5317 (2005).
- One B. anthracis BcIA comprises 70 GPT repeats and has a 21 amino acid sequence ((GPT) 5 GDTGTT; SEQ ID NO: 43) repeated six times.
- BcIA polymorphisms may map to sequences encoding CLRs with a number of contiguous GXX triplets varying from 17 - 91.
- the twelve ⁇ -strands numbered sequentially A, A", A', B', B, C, D, E, F, G, G', and H, according to the TNF-like conventions, are connected with the Greek key topology and form two ⁇ -sheets, each containing five strands, A'AHCF and B 'BGDE, respectively.
- the main difference with other members of the TNF-like is the presence of the extra A" and G' strands that form a two-strand antiparallel ⁇ -sheet, packing together the AA' and GH loops.
- BcIA trimer assembly is very similar to other TNF-like trimers. Because of the shorter protruding loops, the overall shape of the BcIA trimer is somewhat more globular than that of TNF, and it is slightly smaller than the globular head of CIq (by ⁇ 5 A in diameter). Upon trimer formation, the buried surface of 4234 A 2 is less than the equivalent surface areas in CIq (5490 A 2 ) or collagen VIII NCl (6150 A 2 ). This is due both to its slightly smaller overall size but principally to the existence of a solvent- filled cavity within the trimer center.
- a BcIA protein (BASl 130) comprises an amino acid sequence of SEQ ID NO:44 (Accession Number YP_027402):
- a modified Bacillus anthracis protein comprises an amino acid sequence of SEQ ID NO: 45, wherein the modification comprises a SEQ ID NO: 41 fragment:
- a BcIB protein (BAS2281) comprises an amino acid sequence of SEQ ID NO:46 (Accession No. YP_028542):
- the genus Bacillus also includes a diverse collection of gram positive, rod- shaped, aerobic bacteria that form a spore upon deprivation of an essential nutrient.
- Errington "Bacillus subtilis sporulation: regulation of gene expression and control of morphogenesis' Microbiol. Rev. 57:1-33 (1993); and Priest, F. G., "Systemics and ecology of Bacillus” In: Bacillus subtilis and other gram-positive bacteria. Biochemistry, physiology, and molecular genetics, pp. 3-16., A. L. Sonenshein, J. A. Hoch, and R. Losick (ed.), American Society for Microbiology, Washington, D. C. (1993).
- an asymmetric septation of the starved vegetative cell produces a large and a small genome-containing compartment called the mother cell and forespore, respectively.
- the mother cell then engulfs the forespore, thereby surrounding it with two opposing cell membranes.
- a thick layer of modified peptidoglycan called the cortex is synthesized between the two membranes, and proteins synthesized in the mother cell form multiple layers of a spore surface that covers the cortex.
- the coat forms the outermost detectable layer for spores of some species (e.g., Bacillus subtilis), in others (e.g., Bacillus anthracis), the spore is enclosed by an additional layer called the exosporium, a prominent, loose-fitting, balloon-like layer also synthesized by the mother cell. Henriques et al., "Structure and assembly of the bacterial endospore surface" Methods 20:95-110 (2000).
- Bacillus cereus, Bacillus anthracis, and Bacillus thuringiensis are representative of Bacillus bacteria believed to possess an exosporium.
- Ohye et al. "Exosporium and spore surface formation in Bacillus cereus V J. Bacteriol. 115:1179-1190 (1973); and Andersen G., "Genome differences that distinguish Bacillus anthracis from Bacillus cereus and Bacillus thuringiensis ' " Appl. Environ. Microbiol. 69:2755-2764 (2003). See, Figure 9A, 9B. B.
- subtilis lacks a distinct, separate exosporium, although there has been a report that a veiy outermost tightly fitting layer of the spore surface can be visualized after extracting some of the coat material from spores with urea- mercaptoethanol and might be considered an exosporium. Sousa et al., "An exosporium- like outer layer in Bacillus subtilis spores" Nature 263:53-54 (1976).
- exosporium of Bacillus cereus is first observed as a small lamellar structure in the mother cell cytoplasm in proximity to, but not in contact with, the outer forespore membrane; it is synthesized concurrently with the spore surface, although the two structures are clearly separate within the mature spore.
- Exosporia usually contain a hexagonal crystal-like basal layer comprising 53% protein, 20% amino and neutral polysaccharide, 18% lipids, and approximately 4% ash.
- the exosporium comprises approximately 2% of the dry weight of the spore.
- B. anthracis the causative agent of anthrax. Mock et al., "Anthrax” Annu. Rev. Microbiol. 55:647-671 (2001). In light of the recent use of B.
- exosporium which serves as a primary permeability barrier for the spore and as the source of spore surface antigens.
- the exosporium will interact with the soil environment, with collection and detection devices, with spore-binding target cells in a mammalian host, and with host defenses.
- Presently, detailed information about exosporium structure and function is limited. Previous studies of the exosporium focused on spores of B. anthracis and the opportunistic human pathogen Bacillus cereus.
- the basal layer contains four paracrystalline sublayers, each exhibiting a hexagonal, perforate lattice structure.
- the hair-like nap varies in length from species to species and even from strain to strain.
- Beaman et al. "Paracrystalline sheets reaggregated from solubilized exosporium of Bacillus cereus” J. Bacteriol. 107:320-324 (1971); and Kramer et al., "Ultrastructural differences in the exosporium of the Sterne and Vollum strains of Bacillus anthracis" Can. J. Microbiol. 14:1297-1299 (1968).
- the exosporium reacts with lectins, which appear to bind polysaccharides located in the hair-like nap.
- lectins which appear to bind polysaccharides located in the hair-like nap.
- Cole et al. "Differentiation of Bacillus anthracis and other Bacillus species by lectins" J. Clin. Microbiol. 19:48-53 (1984); Matz et al., "Chemical ultrastructure of the exosporium enveloping spores of Bacillus cereus” Bacteriol. Proc, p. 31 (1965).
- the exosporium constitutes about 2% of the mass of the spore and contains approximately 50% protein, 20% lipid, 20% neutral polysaccharides, and 10% other components.
- Matz et al. "Chemical composition of exosporium from spores of Bacillus cereus” J. Bacteriol. 101 :196-201 (1970).
- the exosporium contains multiple proteins that are synthesized concurrently with the cortex and coat. Desrosier et al., "Synthesis of the exosporium during sporulation of Bacillus cereus” J. Gen. Microbiol. 130:935-940 (1984); and Ohye et al., "Exosporium and spore surface formation in Bacillus cereus Z" J. Bacteriol. 115:1179-1190 (1973). More recent studies have attempted to identify individual exosporium proteins. An apparent 72-kDa glycoprotein was identified as a component of either the exosporium or the coat of B. thuringiensis spores.
- the Bacillus spore itself is believed responsive to environmental stimuli.
- atomic force microscopy was used to identify species-specific alterations in spore morphology when exposed to arid versus humid environments. For example, dimensional changes appeared dependent upon species, growth regimes, and environmental conditions. In general, spore widths may fluctuate between 500 - 3000 nm depending upon the interaction of these factors.
- Plomp et al. "The high-resolution architecture and structural dynamics of Bacillus spores" Biophys J 88:603-608 (2005). Additionally, in addition to BcIA, the B.
- anthracis exosporium is also believed to contain four other primary proteins: i) alanine racemase; ii) iron/manganese superoxide dismutase; iii) a 29,174-Da protein having an unknown function; and iv) a 17,331-Da protein having an unknown function.
- the exosporium may represent a contact surface between a spore, the environment, and/or a host.
- the exosporium comprises proteins that are responsible for functions including, but not limited to, immunogenicity, environment/host attachment and stability, or germination responses. Redmond et al., "Identification of proteins in the exosporium of Bacillus anthracis" Microbiol 150:355-363 (2004).
- a bacterial species exosporium protein may include, but are not limited to, putative coat proteins (i.e., for example, genes cotJCl or cotJC2), hypothetical exosporium proteins, BcIA proteins, BcIB proteins, BcI Sterne proteins, modified BcIA or BcIB proteins, ExsF proteins; CotB proteins; ExsY proteins; CotY proteins; ExsK proteins, inosine hydrolases, alanine racemases, pyruvate-flavodoxin oxidoreductases (i.e.,.
- a Bacillus thuringiensis serovar kurstaki strain 1.175 alanine racemase (i.e., for example, gene alrA) (Accession No. DQ402058) comprises an amino acid sequence (SEQ ID NO: 47):
- GTINYE ⁇ ATISFRVPRIFIRNGKVVEIINYLNNI encoded by the nucleic acid sequence (SEQ ID NO: 48): 1 cgtgcgatac tcacatacac tggaaataag aaatccttta ctttaataca agaaaaggca 61 aaagttgcag aggcatcatc agcggtaagt gt gt gtaagtggag aaccagttga tcttgggtttttt
- a Bacillus anthracis str. Sterne protein (BAS3290) comprises an amino acid sequence of SEQ ID NO :49 (Accession No. YP_029547):
- & Bacillus anthracis str. Sterne protein (BAS3557) comprises an amino acid sequence of SEQ ID NO: 50 (Accession No. YP_029811): 1 msryddsqnk fskpc ⁇ ssa gripntpsip vtkaqlrtfr aiiidltkii pklfanpspq
- a Bacillus anthracis str. Sterne protein having a collagen triple helix repeat domain comprises an amino acid sequence of SEQ ID NO: 51 (Accession No. YP_030670):
- a Bacillus anthracis str. Sterne protein having a collagen triple helix repeat domain comprises an amino acid sequence of SEQ ID NO: 52 (Accession No. YP_030869):
- a Bacillus anthracis str. Sterne protein (BAS2280) comprises an amino acid sequence of SEQ ID NO: 53 (Accession No. YP_028541):
- a modified Bacillus anthrac ⁇ s str CEB protein comprises an amino acid sequence of SEQ ID NO: 54, wherein the modification comprises a truncated leader sequence and the addition of a His-6 Tag:
- the present invention contemplates a composition comprising a Bacillus spore surface protein, wherein the protein comprises an ExsA protein.
- the ExsA protein is localized in both the exosporium and bacterial coat and may be related to the SafA (SpoVID-associated factor) protein of B. subtilis.
- SafA interacts with SpoVID during the early stages of coat assembly. Ozin et al., "SpoVID guides SafA to the spore surface ⁇ Bacillus subtilis" J. Bacteriol. 183:3041-3049 (2001). Both SpoIVA and SpoVID are believed for SafA localization, and homologues of both are encoded in the B. cereus genome.
- ExsA might play a larger role in B. cereus than SafA does in B., subtilis, in that a less extreme coat assembly defect has been reported for B. subtilis safA detection mutants.
- safA mutant spores were sensitive to lysozyme, but the exsA spore structure appeared rather less disturbed.
- the ExsA protein is very different in amino acid sequence from SafA, apart from N-terminal and C-terminal regions. Given the large differences in sequence between SafA and ExsA, local regions of conservation are likely to be significant for functions conserved in both SafA and ExsA, and could be explored by directed mutagenesis in B. subtilis.
- the multiple proline-rich tandem repeat sequences in ExsA are likely to be in an extended conformation, but their function is not known — they either could be repetitive regions for binding of other coat proteins or could act as spacers between regions that bind other coat proteins. Speculatively, this could be a mechanism to provide some distance between integument layers, but it would not be obvious why there should be three such regions, each with its own sequence repeat.
- the present invention contemplates a composition comprising a Bacillus spore surface protein, wherein said protein comprises an ExsF protein.
- ExsF proteins i.e., for example, ExsF, ExsF A, and ExsFB
- ExsF proteins are exosporium components believed involved in the proper localization of BcIA filaments on a Bacillus spore surface and for the stability of the crystalline layers of the exosporium. These proteins are probably organized in multimeric complexes with other exosporium components, including BcIA.
- the protein ExsFA may interact with BcIA and ensures that it is localized on the spore surface.
- ExsF The contribution of ExsF is less clear, but one hypothesis is that ExsFB and ExsFA interact with the components of both arrays of the crystalline basal layer and ensure its stability. Alternatively, the absence of two spore components (35 to 37 kDa) in mutant ExsF knock-out strains suggest that ExsFs proteins may be involved in the assembly of exosporium structural components or with maintenance on the spore. Sylvestre et al., "Contribution of ExsFA and ExsFB proteins to the localization of BcIA on the spore surface and to the stability of the Bacillus anthracis exosporium" J Bacteriol 187:5122-5128 (2005).
- the present invention contemplates a composition comprising a Bacillus spore surface protein, wherein said protein comprises a BxpB protein.
- BxpB was discovered as one of several proteins present in a purified sample of exosporium that had been isolated from the Sterne strain of B. anthracis.
- BxpB was found in high levels in samples of chemically deglycosylated exosporium. This result suggested that BxpB was either glycosylated or associated with glycosylated material. However, BxpB is not a glycoprotein but forms a high-molecular-mass complex with a BcI A glycoprotein and other proteins including, but not limited to, ExsY or CotY both of which are found in Bacillus exosporium.
- BxpB may be an integral basal layer protein.
- binding of the anti-BxpB MAb to Sterne spores was weaker than that detected with ⁇ bcla spores that lack BcIA.
- the reduced MAb binding to Sterne spores was due primarily to the protein component of BcIA, perhaps reflecting a close BxpB-BclA interaction.
- Spores that lack BxpB i.e., for example, ⁇ bxpB mutants
- BxpB may mediate attachment of BcIA to the basal spore layer and assembly of the hair-like nap.
- NTD 38-residue amino-terminal domain
- Boydston et al. "Orientation within the exosporium and structural stability of the collagen like glycoprotein BcIA of Bacillus anthracis" J. Bacteriol. 187:5310-5317 (2005).
- the first 19 amino acids of this NTD are absent in mature BcIA isolated from spores, most likely due to a proteolytic processing event.
- a BxpB exosporium protein comprises an amino acid sequence of SEQ ID NO: 55:
- an ExsJ exosporium protein (Bacillus cereus) comprises an amino acid sequence of SEQ ID NO: 56 (Accession No. AY 183116.1):
- an ExsH exosporium protein ⁇ Bacillus cereus comprises an amino acid sequence of SEQ ID NO: 58:
- nucleic acid sequence comprising SEQ ID NO: 59:
- gagcaacagg cttaacagga gcgacaggcc caacgggagc aacaggttta acaggagcaa 781 caggtttaac aggagcaaca ggcttaacag gagcgacagg tccaacagga gcaacaggtc
- CotB Proteins in one embodiment, the present invention contemplates a CotB exosporium protein ⁇ Bacillus subtilis; Accession No. AYl 86996,) comprising an amino acid sequence of SEQ ID NO: 60:
- CotY Proteins in one embodiment, the present invention contemplates a CotY exosporium protein ⁇ Bacillus cereus) comprising an amino acid sequence of SEQ ID NO: 62:
- an ExsY exosporium protein ⁇ Bacillus cereus comprises an amino acid sequence of SEQ ID NO: 64 (Accession No. AY121973): MSCNENKHHGSSHCVVDWKFINELQDCSTTTCGSGCEIPFLGAHNTASV ANTRPFILYTKTGEPFEAFAPSASLTSCRSPIFRVESVDDDSCAVLRVLTW LGDSSPVPPGDDPICTFLAVPNARLISTTTCITVDLSCFCAIQCLRDVSIVK encoded by a nucleic acid sequence SEQ ID NO: 65:
- a Clostridium perfringes spore surface homolog protein comprises a triple helix protein comprising an amino acid sequence of SEQ ID NO: 66 (Accession No. YP 695648):
- the present invention contemplates inhibiting microbial spore binding and/or attachment to inanimate and/or animate surfaces using antibodies.
