WO2010040769A1 - HERSTELLUNG UND VERWENDUNG VON HOCHREINEM HEMOPARATIDE (hPTH-1-37) FÜR DIE BEHANDLUNG VON ENTZÜNDLICH-SCHUPPENDEN ERKRANKUNGEN DER HAUT - Google Patents
HERSTELLUNG UND VERWENDUNG VON HOCHREINEM HEMOPARATIDE (hPTH-1-37) FÜR DIE BEHANDLUNG VON ENTZÜNDLICH-SCHUPPENDEN ERKRANKUNGEN DER HAUT Download PDFInfo
- Publication number
- WO2010040769A1 WO2010040769A1 PCT/EP2009/063017 EP2009063017W WO2010040769A1 WO 2010040769 A1 WO2010040769 A1 WO 2010040769A1 EP 2009063017 W EP2009063017 W EP 2009063017W WO 2010040769 A1 WO2010040769 A1 WO 2010040769A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hpth
- seq
- derivatives
- ointment
- treatment
- Prior art date
Links
- 238000004519 manufacturing process Methods 0.000 title claims description 7
- 230000002757 inflammatory effect Effects 0.000 title abstract description 5
- 208000017520 skin disease Diseases 0.000 title description 3
- 239000003814 drug Substances 0.000 claims abstract description 14
- 201000004681 Psoriasis Diseases 0.000 claims abstract description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 8
- 229940079593 drug Drugs 0.000 claims abstract description 8
- 201000010099 disease Diseases 0.000 claims abstract description 7
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 2
- 238000002360 preparation method Methods 0.000 claims description 11
- 238000003786 synthesis reaction Methods 0.000 claims description 10
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 9
- 239000002674 ointment Substances 0.000 claims description 8
- 238000000034 method Methods 0.000 claims description 7
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 claims description 6
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 claims description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 claims description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 claims description 3
- 229960004543 anhydrous citric acid Drugs 0.000 claims description 3
- 229960000686 benzalkonium chloride Drugs 0.000 claims description 3
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 claims description 3
- 238000004587 chromatography analysis Methods 0.000 claims description 3
- 230000001804 emulsifying effect Effects 0.000 claims description 3
- 239000003883 ointment base Substances 0.000 claims description 3
- 239000004302 potassium sorbate