- the antibodies inhibit Clostridium spore binding.
- These antibodies include, but are not limited to, polyclonal and monoclonal antibodies.
- chimeric antibodies may be produced, for example, by splicing mouse antibody genes to human antibody genes. Single chain antibodies are also contemplated as well as antibody fragments generated by pepsin digestion of the antibody molecule or by reduction of the disulfide bridges of the Fab fragments.
- the present invention provides isolated antibodies or fragments thereof, (i.e., for example, polyclonal, monoclonal, and/or Fab's).
- the present invention provides monoclonal antibodies that specifically inhibit the binding of microbial spore surface proteins to various surfaces (i.e., for example, animate surfaces and/or inanimate surfaces).
- An antibody against a protein of the present invention may be any monoclonal or polyclonal antibody, as long as it can recognize the protein.
- Antibodies can be produced by using a protein of the present invention as the antigen according to a conventional antibody or antiserum preparation process. Any suitable method may be used to generate the antibodies used in the methods and compositions of the present invention, including but not limited to, those disclosed herein.
- protein, as such, or together with a suitable carrier or diluent is administered to an animal (e.g., a mammal) under conditions that permit the production of antibodies (i.e., for example, immunization).
- the protein is administered once every 2 weeks to 6 weeks, in total, about 2 times to about 10 times.
- Animals suitable for use in such methods include, but are not limited to, primates, rabbits, dogs, guinea pigs, mice, rats, sheep, goats, etc. and may be immunized by injection with a full-length protein or any portion, fragment or oligopeptide which retains immunogenic properties.
- various adjuvants may be used to increase immunological response. For enhancing the antibody production capability, complete or incomplete Freund's adjuvant may be administered.
- Such adjuvants include, but are not limited to, Freund's, mineral gels such as aluminum hydroxide, and surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
- BCG Bacillus Calmette-Guef ⁇ n
- Cornebacterium parrum are potentially useful adjuvants.
- Monoclonal antibodies may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. These include, but are not limited to hybridoma techniques. Koehler et al. Nature 256:495-497(1975); Kosbor et al., Immunol Today 4:72 (1983); Cote et al., Proc Natl Acad Sci 80:2026.-2030 (1983); Cole et al., In: Monoclonal Antibodies and Cancer Therapy, Alan R Liss Inc, New York, N.Y., pp 77-96 (1985)(all references incorporated herein by reference).
- an individual animal e.g., a mouse
- its spleen or lymph node is harvested and antibody-producing cells contained therein are fused with myeloma cells to prepare the desired monoclonal antibody producer hybridoma.
- Measurement of the antibody titer in antiserum can be carried out, for example, by reacting the labeled protein, as described hereinafter and antiserum and then measuring the activity of the labeling agent bound to the antibody.
- the cell fusion can be carried out according to known methods, for example, the method described by Koehler and Milstein (Nature 256:495 [1975]).
- a fusion promoter for example, polyethylene glycol (PEG) or Sendai virus (HVJ), preferably PEG is used.
- myeloma cells examples include NS-I, P3U1, SP2/0, AP-I and the like.
- the proportion of the number of antibody producer cells (i.e., for example, spleen cells) and the number of myeloma cells to be used is preferably about 1 :1 to about 20:1.
- PEG preferably PEG 1000-PEG 6000
- Cell fusion can be carried out efficiently by incubating a mixture of both cells at about 20 0 C to about 40 0 C, preferably about 30 0 C to about 37°C for about 1 minute to 10 minutes.
- a hybridoma producing the antibody e.g., against a tumor antigen or autoantibody of the present invention
- a supernatant of the hybridoma is added to a solid phase (e.g., microplate) to which antibody is adsorbed directly or together with a carrier and then an antiimmunoglobulin antibody (if mouse cells are used in cell fusion, anti -mouse immunoglobulin antibody is used) or Protein A labeled with a radioactive substance or an enzyme is added to detect the monoclonal antibody against the protein bound to the solid phase.
- a solid phase e.g., microplate
- an antiimmunoglobulin antibody if mouse cells are used in cell fusion, anti -mouse immunoglobulin antibody is used
- Protein A labeled with a radioactive substance or an enzyme is added to detect the monoclonal antibody against the protein bound to the solid phase.
- a supernatant of the hybridoma is added to a solid phase to which an antiimmunoglobulin antibody or Protein A is adsorbed and then the protein labeled with a radioactive substance or an enzyme is added to detect the monoclonal antibody against the protein bound to the solid phase.
- Selection of the monoclonal antibody can be carried out according to any known method or its modification. Normally, a medium for animal cells to which HAT
- RPMI 1640 medium containing 1% to 20%, preferably 10% to 20% fetal bovine serum, GIT medium containing 1% to 10% fetal bovine serum, a serum free medium for cultivation of a hybridoma (SFM-101, Nissui Seiyaku) and the like can be used.
- the cultivation is carried out at 20 0 C to 4O 0 C, preferably 37°C for about 5 days to 3 weeks, preferably 1 week to 2 weeks under about 5% CO 2 gas.
- the antibody titer of the supernatant of a hybridoma culture can be measured according to the same manner as described above with respect to the antibody titer of the anti-protein in the antiserum.
- Separation and purification of a monoclonal antibody can be carried out according to the same manner as those of conventional polyclonal antibodies such as separation and purification of immunoglobulins, for example, salting-out, alcoholic precipitation, isoelectric point precipitation, electrophoresis, adsorption and desorption with ion exchangers (e.g., DEAE), ultracentrifugation, gel filtration, or a specific purification method wherein only an antibody is collected with an active adsorbent such as an antigen- binding solid phase, Protein A or Protein G and dissociating the binding to obtain the antibody.
- an active adsorbent such as an antigen- binding solid phase, Protein A or Protein G and dissociating the binding to obtain the antibody.
- Polyclonal antibodies may be prepared by any known method or modifications of these methods including obtaining antibodies from patients. For example, a complex of an immunogen (an antigen against the protein) and a carrier protein is prepared and an animal is immunized by the complex according to the same manner as that described with respect to the above monoclonal antibody preparation. A material containing the antibody against is recovered from the immunized animal and the antibody is separated and purified.
- an immunogen an antigen against the protein
- a carrier protein is prepared and an animal is immunized by the complex according to the same manner as that described with respect to the above monoclonal antibody preparation.
- a material containing the antibody against is recovered from the immunized animal and the antibody is separated and purified.
- any carrier protein and any mixing proportion of the carrier and a hapten can be employed as long as an antibody against the hapten, which is crosslinked on the carrier and used for immunization, is produced efficiently.
- bovine serum albumin, bovine cycloglobulin, keyhole limpet hemocyanin, etc. may be coupled to an hapten in a weight ratio of about 0.1 part to about 20 parts, preferably, about 1 part to about 5 parts per 1 part of the hapten.
- various condensing agents can be used for coupling of a hapten and a carrier.
- glutaraldehyde, carbodiimide, maleimide activated ester, activated ester reagents containing thiol group or dithiopyridyl group, and the like find use with the present invention.
- the condensation product as such or together with a suitable carrier or diluent is administered to a site of an animal that permits the antibody production.
- complete or incomplete Freund's adjuvant may be administered. Normally, the protein is administered once every 2 weeks to 6 weeks, in total, about 3 times to about 10 times.
- the polyclonal antibody is recovered from blood, ascites and the like, of an animal immunized by the above method.
- the antibody titer in the antiserum can be measured according to the same manner as that described above with respect to the supernatant of the hybridoma culture. Separation and purification of the antibody can be carried out according to the same separation and purification method of immunoglobulin as that described with respect to the above monoclonal antibody.
- the protein used herein as the immunogen is not limited to any particular type of immunogen.
- a protein expressed resulting from a virus infection can be used as the immunogen.
- fragments of the protein may be used. Fragments may be obtained by any methods including, but not limited to expressing a fragment of the gene, enzymatic processing of the protein, chemical synthesis, and the like.
- any antigenic portion of a microbial spore protein amino acid sequence contemplated herein can be used either alone ,or fused with amino acids of another protein (i.e., for example, glutathione to produce an antibody against a chimeric molecule).
- Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fab fragments and fragments produced by a Fab expression library.
- Neutralizing antibodies i.e., those which inhibit dimer formation, are especially preferred for diagnostics and therapeutics.
- Polypeptides to be used for antibody induction need not retain biological activity; however, the protein fragment, or oligopeptide should be antigenic.
- Peptides used to induce specific antibodies may have an amino acid sequence comprising at least five amino acids, preferably at least 10 amino acids. Preferably, they should mimic a portion of the amino acid sequence of the natural protein and may contain the entire amino acid sequence of a small, naturally occurring molecule. Short stretches of an amino acid sequence may be fused with those of another protein including, but not limited to, keyhole limpet hemocyanin and antibody produced against a chimeric molecule.
- Antibodies can also be used to detect polypeptides in samples including, but not limited to, body fluids, cell extracts, tissue extracts, or surface swipes using techniques including, but not limited to, enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA) and fluorescent activated cell sorting (FACS). Reporter molecules can be joined to the polypeptides and antibodies to facilitate detection of polypeptide-antibody binding.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- FACS fluorescent activated cell sorting
- the present invention contemplates a screening method comprising a monoclonal and/or polyclonal antibody having affinity to a Clostridium spore surface protein.
- the antibodies were examined qualitatively (visually) for their reactivities with a range of Bacillus, Clostridium, and Desulfotomaculum spores by using a dot blot format.
- Antibody C33 reacted strongly with C. sporogenes spores and weakly with C. perfringens spores.
- Antibody C225 reacted weakly with B. megaterium spores and strongly with spores of B. stear other mophilus, C. perfringens, and C. sporogenes.
- Immunocytochemical localization of the antigen in C. sporogenes indicated that it is present on the exosporium and the outer cortex region of the spore. While less information is available about C.
- the present invention contemplates a method whereby a monoclonal and/or a polyclonal antibody has affinity to a Clostridium spore surface protein (i.e., for example, CD1581) is used to disrupt the binding of a Clostridium spore to a surface.
- a Clostridium spore surface protein i.e., for example, CD1581
- the surface may be selected from the group including, but not limited to, plastic, ceramic, stainless steel, iron steel, vinyl, tile, wood laminate, skin (i.e., for example, pigskin), internal body tissues, clothing, or environmental protection suits.
- a modified cup scrub method was used to evaluate the ability of C. difficile spores to bind to a human skin surrogate (i.e., for example, pigskin). See, Example X.
- the pigskin was first washed using a non- antimicrobial soap for 30 s followed by water rinse for 30 s. After washing the pigskin, up to 50 ⁇ l of spores were added to a 20 mm diameter area on the surface of the skin. The spores were allowed to dry for up to an hour and then removed according to the cup scrub method. This experiment determined the ability of C. difficile spores to bind to the skin surrogate.
- Preliminary data has shown that up to 80% of spores can be removed from the surface of the pigskin. In subsequent experiments, spores were first reacted with C. difficile spore surface antibodies prior to being applied to the skin surface. The ability to remove the spores from the skin was again determined using the cup scrub method. Preliminary data has shown the ability to remove greater than 80% of the spores from the pigskin, suggesting the antibody is preventing the spores from binding to the skin.
- the present invention contemplates a method comprising inhibiting microbial spore binding using an infection control agent, wherein the agent comprises at least a portion of a microbial spore protein.
- an infection control agent comprises at least a portion of a microbial spore protein.
- the infection control agent competes for surface binding sites to which the microbial spore has similar affinity. It is further believed that the resultant competitive binding either displaces previously bound microbial spores from the surface attachment site and/or is sterically prevented from binding due to the presence of the at least a portion of the microbial spore surface protein.
- the spore surface protein may be derived from microbial organisms selected from the group comprising bacteria, viruses, fungi, algae, or molds. In one embodiment, the method further comprises preventing attachment of a microbial spore to a surface with the spore surface protein. In one embodiment, the spore surface proteins are formulated with non-spore surface protein compounds are selected from the group comprising small molecules, proteins, or nucleic acids. In one embodiment, the spore surface proteins are formulated with surface acting agents which may include, but are not limited to, surfactants, soaps, detergents, foaming agents, wetting agents, and aerosolizing agents. In one embodiment, the compounds are selected form the class of compounds known as solvents.
- a microbial spore surface protein comprises a full length microbial spore surface protein.
- the full length microbial spore surface protein comprises a Clostridium spore surface protein.
- the Clostridium full length spore surface protein comprises a C. difficile full length spore surface protein.
- the C. difficile full length spore surface proteins maybe selected from the group comprising SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO: 7 SEQ ID NO: 9 .
- the full length microbial spore surface protein comprises a Bacillus spore surface protein.
- the Bacillus full length spore surface protein comprises a B. anthracis full length spore surface protein.
- the B. anthracis full length spore surface proteins may be selected from the group comprising SEQ ID NO:41, SEQ ID NO: 43 SEQ ID NO: 45 SEQ ID NO: 47 SEQ ID NO: 49 .
- the at least a portion of a microbial spore surface protein comprises a truncated microbial spore surface protein.
- truncated microbial spore surface proteins may be constructed by recombinant protein expression platforms (infra) wherein a portion of a nucleic acid sequence encoding a microbial spore surface protein is integrated within a vector and placed in operable combination with a compatible promoter.
- such truncated microbial surface proteins may be created by digesting full length microbial spore surface proteins using any one, or more, of peptidase enzymes previously reported.
- peptidase enzymes may comprise enzymes including but not limited to endopeptidases, exopeptidases, amidopeptidases, and/or carboxypeptidases.
- the truncated microbial spore surface protein is derived from a Clostridium spore surface protein.
- the Clostridium truncated spore surface protein comprises a C. difficile truncated spore surface protein.
- the C. difficile truncated spore surface protein may be derived from a Clostridium hypothetical protein (CD 1581) as listed in Table III:
- the C. difficile truncated spore surface protein may be derived from a Clostridium hypothetical protein (CD 1067) as listed in Table IV:
- the C. difficile truncated spore surface protein may be derived from a Clostridium hypothetical protein (CD 3620) as listed in Table V:
- the C. difficile truncated spore surface protein may be derived from a Clostridium hypothetical protein (CD 1613) as listed in Table VI:
- a Clostridium truncated spore surface protein may be derived from a hypothetical protein (CD 1711) as listed in Table VII: Table VII.
- a Clostridium truncated spore surface protein may be derived from a hypothetical protein (CD 0881) as listed in Table VIII:
- a Clostridium truncated spore surface protein may be derived from a hypothetical protein (CDl 511) as listed in Table IX:
- the C. difficile truncated spore surface protein may be derived from a collagen-like protein as listed in Table X.
- the C. difficile truncated spore surface protein may be derived from a collagen-like protein as listed in Table XI.
- the C. difficile truncated spore surface protein may be derived from a collagen-like protein as listed in Table XII.
- the truncated microbial spore surface protein is derived from a Bacillus full length spore surface protein.
- the Bacillus truncated spore surface protein comprises a B. anthracis truncated spore surface protein.
- the B. anthracis truncated spore surface protein may be derived from a BcIA protein as listed in Table XIII.
- the present invention contemplates compositions and methods for making and using infection control compositions comprising microbial spore surface protein mimetics.
- the protein mimetic comprises an amino acid sequence.
- the amino acid sequence comprises a circular tertiary structure.
- the protein mimetic comprises a small organic molecule. Small organic molecules mimicking the necessary conformation for recognition and docking to the active site binding to the peptides of the present invention are contemplated as within the scope of this invention.
- mimetics of microbial spore surface proteins and/or peptide fragments are contemplated. A variety of designs for such mimetics are possible.
- cyclic and/or linear proteins and/or peptide fragments in which the necessary conformation for binding is stabilized by nonpeptides, are specifically contemplated.
- non-peptide compounds that mimic peptide sequences are also known in the art.
- some non-peptide antagonists mimic the Arg-Gly-Asp sequence.
- Ku, et al., (J. Med. Chem. 38:9 (1995)) give further elucidation of the synthesis of a series of such compounds.
- Such non-peptide compounds that mimic microbial spore surface proteins and/or peptide fragments are specifically contemplated by the present invention.
- the present invention also contemplates synthetic mimicking compounds that are multimeric compounds that repeat relevant peptide sequences.
- peptides can be synthesized by linking an amino group to a carboxyl group that has been activated by reaction with a coupling agent, such as dicyclohexylcarbodiimide (DCC).
- DCC dicyclohexylcarbodiimide
- the attack of a free amino group on the activated carboxyl leads to the formation of a peptide bond and the release of dicyclohexylurea.
- DCC dicyclohexylcarbodiimide
- It can be necessary to protect potentially reactive groups other than the amino and carboxyl groups intended to react.
- the ⁇ -amino group of the component containing the activated carboxyl group can be blocked with a tertbutyloxycarbonyl group. This protecting group can be subsequently removed by exposing the peptide to dilute acid, which leaves peptide bonds intact.
- peptides can be readily synthesized by a solid phase method by adding amino acids stepwise to a growing peptide chain that is linked to an insoluble matrix, such as polystyrene beads.
- the carboxyl-terminal amino acid (with an amino protecting group) of the desired peptide sequence is first anchored to the polystyrene beads.
- the protecting group of the amino acid is then removed.
- the next amino acid (with the protecting group) is added with the coupling agent. This is followed by a washing cycle. The cycle is repeated as necessary.
- the mimetics of the present invention are peptides having sequence homology to the above-described microbial spore surface proteins and/or peptide fragments.
- One common methodology for evaluating sequence homology, and more importantly statistically significant similarities, is to use a Monte Carlo analysis using an algorithm written by Lipman and Pearson to obtain a Z value. According to this analysis, a Z value greater than 6 indicates probable significance, and a Z value greater than 10 is considered to be statistically significant.
- synthetic polypeptides useful in solving the problems of microbial decontamination and microbial infection are those peptides with statistically significant sequence homology and similarity (Z value of Lipman and Pearson algorithm in Monte Carlo analysis exceeding 6).
- the present invention contemplates methods comprising screening for infection control compositions that inhibit, antagonize, interfere, displace, and/or disrupt the binding of a microbial spore to an inanimate and/or animate surface. In one embodiment, the present invention contemplates methods comprising screening for infection control compositions that inhibit, antagonize, interfere, displace, and/or disrupt the binding of a microbial spore surface protein to an inanimate and/or animate surface.
- the animate surface may be selected from the group comprising skin, human body tissues, and/or human cells.
- the inanimate surface may comprise hard surfaces including, but not limited to, ceramic, tile, granite, and/or stainless steel.
- the microbial spore comprises a Clostridium spore. In one embodiment, the Clostridium spore comprises a C. difficile spore. In one embodiment, the screened infection control compositions are capable of binding to a microbial spore surface protein. Although it is not necessary to understand the mechanism of an invention, it is believed that the infection control compositions bind to a surface thereby blocking binding of a microbial spore surface protein. Although it is not necessary to understand the mechanism of an invention, it is believed that such infection control compositions may include, but are not limited to, natural compounds isolated from viral, bacterial, fungal, plant, and animal sources, as well as synthetic compounds. It is further believed that neither the source, chemical structure, or mechanism of action of the infection control composition is essential to this invention. A. Assays For Detecting Microbial Spore Binding To A Surface
- the present invention contemplates methods for detecting microbial spores and/or microbial spore proteins comprising: a) providing; i) a substrate surface suspected of contamination by at least one microbial spore; ii) a spore collection device comprising a plurality of infection control compositions capable of attaching the at least one microbial spore; and iii) a spore growth plate capable of supporting growth of the at least one microbial spore; b) contacting the spore collection device with the substrate surface wherein the at least one microbial spore becomes attached to the device; c) contacting the microbial collection device with the spore growth plate; and d) detecting at least one microbial spore on the spore growth plate.
- the infection control composition comprises a microbial spore protein peptide fragment.
- the microbial spore protein peptide fragment is selected from the group comprising a Clostridium spore protein peptide fragment, or a Bacillus spore protein peptide fragment.
- the microbial spore is a Clostridium difficile spore.
- the microbial spore is a Bacillus anthracis spore.
- a growth assay can be performed using any microbial spore.
- C. sporogenes spores are used below in a method to detect the growth of spores after their collection from a contaminated surface, but is should be understood that any microbial spore can be substituted wherein collection and detection each respective microbial spore will be successfully performed (i.e., for example, Clostridium difficile antibodies).
- a. Cup Scrub Assays One described technique is suitable for the recovery of resident and transient microorganisms from human or animal skin. For example, the technique may be used in situ within clinical protocols or in vitro for studies using isolated skin or skin equivalents.
- a cub-scrub procedure can be incorporated into any method describes herein to evaluate test materials containing infection control compositions that are intended to reduce significantly the number of microbial spores on a test surface (i.e., for example, intact skin). It also may be used to provide an indication of residual antimicrobial activity.
- C difficile endospore suspension Aliquots of C difficile endospore suspension are anaerobically incubated at 35 0 C on prereduced (i.e., for example, oxygen removed) BCDC, TCCFA, and TSA. Control and experimental plates are inoculated identically with a spore suspension, and one set of control plates are allowed to incubate and grow undisturbed for the duration of each experiment.
- Attachment experiments are done by placing a circle (i.e., for example, a target area) on the bottom of the agar-filled Petri dish, and inoculating the plate with 5 or 10 ⁇ l of C. difficile spore suspensions directly within a target area, incubating these spores in the anaerobic hood (Forma Scientific, Marietta, Ohio) on pre-reduced plates for 27 min, 99 min, 150 min, and 360 min. After timed incubation, the plates are removed, and 4 ml of sterile distilled water added to each culture plate.
- a circle i.e., for example, a target area
- the plates are then shaken at 300 rpm for 10 min, after which the agitation solution is aseptically pipetted off the agar surface, and the plates re-incubated anaerobically for 24, 48, and 72 h.
- the agitation solution is aseptically pipetted off the agar surface, and the plates re-incubated anaerobically for 24, 48, and 72 h.
- light microscopy smears on glass slides are made from randomized colonies and photographed on a photomicroscope, and plates are inoculated and incubated under aerobic conditions to identify any aerobic contaminants.
- the water agitation solution (removed after shaking the plate) is also tested for the presence of spores.
- the present invention contemplates methods for detecting microbial spores comprising: a) providing; i) a substrate surface suspected of contamination by at least one microbial spore; and ii) an anti-spore surface antibody capable of binding to the at least one microbial spore; b) contacting the anti-spore surface antibody with the substrate surface or spore surface under conditions such that the antibody binds to the at least one microbial spore, wherein an antibody/spore complex is created; and c) detecting the antibody/spore complex.
- the antibody comprises a polyclonal antibody (i.e.., for example, Fl 997)
- the anti- spore surface antibody comprises a label.
- the label comprises a fluorescent label.
- the microbial spore is a Clostridium difficile spore.
- the microbial spore is a Bacillus anthracis spore.
- the present invention contemplates methods for detecting microbial spores comprising: a) providing; i) a substrate surface suspected of contamination by at least one microbial spore; ii) an anti-spore surface antibody capable of binding to the at least one microbial spore; and iii) a growth assay plate; b) combining the anti-spore surface antibody with the antibody, wherein an antibody/spore complex is created; c) contacting the antibody/spore complex with the substrate surface; d) removing a sample of the antibody/spore complex (i;e., for example, by the cup-scrub method) from the surface; e) streaking the sample on the growth assay plate.
- the antibody comprises a polyclonal antibody (i.e.., for example, F1997).
- the substrate surface comprises a pigskin surface.
- the label comprises a fluorescent label.
- the microbial spore is a Clostridium difficile spore. In one embodiment, the microbial spore is a Bacillus anthracis spore. a. Antibody Development
- an anti-spore surface antibody can be directed towards any epitope on a spore surface (i.e., whether a protein or other antigenic structure).
- a spore surface i.e., whether a protein or other antigenic structure.
- C. sporogenes spores are used below in a method to generate anti-spore surface monoclonal and polyclonal antibodies, but is should be understood that any microbial spore can be substituted wherein antibodies against each respective microbial spore will be successfully generated (i.e., for example, Clostridium difficile antibodies).
- mice were obtained by several injections of 10 8 inactivated spores (incubated in 4% (v/v) formaldehyde for 4 h at 37°C). Monoclonal antibodies were produced according to the procedures of Kohler and Milstein (Kohler and Milstein, 1975). Briefly, the mice were boosted on days 21 and 42 and bled on day 50 for polyclonal antibodies, or boosted on day 50 and sacrificed for fusion on day 53 for monoclonal antibodies. Spore stocks are prepared by growing C. sporogenes cells in cooked meat medium at 35 0 C, and Clostridium perfringens cells in fluid thioglycolate medium at 37°C under anaerobic conditions
- Antigen prepared by the above formalin inactivation of C. sporogenes P A3679 spore stocks were free of vegetative cell material as observed by phase-contrast microscopy. Phillips et al., "Assessment of immunofluorescence measurements of individual bacteria in direct and indirect assays for Bacillus anthracis and Bacillus cereus spores" J. Appl. Bacteriol. 53:223-231 (1982). A total of 1 x 10 7 C. sporogenes spores are used as the antigen.
- Monoclonal antibody production is done according one of many procedures. Kohler et al., "Continuous cultures of fused cells secreting antibody of predefined specificity" Nature 296:495 ⁇ -97 (1975)(herein incorporated by reference in its entirety). Hybridomas are screened for reactivity with C. sporogenes spores. Hybridomas found to be reactive are also screened for reactivity with the vegetative cells.
- Isotyping of monoclonal antibodies are performed by using a dot blot immunoassay format. Spores are applied to an Immobilon-P ® membrane (Millipore Corp., Bedford, Mass.) in a dot blot apparatus. The spores are then incubated with 100 ml of the appropriate tissue culture supernatants. Monoclonal antibody bound to spores are isotyped by using rabbit anti-mouse subclass specific antiserum obtained from Bio- Rad ® (Hercules, Calif.). Clostridium sporogenes spores were then applied to an Immobilon-P ® membrane, followed by incubation with above generated antibodies.
- Culture supernatants are then diluted 1 :32 and 1 :128 with Tris-buffered saline (TBS) (0.01 M Tris, 0.15 M NaCl, pH 7.4). Aliquots of diluted culture supernatants are mixed with an equal volume of the spore antigen (4 x 10 9 spores/ml) by gentle inversion overnight at 48°C. Diluted culture supernatants mixed with sterile distilled water serve as a positive control. Antibodies adsorbed to spores are removed by centrifugation (ca. 4,000 3g, 10 min). The supernatant fluid is used in immunoblot assays as detailed above.
- TBS Tris-buffered saline
- Antibodies are concentrated by ammonium sulfate precipitation of tissue culture supernatants. Halow et al., "Storing and purifying antibodies” In: Antibodies: A Laboratory Manual, p. 283-318. E. Halow and D. Lane (ed.), Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1988). The concentrated protein is biotinylated by incubation with N-hydroxysuccinimidobiotin (Sigma Chemical Co.) (ca. 100 mg/mg of antibody in the sample) at room temperature for 4 h.
- biotinylated protein is dialyzed extensively against phosphate-buffered saline (0.1 M sodium phosphate, 0.8% NaCl) (PBS), pH 7.0.
- phosphate-buffered saline 0.1 M sodium phosphate, 0.8% NaCl
- IgG antibodies are purified out of tissue culture supernatants by using a protein A column (Pierce Chemical Co., Rockford, 111.) according to the manufacturer's directions.
- IgM antibodies are purified from the culture supernatant by using a goat anti-mouse IgM antibody column (Pierce Chemical Co.). The tissue culture supernatant is diluted 1:1 in PBS and applied to the goat anti-mouse IgM column, which is equilibrated with PBS. Washing and elution of antibody off the column is performed according to the manufacturer's directions. Fractions containing protein are pooled and concentrated with a Centricon 10 microconcentrator (Amicon, Danvers, Mass.) and centrifugation at 3,000 3 g for 30 min.
- the present invention contemplates methods for detecting microbial spores comprising: a) providing; i) a substrate surface suspected of contamination by at least one microbial spore, said spore comprising at least one surface protein; and ii) a anti-surface protein antibody capable of binding to the at least one surface protein; b) contacting the anti- surface protein antibody with the substrate surface under conditions such that the antibody binds to the at least one surface protein, wherein an antibody/protein complex is created; and c) detecting the antibody/protein complex.
- the spore surface protein includes, but is not limited to, CD 1067, CD 1581 , CD 3520, CD 0372, or CD 1613.
- the anti- surface protein antibody comprises a label.
- the label comprises a fluorescent label.
- the surface protein is a Clostridium difficile surface protein.
- the surface protein is a Bacillus anthracis surface protein.
- a microbial surface protein antibody can be directed towards a specific epitope on a spore surface protein (i.e., whether an amino acid sequence or other antigenic structure).
- a specific C. difficile spore surface protein is used below in a method to generate polyclonal and monoclonal antibodies, but is should be understood that any microbial spore surface protein can be substituted wherein polyclonal and/or monoclonal antibodies directed against each respective microbial spore surface protein will be successfully generated.
- Mouse polyclonal antiserum and monoclonal antibodies against C. difficile hypothetical protein are obtained by several injections of isolated hypothetical protein (i.e., for example, approximately 10 proteins per injection). Monoclonal antibodies are produced according to the procedures of Kohl er and Milstein (Kohler and Milstein, 1975). Briefly, the mice can be boosted on days 21 and 42 and bled on day 50 for polyclonal antibodies, or boosted on day 50 and sacrificed for fusion on day 53 for monoclonal antibodies. Hybridomas may be screened for reactivity with C. difficile spores. Hybridomas found to be reactive are also screened for reactivity with the vegetative cells.
- Isotyping of monoclonal antibodies are performed by using a dot blot immunoassay format. Spores are applied to an Immobilon-P ® membrane (Millipore Corp., Bedford, Mass.) in a dot blot apparatus. The spores are then incubated with 100 ml of the appropriate tissue culture supernatants. Monoclonal antibody bound to spores are isotyped by using rabbit anti-mouse subclass specific antiserum obtained from Bio- Rad ® (Hercules, Calif.).
- the present invention contemplates methods for detecting microbial spores comprising: a) providing; i) a substrate surface suspected of contamination by at least one microbial spore, said spore comprising at least one surface protein; and ii) a anti-surface protein monoclonal antibody capable of binding to the at least one surface protein; b) contacting the anti-surface protein monoclonal antibody with the substrate surface under conditions such that the monoclonal antibody binds to the at least one surface protein, wherein a monoclonal antibody/protein complex is created; and c) detecting the monoclonal antibody/protein complex.
- the spore surface protein includes, but is not limited to, CD 1067, CD 1581, CD 3520, CD 0372, or CD 1613.
- the anti-surface protein monoclonal antibody comprises a label.
- the label comprises a fluorescent label.
- the surface protein is a Clostridium difficile surface protein.
- the surface protein is a Bacillus anthracis surface protein.
- the present invention generally incorporates model in vitro systems which mimic a given microbial system in vitro for which infection control compositions are desired.
- the range of systems against which these infection control compositions can be screened is extensive.
- potential infection control compositions are optionally screened for effects in blocking, slowing or otherwise inhibiting key events associated with infectious microbial organisms.
- potential infection control test compositions are optionally screened for their ability to block systems that are responsible, at least in part, for sporulation or for the binding of spores to a surface, including, e.g., skin, bodily tissues, granite, stainless steel, ceramic etc..
- Infection control test compositions which show promising results in these screening assay methods can then be subjected to further testing to identify effective pharmacological agents for the treatment of disease or symptoms of microbial infections
- the infection control composition screening models employed in the methods and apparatuses of the present invention will screen for an interaction of a infection control composition with a component of a biochemical system, e.g., receptor-ligand interaction, enzyme-substrate interaction, and the like.
- the screening model will typically include two interacting components of the system (i.e., for example, a bacterial spore protein and an infection control composition or a microbial enzyme and an infection control composition).
- the method comprises determining whether an infection control test composition has an effect on microbial spore protein binding interactions with a surface by contacting the microbial spore protein with the infection control test composition and assaying for residual binding of the microbial spore to the surface.
- the residual surface binding amount is then compared to a control surface binding, e.g., the same binding assay performed in the absence of the infection control composition.
- binding assays involve the measurement of a parameter of the screening system.
- parameter of the screening system is meant some measurable evidence, e.g., the presence or absence of a labeled group or a change in molecular weight (e.g., in binding reactions, transport screens), the presence or absence of a reaction product or substrate (in substrate turnover measurements), or an alteration in electrophoretic mobility (typically detected by a change in elution time of a labeled compound).
- the methods and apparatuses may also be used to screen for effectors of much more complex systems, where the result or end product of the system is known and assayable at some level, e.g., enzymatic pathways, spore surface signaling pathways and the like.
- the methods and apparatuses described herein are optionally used to screen for compounds that interact with a single component of a biochemical system, e.g., compounds that specifically bind to a particular biochemical compound, e.g., a receptor, ligand, enzyme, nucleic acid, structural macromolecule, etc.
- assays of this invention may involve the interaction of two or more components. Assays involving interactions between two components can be viewed as assays for enhancers or inhibitors of binding between members of "binding pairs". Preferred binding pairs include, but are not limited to, microbial spore proteins/small organic molecules, microbial spore proteins/nucleic acids, microbial spore proteins/infection control compositions (i.e., for example, Clostridium spore surface protein fragments).
- either member of the binding pair can be immobilized (i.e., for example, attached to the surface) while the other member is in a solution contacted to the surface.
- both members can be attached to different surfaces which are then juxtaposed to perform the assay.
- the present invention will be useful in screening for infection control compositions that form a binding pair with a receptor molecule, wherein the binding pair affects an interaction between the receptor molecule and a surface.
- the term "receptor” generally refers to one member of the binding pair (i.e., for example, a microbial spore surface protein).
- the other member of the binding pair is termed "an infection control composition.
- a receptor/ligand pair may include a typical protein receptor, usually membrane associated, and its natural ligand, e.g., another protein or small molecule.
- Receptor/ligand pairs may also include antibody/antigen binding pairs, complementary nucleic acids, nucleic acid associating proteins and their nucleic acid ligands.
- a receptor/ligand interaction i.e., for example, a microbial spore surface protein/infection control composition interaction
- a test compound i.e., for example, a microbial spore surface protein/infection control composition interaction
- the level of binding of the receptor/ligand pair is then compared to negative and/or positive controls. Where a decrease in normal binding is seen, the test compound is determined to be an inhibitor of the receptor/ligand binding. Where an increase in that binding is seen, the test compound is determined to be an enhancer or inducer of the interaction.
- the receptor/ligand interaction is assayed by measuring the amount of residual binding of the receptor to a surface in the presence of the infection control composition.
- high throughput screening assays may comprise multiwell reaction plates, e.g., multi-well microplates, which allow for the simultaneous, parallel screening of large numbers of potential infection control compositions.
- a similar, and perhaps overlapping, set of biochemical systems may include the interactions between microbial enzymes and their substrates.
- effectors of an enzyme's activity toward its substrate are screened by contacting the enzyme with a substrate in the presence and absence of the compound to be screened and under conditions optimal for detecting changes in the enzyme's activity. After a set time for reaction, the mixture is assayed for the presence of reaction products or a decrease in the amount of substrate.
- the amount of substrate that has been catalyzed is them compared to a control, i.e., enzyme contacted with substrate in the absence of test compound or presence of a known effector.
- a control i.e., enzyme contacted with substrate in the absence of test compound or presence of a known effector.
- an inhibitor a compound that reduces the enzymes activity toward its substrate
- aninducer a compound that accentuates that activity
- the infection control test compositions are provided in various different media including, but not limited to, by injection, free in solution, attached to a carrier, attached to a solid support (i.e., for example, beads).
- a solid support i.e., for example, beads.
- suitable solid supports include agarose, cellulose, dextran (commercially available as, i.e., Sephadex, Sepharose) carboxymethyl cellulose, polystyrene, polyethylene glycol (PEG), filter paper, nitrocellulose, ion exchange resins, plastic films, glass beads, polyaminemethylvinylether maleic acid copolymer, amino acid copolymer, ethylene-maleic acid copolymer, nylon, silk, etc.
- test compounds are screened individually, or in groups.
- Group screening is particularly useful where hit rates for effective test compounds are expected to be low such that one would not expect more than one positive result for a given group.
- group screening is used where the effects of different test compounds are differentially detected in a single system.
- the present invention contemplates immunological tests where a reaction takes place between two or more related immunological agents (i.e., for example, an antigen and antibody).
- immunological agents i.e., for example, an antigen and antibody.
- an antibody/antigen binding pair may be visualized using an indicator or carrier particle.
- an indicator or carrier particle comprises a polymeric particle technique in which synthetic resin particles, surfaces, or matrices have been used as an adsorbent onto which the appropriate antigen (i.e., for example, a microbial spore protein fragment) or antibody (i.e., for example, having affinity to a microbial spore protein fragment) has been adsorbed.
- Formats for immunoassays include, but are not limited to, competitive (e.g., ELISA, hapten inhibition, etc.) and noncompetitive assays.
- Various immunoassay formats have been reported. See, U.S. Pat. Nos. 4,366,241; 4,376,110; 4,517,288; and 4,837,168; Asai (1993) Methods in Cell Biology Volume 37: Antibodies in Cell Biology, Academic Press, Inc. New York, Stites & Terr, eds. (1991) Basic and Clinical Immunology 7th Edition, etc.) and the references cited therein)(all reference herein incorporated by reference.
- the materials and methods of this invention are used to immobilize components in nucleic acid binding protein assays.
- such assays detect binding of a nucleic acid by one or more binding proteins.
- the assays are generally used to screen for agents that improve (specificity or affinity) or inhibit nucleic acid binding by one or more particular nucleic acid binding proteins.
- Nucleic acid binding proteins include, but are not limited to endonucleases, polymerases, nuclear transcription factor receptors, API proteins (i.e., for example, fas andjwn). Nucleic acid binding assays are facilitated by attachment to a surface of either the nucleic acid containing the protein binding site or the binding protein itself.
- the infection control compositions of this invention can also be used to purify the moiety (e.g., polypeptide(s)) to which they for binding pairs.
- the infection control compositions can be used in conjunction with virtually any anion or cation exchange resin. Suitable anion and cation exchange resins are commercially available. Cation exchange resins, for example include, but are not limited to, carboxymethylcellulose, while anion exchange resins include, but are not limited to, DEAE cellulose, DEAE SEPHAROSE gel filtration ion exchange media, heparin, and the like.
- the interaction of an infection control composition with a microbial spore surface protein can be exploited for purification purposes.
- the mica is provided as a bed (either of mica flakes or powder) through which the sample is flowed.
- the mica bed is housed in any of a variety of suitable vessels, including cartridges that are attachable to syringes, chromatography columns, and the like.
- the microbial spore surface protein binds to the mica bed, while other components of the sample are washed away. Non- specifically binding components can be eluted away using salt solutions at concentrations sufficient to release undesired components while retaining the microbial spore surface protein.
- the infection control composition can then be released by application of sufficient salt concentrations and/or other appropriate solvent mixtures as desired. 5.
- the methods and apparatuses of the invention are used in screening infection control test compositions using a continuous flow assay system.
- the use of such continuous flow assay systems are not limited to screening for spore surface protein binding to surfaces but can also be readily used in screening for inhibitors or inducers of enzymatic activity, or for agonists or antagonists of receptor-ligand binding.
- the continuous flow assay system involves the continuous flow of the particular biochemical system along a fluid pathway (i.e., for example, a microarray, a chromatography column, or a microfabricated channel).
- a fluid pathway i.e., for example, a microarray, a chromatography column, or a microfabricated channel.
- continuous generally refers to an unbroken or contiguous stream of the particular composition that is being continuously flowed.
- a continuous flow may include a constant fluid flow having a set velocity, or alternatively, a fluid flow which includes pauses in the flow rate of the overall system, such that the pause does not otherwise interrupt the flow stream.
- a functioning screening system comprises producing a detectable event or signal.
- detectable signals may include, but are not limited to, optically detectable chromophoric or fluorescent signals.
- detectable signals can be produced by products of the enzyme's catalytic action, e.g., on a chromogenic or fluorogenic substrate.
- binding systems e.g., receptor ligand interactions or microbial spore surface binding to surfaces, signals will typically involve the association of a labeled ligand with the receptor, or vice versa.
- labels are commonly detectable by spectroscopic, photochemical, biochemical, immunochemical, or chemical means.
- useful nucleic acid labels include 32 P, 35 S, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, dioxigenin, or haptens and proteins for which antisera or monoclonal antibodies are available.
- labels suitable for labeling biological components are known and are reported extensively in both the scientific and patent literature, and are generally applicable to the present invention for the labeling of biological components.
- Suitable labels include, but are not limited to, radionucleotides, enzymes, substrates, cofactors, inhibitors, fluorescent moieties, chemiluminescent moieties, magnetic particles, and the like.
- Labeling agents optionally include e.g., monoclonal antibodies, polyclonal antibodies, proteins, or other polymers such as affinity matrices, carbohydrates or lipids.
- Detection of labels may proceed by a variety of methods, including but not limited to, spectrophotometric or optical tracking of radioactive or fluorescent markers, or other methods which track a molecule based upon size, charge or affinity.
- a detectable moiety can be of any material having a detectable physical or chemical property.
- detectable labels exist in the fields of gel electrophoresis, column chromatography, solid substrates, spectroscopic techniques, and the like, and in general, labels useful in such methods can be applied to the present invention.
- a label may comprise any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical thermal, or chemical means.
- labels may include, but are not limited to, fluorescent dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, and the like), radiolabels (e.g., 3 H, 125 1, 35 S, 14 C, 32 P or 33 P), enzymes (e.g., LacZ, CAT, horse radish peroxidase, alkaline phosphatase and others, commonly used as detectable enzymes, either as marker products or as in an ELISA), nucleic acid intercalators (e.g., ethidium bromide) and colorimetric labels such as colloidal gold or colored glass or plastic (e.g.
- the present invention contemplates fluorescent labels that are typically characterized by one or more of the following: high sensitivity, high stability, low background, low environmental sensitivity and high specificity in labeling.
- Such fluorescent moieties which are incorporated into the labels of the invention may include, but are not limited to, 1- and 2-aminonaphthalene, p,p'-diaminostilbenes, pyrenes, quaternary phenanthridine salts, 9-aminoacridines, p,p'-diaminobenzophenone imines, anthracenes, oxacarbocyanine, merocyanine, 3-aminoequilenin, perylene, bis- benzoxazole, bis-p-oxazolyl benzene, 1 ,2-benzophenazin, retinol, bis-3-amino ⁇ yridinium salts, hellebrigenin, tetracycline, sterophenol, benzimidazolylphenylamine, 2-oxo-3- chromen, indole, xanthen, 7-hydroxycoumarin, phenoxazine, calicylate, strophant
- Individual fluorescent compounds which have functionalities for linking to an element detectable by embodiments of the invention, or which can be modified to incorporate such functionalities, include but are not limited to, dansyl chloride; fluoresceins such as 3,6-dihydroxy-9-phenylxanthhydrol; rhodamineisothiocyanate; N-phenyl l-amino-8-sulfonatonaphthalene; N-phenyl 2-amino- 6-sulfonatonaphthalene; 4-acetamido-4-isothiocyanato-stilbene-2,2'-disulfonic acid; pyrene-3-sulfonic acid; 2-toluidinonaphthalene-6-sulfonate; N-phenyl-N-methyl-2- aminoaphthalene-6-sulfonate; ethidium bromide; stebrine; auromine-0,2-(9'- anthroyl)palmitate; dansyl phosphatidyl
- fluorescent tags are commercially available, for example, from SIGMA chemical company (Saint Louis, Mo.), Molecular Probes, R&D systems (Minneapolis, Minn.), Pharmacia LKB Biotechnology (Piscataway, N.J.), CLONTECH Laboratories, Inc. (Palo Alto, Calif), Chem Genes Corp., Aldrich Chemical Company (Milwaukee, Wis.), Glen Research, Inc., GIBCO BRL Life Technologies, Inc. (Gaithersberg, Md.), Fluka Chemica-Biochemika Analytika (Fluka Chemie AG, Buchs, Switzerland), and Applied Biosystems (Foster City, Calif.).
- fluorescent labels absorb light above about 300 nm, preferably about 350 nm, and more preferably above about 400 nm, usually emitting at wavelengths greater than about 10 nm higher than the wavelength of the light absorbed. It should be noted that the absorption and emission characteristics of the bound label may differ from the unbound label. Therefore, when referring to the various wavelength ranges and characteristics of the labels, it is intended to indicate the labels as employed and not the label which is unconjugated and characterized in an arbitrary solvent. Fluorescent labels are detectable because by irradiating a fluorescent label with light, one can obtain a plurality of emissions. Thus, a single label can provide for a plurality of measurable events. Detectable signal may also be provided by chemiluminescent and bioluminescent sources.
- Chemiluminescent sources include a compound which becomes electronically excited by a chemical reaction and may then emit light which serves as the detectible signal or donates energy to a fluorescent acceptor.
- a diverse number of families of compounds have been found to provide chemiluminescence under a variety or conditions.
- One of compounds is 2,3-dihydro-l,4-phthalazinedione.
- the most popular compound is luminol, which is a 5-amino compound.
- Other members of the include the 5-amino- 6,7,8-trimethoxy- and the dimethylamino[ca]benz analog. These compounds can be made to luminesce with alkaline hydrogen peroxide or calcium hypochlorite and base.
- Chemiluminescent analogs include para-dimethylamino and -methoxy substituents. Chemiluminescence may also be obtained with oxalates, usually oxalyl active esters, e.g., p-nitrophenyl and a peroxide, e.g., hydrogen peroxide, under basic conditions. Other useful chemiluminescent compounds are also known and available, including -N-alkyl acridinum esters (basic H 2 O 2 ) and dioxetanes.
- luciferins may be used in conjunction with luciferase or lucigenins to provide bioluminescence.
- a label may be coupled directly or indirectly to a molecule to be detected (a product, substrate, enzyme, or the like) according to many methods. As indicated above, a wide variety of labels are used, with the choice of label depending on the sensitivity required, ease of conjugation of the compound, stability requirements, available instrumentation, and disposal provisions. Non-radioactive labels are often attached by indirect means. Generally, a ligand molecule (e.g., biotin) is covalently bound to a polymer.
- the ligand then binds to an anti-ligand (e.g., streptavidin) molecule which is either inherently detectable or covalently bound to a signal system, such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound.
- a signal system such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound.
- ligands and anti-ligands can be used. Where a ligand has a natural anti-ligand, for example, biotin, thyroxine, and Cortisol, it can be used in conjunction with labeled, anti- ligands. Alternatively, any haptenic or antigenic compound can be used in combination with an antibody. Labels can also be conjugated directly to signal generating compounds, e.g., by conjugation with an enzyme or fluorophore.
- Enzymes of interest as labels will primarily be hydrolases, particularly phosphatases, esterases and glycosidases, or oxidoreductases, particularly peroxidases.
- Fluorescent compounds include fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, etc.
- Chemiluminescent compounds include luciferin, and 2,3-dihydrophthalazinediones, e.g., luminol.
- Means of detecting labels are dependent upon the type of label.
- a means for detection may include, but is not limited to, a scintillation counter or photographic film as in autoradiography.
- a means for detection may include, but is not limited to, exciting the fluorochrome with the appropriate wavelength of light and detecting the resulting fluorescence, e.g., by microscopy, visual inspection, via photographic film, by the use of electronic detectors such as digital cameras, charge coupled devices (CCDs) or photomultipliers and phototubes, and the like.
- CCDs charge coupled devices
- photomultipliers and phototubes and the like.
- enzymatic labels may be detected by providing appropriate substrates for the enzyme and detecting the resulting reaction product.
- simple colorimetric labels are often detected simply by observing the color associated with the label. For example, conjugated gold often appears pink, while various conjugated beads appear the color of the bead.
- a continuous flow screening system generates a constant signal which varies only when a test compound is introduced that affects the system. Specifically, as the system components flow through the system, they will produce a relatively constant signal level at a detection zone.
- test compounds i.e., for example, infection control compositions
- the test compounds cause a deviation from the constant signal level at the detection zone. This deviation may then be correlated to the particular test compound screened.
- the present invention contemplates a method for detecting microbial spore surface protein binding to an epidermal layer.
- the epidermal layer is derived from skin.
- the epidermal layer is derived from an internal organ.
- the epidermal layer is derived from a mucosal membrane.
- the epidermal layer comprises a skin protein.
- the skin protein comprises involucrin.
- the skin protein comprises loricrin.
- the skin protein comprises cytokeratin. See, Figure 10.
- Enzyme-linked immunosorbent assay plates were coated with 5 mg of human keratin in 100 ⁇ l of PBS/well overnight at 4 0 C. Wells were then washed three times with PBS and then blocked with 1% bovine serum albumin in PBS for 1 h before the addition of spores. Spores (C. difficile prepared as described above) were diluted to a concentration having an absorbance of 1.0 at 600 run in PBS (approximately 5xlO 7 spores/ml) before being labeled with FITC. 100 ⁇ l of labeled spores were added per well, and the plates were incubated at 37 0 C for 1 h.
- EpiDermTM Skin Model plates 24-well or 96-well were blocked with 1% bovine serum albumin in PBS for 1 h before the addition of spores.
- Spores C. difficile prepared as described above
- PBS approximately 5x10 7 spores/ml
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Zoology (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Analytical Chemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Toxicology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK10745031.4T DK2411410T3 (en) | 2009-03-27 | 2010-03-26 | Compositions and methods for screening and use of compounds which counteract the track-surface interactions |
| BRPI1014121A BRPI1014121A2 (pt) | 2009-03-27 | 2010-03-26 | composições e métodos para investigação e uso de compostos que antagonizam as interações esporo-superfície |
| CA2756760A CA2756760A1 (en) | 2009-03-27 | 2010-03-26 | Compositions and methods for screening and using compounds antagonizing spore-surface interactions |
| ES10745031.4T ES2544435T3 (es) | 2009-03-27 | 2010-03-26 | Composiciones y métodos para examinar y usar compuestos que antagonizan interacciones espora-superficie |
| AU2010241947A AU2010241947B2 (en) | 2009-03-27 | 2010-03-26 | Compositions and methods for screening and using compounds antagonizing spore-surface interactions |
| CN2010800140986A CN102388064A (zh) | 2009-03-27 | 2010-03-26 | 用于筛选与使用拮抗孢子-表面交互作用的化合物的组合物与方法 |
| JP2012502303A JP5911421B2 (ja) | 2009-03-27 | 2010-03-26 | 組成物及び胞子−表面の相互作用と拮抗する化合物をスクリーニングする方法及び使用する方法 |
| EP10745031.4A EP2411410B1 (en) | 2009-03-27 | 2010-03-26 | Compositions and methods for screening and using compounds antagonizing spore-surface interactions |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16415409P | 2009-03-27 | 2009-03-27 | |
| US61/164,154 | 2009-03-27 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2010126670A2 true WO2010126670A2 (en) | 2010-11-04 |
| WO2010126670A3 WO2010126670A3 (en) | 2011-03-31 |
| WO2010126670A9 WO2010126670A9 (en) | 2011-06-30 |
Family
ID=43032739
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/028902 Ceased WO2010126670A2 (en) | 2009-03-27 | 2010-03-26 | Compositions and methods for screening and using compounds antagonizing spore-surface interactions |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US20100291100A1 (https=) |
| EP (1) | EP2411410B1 (https=) |
| JP (1) | JP5911421B2 (https=) |
| KR (1) | KR20110140128A (https=) |
| CN (1) | CN102388064A (https=) |
| AU (1) | AU2010241947B2 (https=) |
| BR (1) | BRPI1014121A2 (https=) |
| CA (1) | CA2756760A1 (https=) |
| DK (1) | DK2411410T3 (https=) |
| ES (1) | ES2544435T3 (https=) |
| PT (1) | PT2411410E (https=) |
| TW (1) | TW201039841A (https=) |
| WO (1) | WO2010126670A2 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB2491117A (en) * | 2011-05-20 | 2012-11-28 | Royal Holloway & Bedford New College | Coat proteins from Clostridium and Bacillus species |
| WO2015061529A1 (en) * | 2013-10-23 | 2015-04-30 | The Rockefeller University | Compositions and methods for prophylaxis and therapy of clostridium difficile infection |
| GB2525177A (en) * | 2014-04-14 | 2015-10-21 | New Royal Holloway & Bedford | Vaccine |
| CN108884434A (zh) * | 2016-04-05 | 2018-11-23 | Nch公司 | 富含营养的萌发剂组合物及孢子培养方法 |
| AU2014232376B2 (en) * | 2013-03-15 | 2019-05-02 | Spogen Biotech Inc. | Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing Bacillus spores on plants |
| WO2020247755A1 (en) * | 2019-06-05 | 2020-12-10 | Biovector, Inc. | Aptamers against clostridium difficile |
| JP2023522072A (ja) * | 2020-04-17 | 2023-05-26 | リブ・プロセス・インコーポレイテッド | クロストリディオイデス・ディフィシル菌のコロニー形成を低減または予防する方法 |
| US11898146B2 (en) | 2020-12-03 | 2024-02-13 | Liv Process, Inc. | Aptamers against Clostridium difficile, compositions comprising aptamers against Clostridium difficile and methods of using the same |
Families Citing this family (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9133251B2 (en) | 2008-02-22 | 2015-09-15 | The Curators Of The University Of Missouri | Bacillus based delivery system and methods of use |
| US20130243794A1 (en) * | 2010-12-03 | 2013-09-19 | Beth Israel Deaconess Medical Center, Inc. | Methods for predicting and treating infection-induced illnesses and predicting the severity of infection-induced illnesses |
| WO2012092469A2 (en) * | 2010-12-29 | 2012-07-05 | Cangene Corporation | Clostridium difficile antigens |
| WO2014193237A2 (en) * | 2013-05-30 | 2014-12-04 | Academisch Ziekenhuis Leiden H.O.D.N. Lumc | C diff protease |
| IL315468A (en) | 2014-09-17 | 2024-11-01 | Spogen Biotech Inc | Fusion proteins, recombinant bacteria, and methods for using recombinant bacteria |
| WO2018129249A1 (en) * | 2017-01-05 | 2018-07-12 | The University Of Chicago | Inhibition of enteric infection through the modulation of microbiota |
| AR113123A1 (es) | 2017-09-20 | 2020-01-29 | Spogen Biotech Inc | Proteínas de fusión, bacterias recombinantes y fragmentos del exosporio para promover la salud de las plantas |
| CN109706101B (zh) * | 2019-02-01 | 2022-10-11 | 东华大学 | 一种嗜冷芽孢八叠球菌及其应用 |
| CN110879209A (zh) * | 2019-12-09 | 2020-03-13 | 济南大学 | 一种γ-氨基丁酸的快速检测方法 |
| CN114395576B (zh) * | 2020-08-31 | 2023-11-14 | 南京工业大学 | 一种提高梭菌中蛋白表达效率的方法 |
| EP4317438A1 (en) * | 2021-03-30 | 2024-02-07 | Asahi Kasei Kabushiki Kaisha | Recombinant polypeptide having acyl-coa compound reducing activity |
| CN113247946B (zh) * | 2021-04-22 | 2022-07-05 | 哈尔滨工业大学 | 一种自组装纳米生物催化剂及其制备方法和在丁醇生产中的应用 |
| CN113278578B (zh) * | 2021-06-15 | 2022-09-16 | 广西大学 | 一种稻瘟病菌分生孢子的移植方法 |
| CN113308431B (zh) * | 2021-06-15 | 2022-09-16 | 广西大学 | 一种番茄灰霉病菌分生孢子的移植与分散方法 |
| CN117580590A (zh) * | 2021-07-02 | 2024-02-20 | 国立大学法人东京大学 | 用于抑制艰难梭菌的增殖的含有单克隆抗体的组合物 |
Citations (47)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3824190A (en) | 1969-12-23 | 1974-07-16 | West Laboratories Inc | Phenolic synthetic detergent-disinfectant |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| USRE28778E (en) | 1969-12-23 | 1976-04-20 | West Laboratories, Inc. | Phenolic synthetic detergent-disinfectant |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| US4517288A (en) | 1981-01-23 | 1985-05-14 | American Hospital Supply Corp. | Solid phase system for ligand assay |
| US4632772A (en) | 1982-02-22 | 1986-12-30 | Dexide, Inc. | Mild antimicrobial detergent composition |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4837168A (en) | 1985-12-23 | 1989-06-06 | Janssen Pharmaceutica N.V. | Immunoassay using colorable latex particles |
| US4981785A (en) | 1988-06-06 | 1991-01-01 | Ventrex Laboratories, Inc. | Apparatus and method for performing immunoassays |
| US5010175A (en) | 1988-05-02 | 1991-04-23 | The Regents Of The University Of California | General method for producing and selecting peptides with specific properties |
| US5051448A (en) | 1984-07-24 | 1991-09-24 | The Mclean Hospital Corporation | GABA esters and GABA analog esters |
| WO1991019735A1 (en) | 1990-06-14 | 1991-12-26 | Bartlett Paul A | Libraries of modified peptides with protease resistance |
| WO1992000091A1 (en) | 1990-07-02 | 1992-01-09 | Bioligand, Inc. | Random bio-oligomer library, a method of synthesis thereof, and a method of use thereof |
| US5114978A (en) | 1990-10-15 | 1992-05-19 | Rhone-Poulenc Surfactants And Specialties, L.P. | Anhydrous blends of p-chloro-m-xylenol in surfactant mixtures |
| US5169862A (en) | 1989-07-07 | 1992-12-08 | Peptide Technologies Corporation | Analogs of viscosin and their uses |
| US5192746A (en) | 1990-07-09 | 1993-03-09 | Tanabe Seiyaku Co., Ltd. | Cyclic cell adhesion modulation compounds |
| WO1993020242A1 (en) | 1992-03-30 | 1993-10-14 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US5288514A (en) | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
| US5288486A (en) | 1985-10-28 | 1994-02-22 | Calgon Corporation | Alcohol-based antimicrobial compositions |
| US5358691A (en) | 1992-03-27 | 1994-10-25 | Abbott Laboratories | Automated continuous and random access analytical system |
| US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US5519134A (en) | 1994-01-11 | 1996-05-21 | Isis Pharmaceuticals, Inc. | Pyrrolidine-containing monomers and oligomers |
| US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
| US5539083A (en) | 1994-02-23 | 1996-07-23 | Isis Pharmaceuticals, Inc. | Peptide nucleic acid combinatorial libraries and improved methods of synthesis |
| US5539085A (en) | 1993-08-20 | 1996-07-23 | Onyx Pharmaceuticals, Inc. | Bcl-2 and R-ras complex |
| US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
| US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
| US5559103A (en) | 1993-07-21 | 1996-09-24 | Cytel Corporation | Bivalent sialyl X saccharides |
| US5559410A (en) | 1992-12-17 | 1996-09-24 | Valeo Systemes D'essuyage | Device for controlling the function of an electric starting motor for a windshield wiper of a rear window of an automotive vehicle and for supplying an electric motor particularly to activate the windshield |
| US5569588A (en) | 1995-08-09 | 1996-10-29 | The Regents Of The University Of California | Methods for drug screening |
| US5576220A (en) | 1993-02-19 | 1996-11-19 | Arris Pharmaceutical Corporation | Thin film HPMP matrix systems and methods for constructing and displaying ligands |
| US5576423A (en) | 1994-12-02 | 1996-11-19 | Schering Corporation | Antibodies to the slam protein expressed on activated T cells |
| US5585639A (en) | 1995-07-27 | 1996-12-17 | Hewlett-Packard Company | Optical scanning apparatus |
| US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
| US5599677A (en) | 1993-12-29 | 1997-02-04 | Abbott Laboratories | Immunoassays for prostate specific antigen |
| US5635462A (en) | 1994-07-08 | 1997-06-03 | Gojo Industries, Inc. | Antimicrobial cleansing compositions |
| US5885530A (en) | 1996-06-28 | 1999-03-23 | Dpc Cirrus, Inc. | Automated immunoassay analyzer |
| US6159750A (en) | 1995-12-22 | 2000-12-12 | Abbott Laboratories | Fluorescence polarization immunoassay diagnostic method |
| US9610287B2 (en) | 2011-06-20 | 2017-04-04 | H. Lundbeck A/S | Method of administration of 4-((1R,3S)-6-chloro-3-phenyl-indan-1-yl)-1,2,2-trimethyl-piperazine and the salts thereof in the treatment of schizophrenia |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7655252B2 (en) * | 1999-04-28 | 2010-02-02 | The Regents Of The University Of Michigan | Antimicrobial nanoemulsion compositions and methods |
| US20050271689A1 (en) * | 2003-07-11 | 2005-12-08 | Chun-Ming Huang | Novel targets and compositions for use in decontamination, immunoprophylaxis, and post-exposure therapy against anthrax |
| ES2247085T3 (es) * | 2000-02-01 | 2006-03-01 | Tiax, Llc | Sistema de descontaminacion quimica y biologica. |
| US6656919B1 (en) * | 2002-01-11 | 2003-12-02 | Clarence L. Baugh | Method and a product for the rapid decontamination and sterilization of bacterial endospores |
| US7192601B2 (en) * | 2002-01-18 | 2007-03-20 | Walker Edward B | Antimicrobial and sporicidal composition |
| EP2725008A1 (en) * | 2003-08-18 | 2014-04-30 | NovaBay Pharmaceuticals, Inc. | N,N-dihalogenated amino acids and derivatives |
| GB0410958D0 (en) * | 2004-05-15 | 2004-06-16 | Haptogen Ltd | Methods for reducing biofilm formation in infectious bacteria |
| US7658706B2 (en) * | 2005-12-05 | 2010-02-09 | Rti Biologics, Inc. | Vascular graft sterilization and decellularization |
| GB0612456D0 (en) * | 2006-06-23 | 2007-03-28 | Secr Defence | Antibody for anthrax |
| CN101190946A (zh) * | 2006-12-01 | 2008-06-04 | 中国人民解放军第二军医大学 | 重组恶性疟原虫环子孢子表面蛋白及其制法和用途 |
| BRPI0906060A2 (pt) * | 2008-02-28 | 2015-12-01 | 3M Innovative Properties Co | anticorpos isolados, métodos de preparo de um anticorpo anti-clostridium difficile, composição e método para a detecção da presença de um esporo de clostridium difficile em uma amostra |
-
2010
- 2010-03-26 WO PCT/US2010/028902 patent/WO2010126670A2/en not_active Ceased
- 2010-03-26 EP EP10745031.4A patent/EP2411410B1/en not_active Not-in-force
- 2010-03-26 TW TW099109076A patent/TW201039841A/zh unknown
- 2010-03-26 US US12/748,011 patent/US20100291100A1/en not_active Abandoned
- 2010-03-26 CA CA2756760A patent/CA2756760A1/en not_active Abandoned
- 2010-03-26 PT PT107450314T patent/PT2411410E/pt unknown
- 2010-03-26 BR BRPI1014121A patent/BRPI1014121A2/pt not_active IP Right Cessation
- 2010-03-26 CN CN2010800140986A patent/CN102388064A/zh active Pending
- 2010-03-26 ES ES10745031.4T patent/ES2544435T3/es active Active
- 2010-03-26 DK DK10745031.4T patent/DK2411410T3/en active
- 2010-03-26 JP JP2012502303A patent/JP5911421B2/ja active Active
- 2010-03-26 KR KR1020117025319A patent/KR20110140128A/ko not_active Ceased
- 2010-03-26 AU AU2010241947A patent/AU2010241947B2/en not_active Ceased
Patent Citations (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3824190A (en) | 1969-12-23 | 1974-07-16 | West Laboratories Inc | Phenolic synthetic detergent-disinfectant |
| USRE28778E (en) | 1969-12-23 | 1976-04-20 | West Laboratories, Inc. | Phenolic synthetic detergent-disinfectant |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US4366241B1 (https=) | 1980-08-07 | 1988-10-18 | ||
| US4517288A (en) | 1981-01-23 | 1985-05-14 | American Hospital Supply Corp. | Solid phase system for ligand assay |
| US4632772A (en) | 1982-02-22 | 1986-12-30 | Dexide, Inc. | Mild antimicrobial detergent composition |
| US5051448A (en) | 1984-07-24 | 1991-09-24 | The Mclean Hospital Corporation | GABA esters and GABA analog esters |
| US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683202B1 (https=) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US5288486A (en) | 1985-10-28 | 1994-02-22 | Calgon Corporation | Alcohol-based antimicrobial compositions |
| US4837168A (en) | 1985-12-23 | 1989-06-06 | Janssen Pharmaceutica N.V. | Immunoassay using colorable latex particles |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683195B1 (https=) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US5010175A (en) | 1988-05-02 | 1991-04-23 | The Regents Of The University Of California | General method for producing and selecting peptides with specific properties |
| US4981785A (en) | 1988-06-06 | 1991-01-01 | Ventrex Laboratories, Inc. | Apparatus and method for performing immunoassays |
| US5169862A (en) | 1989-07-07 | 1992-12-08 | Peptide Technologies Corporation | Analogs of viscosin and their uses |
| WO1991019735A1 (en) | 1990-06-14 | 1991-12-26 | Bartlett Paul A | Libraries of modified peptides with protease resistance |
| WO1992000091A1 (en) | 1990-07-02 | 1992-01-09 | Bioligand, Inc. | Random bio-oligomer library, a method of synthesis thereof, and a method of use thereof |
| US5192746A (en) | 1990-07-09 | 1993-03-09 | Tanabe Seiyaku Co., Ltd. | Cyclic cell adhesion modulation compounds |
| US5114978A (en) | 1990-10-15 | 1992-05-19 | Rhone-Poulenc Surfactants And Specialties, L.P. | Anhydrous blends of p-chloro-m-xylenol in surfactant mixtures |
| US5358691A (en) | 1992-03-27 | 1994-10-25 | Abbott Laboratories | Automated continuous and random access analytical system |
| WO1993020242A1 (en) | 1992-03-30 | 1993-10-14 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
| US5288514A (en) | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
| US5559410A (en) | 1992-12-17 | 1996-09-24 | Valeo Systemes D'essuyage | Device for controlling the function of an electric starting motor for a windshield wiper of a rear window of an automotive vehicle and for supplying an electric motor particularly to activate the windshield |
| US5576220A (en) | 1993-02-19 | 1996-11-19 | Arris Pharmaceutical Corporation | Thin film HPMP matrix systems and methods for constructing and displaying ligands |
| US5559103A (en) | 1993-07-21 | 1996-09-24 | Cytel Corporation | Bivalent sialyl X saccharides |
| US5539085A (en) | 1993-08-20 | 1996-07-23 | Onyx Pharmaceuticals, Inc. | Bcl-2 and R-ras complex |
| US5599677A (en) | 1993-12-29 | 1997-02-04 | Abbott Laboratories | Immunoassays for prostate specific antigen |
| US5672480A (en) | 1993-12-29 | 1997-09-30 | Abbott Laboratories | Immunoassays for prostate specific antigen |
| US5519134A (en) | 1994-01-11 | 1996-05-21 | Isis Pharmaceuticals, Inc. | Pyrrolidine-containing monomers and oligomers |
| US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
| US5539083A (en) | 1994-02-23 | 1996-07-23 | Isis Pharmaceuticals, Inc. | Peptide nucleic acid combinatorial libraries and improved methods of synthesis |
| US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
| US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
| US5635462A (en) | 1994-07-08 | 1997-06-03 | Gojo Industries, Inc. | Antimicrobial cleansing compositions |
| US5576423A (en) | 1994-12-02 | 1996-11-19 | Schering Corporation | Antibodies to the slam protein expressed on activated T cells |
| US5585639A (en) | 1995-07-27 | 1996-12-17 | Hewlett-Packard Company | Optical scanning apparatus |
| US5569588A (en) | 1995-08-09 | 1996-10-29 | The Regents Of The University Of California | Methods for drug screening |
| US6159750A (en) | 1995-12-22 | 2000-12-12 | Abbott Laboratories | Fluorescence polarization immunoassay diagnostic method |
| US5885530A (en) | 1996-06-28 | 1999-03-23 | Dpc Cirrus, Inc. | Automated immunoassay analyzer |
| US9610287B2 (en) | 2011-06-20 | 2017-04-04 | H. Lundbeck A/S | Method of administration of 4-((1R,3S)-6-chloro-3-phenyl-indan-1-yl)-1,2,2-trimethyl-piperazine and the salts thereof in the treatment of schizophrenia |
Non-Patent Citations (171)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1996, JOHN WILEY AND SONS, INC. |
| "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS, pages: 9.31 - 9.58 |
| "Remington's Pharmaceutical Sciences 15th Edition,", pages: 1035 - 1038 |
| "Standard Test Method for Recovery of Microorganisms From Skin using the Cup Scrub Technique", ATSM INTERNATIONAL, 2009, pages 1874 - 09 |
| A. L. SONENSHEIN, J. A. HOCH, AND R. LOSICK: "Bacillus subtilis and other gram-positive bacteria. Biochemistry, physiology, and molecular genetics", 1993, AMERICAN SOCIETY FOR MICROBIOLOGY, article PRIEST, F. G.: "Systemics and ecology of Bacillus", pages: 3 - 16 |
| ANDERSEN G.: "Genome differences that distinguish Bacillus anthracis from Bacillus cereus and Bacillus thuringiensis", APPL. ENVIRON. MICROBIOL., vol. 69, 2003, pages 2755 - 2764 |
| AUGUSTO ET AL., AM. J RESPIR. CRIT. CARE MED., vol. 168, 2003, pages 335 - 341 |
| AUGUSTO ET AL., J BIOL. CHEM., vol. 277, 2002, pages 23484 - 23492 |
| BAILEY-SMITH ET AL.: "The ExsA protein of Bacillus cereus is required for assembly of coat and exosporium onto the spore surface", J. BACTERIOL., vol. 187, 2005, pages 3800 - 3806 |
| BANGHAM ET AL., J. MOL. BIOI., vol. 13, 1965, pages 238 - 252 |
| BARANY ET AL., PCR METHODS AND APPLIC., vol. 1, 1991, pages 5 |
| BARANY ET AL., PROC. NATL. ACAD. SCI., vol. 88, 1991, pages 189 |
| BARBUT ET AL.: "Epidemiology of recurrences or reinfections of Clostridium difficile-Associated diarrhea", J CLIN MICROBIOL, vol. 38, 2000, pages 2386 - 2388 |
| BARTLETT, J.: "Clostridium Difficile: Its Role in Intestinal Disease", 1988, ACADEMIC PRESS, article "Introduction", pages: 1 - 13 |
| BAUM C&EN, 18 January 1993 (1993-01-18), pages 33 |
| BEAMAN ET AL.: "Paracrystalline sheets reaggregated from solubilized exosporium ofBacillus cereus", J. BACTERIOL., vol. 107, 1971, pages 320 - 324 |
| BEAUCAGE ET AL., TETRA. LETT., vol. 22, 1981, pages 1859 - 1862 |
| BECK ET AL.: "Effect of growth on surface charge and hydrophobicity of Staphylococcus aureus", ANN. INST. PASTEURLMICROBIOL. (PARIS), vol. 139, 1988, pages 655 - 664 |
| BERKELMAN, JINFECT DIS., vol. 170, 1994, pages 272 - 277 |
| BORRIELLO ET AL.: "Virulence factors of Clostridium difficile", REV. INFECT. DIS., vol. 12, 1990, pages S185 - S191 |
| BOWMAN: "Peptide antibiotics and their role in innate immunity", ANNU. REV. IMMUNOL., vol. 13, 1995, pages 61 - 92 |
| BOYDSTON ET AL.: "Orientation within the exosporium and structural stability of the collagen like glycoprotein BclA of Bacillus anthracis", J. BACTERIOL., vol. 187, 2005, pages 5310 - 5317 |
| BOYDSTON ET AL.: "Orientation within the exosporium and structural stability of the collagen-like glycoprotein BcIA of Bacillus anthracis", J. BACTERIOL., vol. 187, 2005, pages 5310 - 5317 |
| BROUSSOLLE ET AL.: "Molecular and physiological characterisation of spore germination in Clostridium botulinum and C sporogenes", ANAEROBE, vol. 8, 2002, pages 89 - 100 |
| BROWN ET AL., METH. ENZYMOL., vol. 68, 1979, pages 109 - 151 |
| CALABI ET AL.: "Binding of Clostridium difficile surface layer proteins to gastrointestinal tissues", INFECT IMMUN, vol. 70, 2002, pages 5770 - 5778 |
| CAMPBELL ET AL., J. ORG. CHEM., vol. 59, 1994, pages 658 |
| CERQUETTI ET AL.: "Characterization of surface layer proteins from different Clostridium difficile clinical isolates", MICROB. PATHOG., vol. 28, 2000, pages 363 - 372 |
| CHANG ET AL.: "Immunocytochemical localization of antigens in B. cereus T spores", J. RAPID METHODS AUTOMAT. MICROBIOL., vol. 2, 1993, pages 229 - 233 |
| CHARLTON ET AL.: "Characterization of the exosporium of Bacillus cereus", J. APPL. MICROBIOL., vol. 87, 1999, pages 241 - 245 |
| CHEN ET AL., J. AMER. CHEM. SOC., vol. 116, 1994, pages 2661 |
| CHO ET AL., SCIENCE, vol. 261, 1993, pages 1303 |
| CLARKE ET AL.: "Analysis of Ebh, a 1.1-megadalton cell wall- associated fibronectin-binding protein of Staphylococcus aureus", INFECT. IMMUN, vol. 70, 2002, pages 6680 - 6687 |
| CLARKE ET AL.: "IsdA of Staphylococcus aureus is a broad spectrum, iron-regulated adhesin", MOL. MICROBIOL., vol. 51, 2004, pages 1509 - 1519 |
| CLARKE ET AL.: "The Staphylococcus aureus surface protein IsdA mediates resistance to innate defenses of human skin", CELL HOST MICROBE, vol. 1, 2007, pages 199 - 212 |
| COLE ET AL.: "Differentiation of Bacillus anthracis and other Bacillus species by lectins", J. CLIN. MICROBIOL., vol. 19, 1984, pages 48 - 53 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R LISS INC, pages: 77 - 96 |
| COLLIUOD ET AL., BIOCONJUGATE CHEM., vol. 4, 1993, pages 528 - 536 |
| COTE ET AL., MICROB. PATHOG., vol. 37, 2004, pages 169 - 175 |
| COTE ET AL., PROC NATL ACAD SCI, vol. 80, 1983 |
| CROUCH ET AL., ANNU. REV. PHYSIOL., vol. 63, 2001, pages 521 - 554 |
| D.J. LIPMAN; W.R. PEARSON, SCIENCE, vol. 227, 1985, pages 1435 - 1441 |
| DAUBENSPECK ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 30945 - 30953 |
| DEAMER ET AL.: "Liposomes", 1983, article "Liposome Preparation: Methods and Mechanisms" |
| DESROSIER ET AL.: "Synthesis of the exosporium during sporulation of Bacillus cereus", J. GEN. MICROBIOL., vol. 130, 1984, pages 935 - 940 |
| DEUTSCHER ET AL., METHODS IN ENZYMOLOGY, vol. 182, 1990 |
| DIEFFENBACH C. W. AND G. S. DVEKSLER: "PCR Primer, a Laboratory Manual", 1995, COLD SPRING HARBOR PRESS |
| DIXON ET AL., CELL. MICROBIOL., vol. 2, 2000, pages 453 - 463 |
| DIXON ET AL., N ENGL. J. MED., vol. 341, 1999, pages 815 - 826 |
| DOYLE ET AL.: "Hydrophobic characteristics of Bacillus spores", CURR. MICROBIOL., vol. 10, 1984, pages 329 - 332 |
| DRIKS A.: "Maximum shields: the assembly and function of the bacterial spore surface", TRENDS MICROBIOL., vol. 10, 2002, pages 251 - 254 |
| DU ET AL.: "Bacillus thuringiensis HD-73 spores have surfaced localized Cry lAc toxin: physiological and pathogenic consequences", APPL. ENVIRON. MICROBIOL., vol. 62, 1996, pages 3722 - 3726 |
| EISENBERG ET AL., J CELL BIOCHEM, vol. 31, 1986, pages 11 - 7 |
| ELDRED ET AL., J. MED. CHEM., vol. 37, 1994, pages 3882 |
| ERRINGTON: "Bacillus subtilis sporulation: regulation of gene expression and control of morphogenesis", MICROBIOL. REV., vol. 57, 1993, pages 1 - 33 |
| FINEGOLD AND MARTIN: "Diagnostic Microbiology, 6th Ed", 1982, pages: 13 - 15 |
| FOEGEDING ET AL.: "Polyclonal antibodies in an enzyme-linked immunosorbent assay (ELISA) to detect bacterial spores", J. RAPID METHODS AUTOMAT. MICROBIOL., vol. 2, 1993, pages 135 - 150 |
| FREEMAN ET AL.: "Antibiotics and Clostridium difficile", MICROBES INFECT., vol. 1, 1999, pages 377 - 384 |
| FURKA ET AL., INT. JPEPT. PROT. RES., vol. 37, 1991, pages 487 - 493 |
| G. CHAMBLISS AND J. C. VAR: "Spores VII", 1978, AMERICAN SOCIETY FOR MICROBIOLOGY, article ARONSON ET AL.: "Comparative structural and functional aspects of spore surfaces", pages: 54 - 61 |
| GALLO, JINVEST DERMATOL., vol. 111, 1998, pages 739 - 743 |
| GALLO, JLNVEST DERMATOL., vol. 111, 1998, pages 739 - 743 |
| GANZ ET AL., PHARMAC. THER., vol. 66, 1998, pages 191 - 205 |
| GARCIA-PATRONE ET AL.: "A glycoprotein multimer from Bacillus thuringiensis sporangia: dissociation into subunits and sugar composition", MOL. CELL. BIOCHEM., vol. 145, 1995, pages 29 - 37 |
| GEORGE W.: "Antimicrobial agent-associated colitis and diarrhea: historical background and clinical aspects", REV. INFECT. DIS., vol. 6, 1984, pages S208 - S213 |
| GERHARDT ET AL.: "Ultrastructure of the exosporium enveloping spores of Bacillus cereus", J. BACTERIOL., vol. 88, 1964, pages 1774 - 1789 |
| GERHARDT, P.: "Cytology of Bacillus anthracis", FED. PROC., vol. 26, 1967, pages 1504 - 1517 |
| GOOTZ ET AL., ANTIMICROB. AGENTS AND CHEMOTHER., vol. 28, no. 1, 1985, pages 69 - 73 |
| GREGORIADIS: "Drug Carriers in Biology and Medicine", 1979, pages: 287 - 341 |
| GUIDI-RONTANI ET AL., MOL. MICROBIOL., vol. 31, 1999, pages 9 - 17 |
| HACHISUKA ET AL.: "Fine filaments on the outside of the exosporium of Bacillus anthracis spores", J. BACTERIOL., vol. 91, 1966, pages 2382 - 2384 |
| HAGIHARA ET AL., JAMER. CHEM. SOC., vol. 114, 1992, pages 6568 |
| HALOW ET AL.: "Antibodies: A Laboratory Manual.", 1988, COLD SPRING HARBOR LABORATORY, article "Storing and purifying antibodies", pages: 283 - 318 |
| HENRIQUES ET AL.: "Structure and assembly of the bacterial endospore surface", METHODS, vol. 20, 2000, pages 95 - 110 |
| HIRATA ET AL., INFECT. IMMUN., vol. 62, 1994, pages 421 - 1426 |
| HIRSCHMANN, J. AMER. CHEM. SOC., vol. 114, 1992, pages 9217 - 9218 |
| HOBBS ET AL., PROC. NAT. ACAD. SCI. USA, vol. 90, 1993, pages 6909 - 6913 |
| HOENIGER ET AL.: "Ultrastructural aspects of spore germination and outgrowth in Clostridium sporogenes", CAN. J. MICROBIOL., vol. 15, 1969, pages 1061 - 1065 |
| HOLM ET AL., J. MOL. BIOL., vol. 233, 1993, pages 123 - 138 |
| HORSBURGH ET AL.: "In Staphylococcus aureus, Fur is an interactive regulator with PerR, contributes to virulence, and is necessary for oxidative stress resistance through positive regulation of catalase and iron homeostasis", J. BACTERIOL., vol. 183, 2001, pages 468 - 475 |
| HOUGHTON ET AL., NATURE, vol. 354, 1991, pages 84 - 88 |
| HWANG ET AL., BIOCHEM CELL BIOL, vol. 76, 1998, pages 235 - 246 |
| INGLESBY ET AL.: "Anthrax as a biological weapon, 2002: updated recommendations for management", JAMA, vol. 287, 2002, pages 2236 - 2252 |
| ITO ET AL.: "Sterilization of packaging materials using aseptic systems", FOOD TECHNOL., vol. 38, 1984, pages 60 - 62 |
| IWANE ET AL., BIOPHYS. BIOCHEM. RES. COMM., vol. 230, 1997, pages 76 - 80 |
| KANEDA ET AL., JBIOL CHEM, vol. 264, 1989, pages 12126 - 12129 |
| KJELLEBERG, S.: "Microbial adhesion and aggregation", 1984, SPRINGER-VERLAG, article "Adhesion to inanimate surfaces", pages: 51 - 70 |
| KOEHLER ET AL., NATURE, vol. 256, 1975, pages 495 - 497 |
| KOEHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOHLER ET AL.: "Continuous cultures of fused cells secreting antibody of predefined specificity", NATURE, vol. 296, 1975, pages 495 - 497 |
| KOSBOR ET AL., IMMUNOL TODAY, vol. 4, 1983, pages 72 |
| KOSHIKAWA ET AL.: "Surface hydrophobicity of spores of Bacillus spp", J. GEN. MICROBIOL., vol. 135, 1989, pages 2717 - 2722 |
| KRAMER ET AL.: "Ultrastructural differences in the exosporium of the Sterne and Vollum strains ofBacillus anthracis", CAN. J. MICROBIOL., vol. 14, 1968, pages 1297 - 1299 |
| KUIPERS ET AL.: "Quorum sensing- controlled gene expression in lactic acid bacteria", J. BIOTECHNOL., vol. 64, 1998, pages 15 - 21 |
| KUIPERS, O. P.; P. G. G. A. DE RUYTER; M. KLEEREBEZEM; W. M. DE VOS: "Controlled overproduction of proteins by lactic acid bacteria", J. BIOTECHNOL., vol. 64, 1998, pages 15 - 21 |
| KUTIMA ET AL.: "Involvement of the spore surface in germination of Bacillus cereus T spores", APPL. ENVIRON. MICROBIOL., vol. 53, 1987, pages 47 - 52 |
| LIANG ET AL., SCIENCE, vol. 274, 1996, pages 1520 - 1522 |
| LIKEWISE; KU ET AL., J. MED. CHEM., vol. 38, 1995, pages 9 |
| LU ET AL., ANAL. CHEM., vol. 67, 1995, pages 83 - 87 |
| MAHONEY, FEBS LETT, vol. 377, 1995, pages 519 - 522 |
| MANIATIS, T. ET AL., SCIENCE, vol. 236, 1987, pages 1237 |
| MATZ ET AL.: "Chemical composition of exosporium from spores of Bacillus cereus", J. BACTERIOL., vol. 101, 1970, pages 196 - 201 |
| MATZ ET AL.: "Chemical ultrastructure of the exosporium enveloping spores of Bacillus cereus", BACTERIOL. PROC., 1965, pages 31 |
| MCCORMACK ET AL., J CLIN. INVEST., vol. 109, 2002, pages 707 - 712 |
| MCFARLAND ET AL.: "Nosocomial acquisition of Clostridium difficile infection", NEW ENGL. J. MED., vol. 320, 1989, pages 204 - 210 |
| MINAGI ET AL.: "Cell-surface hydrophobicity of Candida species as determined by the contact-angle and hydrocarbon-adherence methods", J. GEN. MICROBIOL., vol. 132, 1986, pages 1111 - 1115 |
| MOCK: "Anthrax", ANNU. REV. MICROBIOL., vol. 55, 2001, pages 647 - 671 |
| MOIR ET AL.: "Spore germination", CELL MOL LIFE SCI., vol. 59, 2002, pages 403 - 409 |
| MOSELEY ET AL., I INFECT. DIS., vol. 142, 1980, pages 892 - 898 |
| N. MOZES, P. HANDLEY, H. BUSSCHER AND P. ROUXHET,: "Microbial Cell Surface Analysis", 1991, VCH PUBLISHERS, article HANCOCK, I: "Microbial cell surface architecture", pages: 23 - 59 |
| NARANG ET AL., METH. ENZYMOL., vol. 68, 1979, pages 90 - 99 |
| NG ET AL., LANGMUIR, vol. 11, 1995, pages 4048 - 4055 |
| NI EIDHIN ET AL.: "Clumping factor B (ClfB), a new surface-located fibrinogenbinding adhesin of Staphylococcus aureus", MOL. MICROBIOL., vol. 30, 1998, pages 245 - 257 |
| NORRIS J.: "Bacterial spore antigens: a review", J. GEN. MICROBIOL., vol. 28, 1962, pages 393 - 408 |
| O'BRIEN ET AL.: "Staphylococcus aureus clumping factor B (ClfB) promotes adherence to human type I cytokeratin 10: implications for nasal colonization", CELL. MICROBIOL., vol. 4, 2002, pages 759 - 770 |
| OHYE ET AL.: "Exosporium and spore surface formation in Bacillus cereus Tos", J. BACTERIOL., vol. 115, 1973, pages 1179 - 1190 |
| OHYE ET AL.: "Exosporium and spore surface formation", BACILLUS CEREUS T' L BACTERIOL, vol. 115, 1973, pages 1179 - 1190 |
| OREN ET AL., BIOPOLYMERS, vol. 47, no. 6, 1998, pages 451 - 463 |
| OZIN ET AL.: "SpoVID guides SafA to the spore surface in Bacillus subtilis", J. BACTERIOL., vol. 183, 2001, pages 3041 - 3049 |
| PANESSA-WARREN ET AL.: "Electron microscopy of C. sporogenes endospore attachment and germination", SCANNING, vol. 16, 1994, pages 227 - 240 |
| PANESSA-WARREN ET AL.: "Exosporial membrane plasticity of Clostridium sporogens and Clostridium difficile", TISSUE & CELL, vol. 29, 1997, pages 449 - 461 |
| PAREDES ET AL.: "A comparative genomic view of clostridial sporulation and physiology", NAT. REV. MICROBIOL., vol. 3, 2005, pages 969 - 978 |
| PERINE ET AL., INFECT. DISEASES, vol. 152, no. 1, 1985, pages 59 - 63 |
| PHILLIPS ET AL.: "Assessment of immunofluorescence measurements of individual bacteria in direct and indirect assays for Bacillus anthracis and Bacillus cereus spores", J. APPL. BACTERIOL., vol. 53, 1982, pages 223 - 231 |
| PLOMP ET AL.: "The high-resolution architecture and structural dynamics of Bacillus spores", BIOPHYS J, vol. 88, 2005, pages 603 - 608 |
| POTHOULAKIS ET AL.: "Microbes and microbial toxins: paradigms for microbial-mucosal interactions. II. The integrated response of the intestine to Clostridium difficile toxins", AM. J. PHYSIOL. -GASTROINT. LIVER PHYSIOL., vol. 280, 2001, pages G178 - G183 |
| PRINCEWELL, T.: "Spore antigens of Clostridium sporogenes", I MED. MICROBIOL., vol. 12, 1979, pages 29 - 41 |
| QUINLAN ET AL.: "Monoclonal antibodies for use in detection of Bacillus and Clostridium spores", APPL ENVIRON MICROBIOL., vol. 63, 1997, pages 482 - 487 |
| R. SCOPES: "Protein Purification", 1982, SPRINGER-VERLAG |
| RASMUSSEN ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 32313 - 32316 |
| REDMOND ET AL.: "Identification of proteins in the exosporium of Bacillus anthracis", MICROBIOL, vol. 150, 2004, pages 355 - 363 |
| REESE; BETTS: "A Practical Approach to Infectious Diseases", 1993 |
| ROSSMANN, M. G., AND ARNOLD, E.: "International Tables for Crystallography", vol. F, 2001, KLUWER ACADEMIC PUBLISHERS, article KLEYWEGT ET AL., pages: 353 - 356 |
| RUSSELL ET AL., INFECT IMMUN, vol. 64, no. 5, 1996, pages 1565 - 1568 |
| RUSSELL, A.: "Bacterial spores and chemical sporicidal agents", CLIN. MICROBIOL. REV., vol. 3, 1990, pages 99 - 119 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2d ed.", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK, J. ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd ed", 1989, COLD SPRING HARBOR LABORATORY PRESS, pages: 16.7 - 16.8 |
| SAMSONOFF ET AL.: "Ultrastructural changes associated with germination and outgrowth of an appendage-bearing clostridial spore", J. BACTERIOL., vol. 101, 1970, pages 1038 - 1045 |
| SCHMITT ET AL., ANGEW. CHEM. INT. ED. ENGL., vol. 35, 1996, pages 317 - 320 |
| SCHUHMANN ET AL., ADV. MATER., vol. 3, 1991, pages 388 - 391 |
| SEBAIHIA ET AL.: "The multi-drug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome", NATURE GENETICS, vol. 38, 2006, pages 779 - 786 |
| SIGAL ET AL., ANALYTICAL CHEM., vol. 68, 1996, pages 490 - 497 |
| SILVA, J. JR.: "Clostridium difficile: Its Role in Intestinal Disease", 1988, ACADEMIC PRESS, article "Prevention of Clostridium difficile-associated intestinal disease", pages: 368 - 378 |
| SINHA ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 4539 |
| SOUSA ET AL.: "An exosporium- like outer layer in Bacillus subtilis spores", NATURE, vol. 263, 1976, pages 53 - 54 |
| STEICHEN ET AL.: "Characterization of the exosporium basal layer protein BxpB of Bacillus anthracis", J BACTERIOL, vol. 187, 2005, pages 5868 - 5876 |
| STEICHEN ET AL.: "Identification of the immunodominant protein and other proteins of the Bacillus anthracis exosporium", J BACTERIOL., vol. 185, 2003, pages 1903 - 1910 |
| STEICHEN ET AL.: "Identification of the immunodominant protein and other proteins of the Bacillus anthracis exosporium", J. BACTERIOL., vol. 185, 2003, pages 1903 - 1910 |
| STITES & TERR,: "Basic and Clinical Immunology 7th Edition,", vol. 37, 1991, ACADEMIC PRESS, INC., article ASAI: "Methods in Cell Biology,Methods in Cell Biology" |
| STRYER ET AL., ANN. REV. BIOCHEM., vol. 47, 1978, pages 819 - 846 |
| SULLIVAN ET AL.: "New shuttle vectors for Bacillus subtilis and Escherichia coli which allow rapid detection of inserted fragments", GENE, vol. 29, 1984, pages 21 - 26 |
| SYLVESTRE ET AL.: "A collagen-like surface glycoprotein is a structural component of the Bacillus anthracis exosporium", MOL. MICROBIOL., vol. 45, 2002, pages 169 - 178 |
| SYLVESTRE ET AL.: "Contribution of ExsFA and ExsFB proteins to the localization of BclA on the spore surface and to the stability of the Bacillus anthracis exosporium", J BACTERIOL, vol. 187, 2005, pages 5122 - S 128 |
| SYLVESTRE ET AL.: "Polymorphism in the collagen region of the Bacillus anthracis BclA protein leads to variation in exosporium filament length", JBACTERIOL., vol. 185, 2003, pages 1555 - 1563 |
| SZOKA ET AL., PROC. NATL ACAD. SCI. USA, vol. 75, 1978, pages 4194 - 4198 |
| TAKUBO ET AL.: "Isolation and characterization of outermost layer deficient mutant spores of Bacillus megaterium", MICROBIOL. IMMUNOL., vol. 9, 1988, pages 973 - 979 |
| TAKUMI ET AL.: "Isolation and partial characterization of exosporium from spores of a highly sporogenic mutant of Clostridium botulinum type A", MICROBIOL. IMMUNOL., vol. 28, 1979, pages 443 - 454 |
| TAYLOR ET AL., J. CELL BIOL., vol. 89, 1981, pages 362 - 367 |
| TIPPER ET AL.: "Campbell. Amer. Soc. for Microbiol.", 1972, article "Structure of the bacterial endospore" |
| TODD ET AL., J. BACTERIOL., vol. 185, 2003, pages 3373 - 3378 |
| TRAVIS, SCIENCE, vol. 264, 1994, pages 360 - 362 |
| VAUGHN ET AL., NATURE BIOTECHNOLOGY, vol. 14, no. 3, 1996, pages 309 - 314 |
| VOTH ET AL.: "Clostridium difficile toxins: mechanism of action and role in disease", CLIN. MICROBIOL. REV., vol. 18, 2005, pages 247 - 263 |
| W.R. PEARSON; D.J. LIPMAN, PROC. NATL. ACAD. SCI. (USA), vol. 85, 1988, pages 2444 - 2448 |
| WALSH ET AL.: "Clumping factor B, a fibrinogen binding MSCRAMM (microbial surface component recognizing adhesive matrix molecules) adhesin of Staphylococcus aureus also binds the tail region of type I cytokeratin 10", J. BIOI. CHEM., vol. 279, 2004, pages 50691 - 50699 |
| WIENEK ET AL.: "Hydrophobicity of Bacillus and Clostridium spores", APPL ENVIRON MICROBIOL, vol. 56, 1990, pages 2600 - 2605 |
| WREN B.: "Molecular characterisation of Clostridium difficile toxins A and B", REV. MED. MICROBIOL., vol. 3, 1992, pages 21 - 27 |
| WU ET AL., GENOMICS, vol. 4, 1989, pages 560 |
| WU G. AND C. WU: "Liver diseases, targeted diagnosis and therapy using specific receptors and ligands", 1991, NEW YORK: MARCEL DEKKER, article GHOSH ET AL., pages: 87 - 104 |
| WUST ET AL.: "Investigation of an outbreak of antibiotic-associated colitis by various typing methods", CLIN. MICROBIOL, vol. 16, 1982, pages 1096 - 1101 |
| ZALEZNIK, D.: "Clostridium difficile: an important nosocomial pathogen for the 1990s", CLIN. MICROBIOL. NEWSLETTER, vol. 13, 1991, pages 145 - 152 |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9139625B2 (en) | 2011-05-20 | 2015-09-22 | Royal Holloway And Bedford New College | Pathogenic bacteria |
| GB2491117A (en) * | 2011-05-20 | 2012-11-28 | Royal Holloway & Bedford New College | Coat proteins from Clostridium and Bacillus species |
| AU2014232376B2 (en) * | 2013-03-15 | 2019-05-02 | Spogen Biotech Inc. | Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing Bacillus spores on plants |
| WO2015061529A1 (en) * | 2013-10-23 | 2015-04-30 | The Rockefeller University | Compositions and methods for prophylaxis and therapy of clostridium difficile infection |
| EP3060246A4 (en) * | 2013-10-23 | 2017-08-16 | The Rockefeller University | Compositions and methods for prophylaxis and therapy of clostridium difficile infection |
| GB2525177A (en) * | 2014-04-14 | 2015-10-21 | New Royal Holloway & Bedford | Vaccine |
| CN108884434A (zh) * | 2016-04-05 | 2018-11-23 | Nch公司 | 富含营养的萌发剂组合物及孢子培养方法 |
| CN108884434B (zh) * | 2016-04-05 | 2023-06-09 | Nch公司 | 富含营养的萌发剂组合物及孢子培养方法 |
| WO2020247755A1 (en) * | 2019-06-05 | 2020-12-10 | Biovector, Inc. | Aptamers against clostridium difficile |
| US11001847B2 (en) | 2019-06-05 | 2021-05-11 | Biovector, Inc. | Aptamers against Clostridium difficile |
| US11104905B2 (en) | 2019-06-05 | 2021-08-31 | Biovector, Inc. | Aptamers against Clostridium difficile |
| US12338442B2 (en) | 2019-06-05 | 2025-06-24 | Liv Process, Inc. | Aptamers against clostridium difficile |
| JP2023522072A (ja) * | 2020-04-17 | 2023-05-26 | リブ・プロセス・インコーポレイテッド | クロストリディオイデス・ディフィシル菌のコロニー形成を低減または予防する方法 |
| EP4136234A4 (en) * | 2020-04-17 | 2024-05-01 | Liv Process, Inc. | METHODS FOR REDUCING OR PREVENTING COLONIZATION BY DIFFICULT CLOSTRIDIOIDES |
| US11898146B2 (en) | 2020-12-03 | 2024-02-13 | Liv Process, Inc. | Aptamers against Clostridium difficile, compositions comprising aptamers against Clostridium difficile and methods of using the same |
Also Published As
| Publication number | Publication date |
|---|---|
| TW201039841A (en) | 2010-11-16 |
| EP2411410A2 (en) | 2012-02-01 |
| JP2012522010A (ja) | 2012-09-20 |
| EP2411410B1 (en) | 2015-07-08 |
| KR20110140128A (ko) | 2011-12-30 |
| WO2010126670A3 (en) | 2011-03-31 |
| AU2010241947A1 (en) | 2011-11-17 |
| PT2411410E (pt) | 2015-10-09 |
| BRPI1014121A2 (pt) | 2016-11-08 |
| CN102388064A (zh) | 2012-03-21 |
| CA2756760A1 (en) | 2010-11-04 |
| JP5911421B2 (ja) | 2016-05-18 |
| ES2544435T3 (es) | 2015-08-31 |
| WO2010126670A9 (en) | 2011-06-30 |
| DK2411410T3 (en) | 2015-09-07 |
| US20100291100A1 (en) | 2010-11-18 |
| AU2010241947B2 (en) | 2014-01-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK2411410T3 (en) | Compositions and methods for screening and use of compounds which counteract the track-surface interactions | |
| Coburn et al. | Lyme disease pathogenesis | |
| Gut et al. | Mechanism of inhibition of Bacillus anthracis spore outgrowth by the lantibiotic nisin | |
| Lenz et al. | Identification of a second Listeria secA gene associated with protein secretion and the rough phenotype | |
| Reder-Christ et al. | Model membrane studies for characterization of different antibiotic activities of lipopeptides from Pseudomonas | |
| Coullon et al. | N-Deacetylases required for muramic-δ-lactam production are involved in Clostridium difficile sporulation, germination, and heat resistance | |
| WO2002057303A2 (en) | Protein-protein interactions between shigella flexneri polypeptides and mammalian polypeptides | |
| Knerr et al. | Non-proteinogenic amino acids in lacticin 481 analogues result in more potent inhibition of peptidoglycan transglycosylation | |
| Park et al. | Fungicidal effect of antimicrobial peptide arenicin-1 | |
| Shargh et al. | In vitro toxicity evaluation of short cationic antimicrobial peptide (CM11) on Blastocystis sp | |
| KR20190028746A (ko) | 란티바이오틱 변형체 및 그의 용도 | |
| HK1163706A (en) | Compositions and methods for screening and using compounds antagonizing spore-surface interactions | |
| US7883711B2 (en) | Use of polypeptides having antimicrobial activity | |
| KR102296948B1 (ko) | 회색 짧은 꼬리 주머니쥐 유래의 광범위하고 강한 항균 활성을 갖는 항균성 폴리펩타이드 및 이를 포함하는 항균 조성물 | |
| CA2215345C (en) | Bacteriocins produced by ruminal bacteria | |
| KR102296950B1 (ko) | 회색 짧은 꼬리 주머니쥐 유래의 그람 음성균에 대한 강한 항균 활성을 갖는 항균성 폴리펩타이드 및 이를 포함하는 항균 조성물 | |
| Chaudhuri et al. | Cell surface characteristics of environmental and clinical isolates of Vibrio cholerae non-O1 | |
| KR102296949B1 (ko) | 회색 짧은 꼬리 주머니쥐 유래의 그람 양성균에 대한 강한 항균 활성 및 항바이러스 활성을 갖는 항미생물 폴리펩타이드 및 이를 포함하는 항미생물 조성물 | |
| JP2001233899A (ja) | 抗菌及び抗真菌ペプチド | |
| Antunes | The Composition and Function of the Spore Surface in the Human Pathogen Clostridioides Difficile | |
| Roberts et al. | The GlyGly-CTERM domain functions as an independent motif that targets proteins to rhombosortase in Vibrio cholerae | |
| US20050100899A1 (en) | Screening assays | |
| Kumru | Surface localization determinants of Borrelia burgdorferi lipoproteins | |
| Afonina | Characterizing the relationship between Sortase A-dependent substrates and the consequences of Srta deletion in Enterococcus faecalis | |
| Devlin | Murine Host Response to Spirochetes and Their Ligands |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080014098.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10745031 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 7055/DELNP/2011 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2756760 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012502303 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010745031 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20117025319 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2010241947 Country of ref document: AU Date of ref document: 20100326 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: PI1014121 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: PI1014121 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: PI1014121 Country of ref document: BR Kind code of ref document: A2 Effective date: 20110926 |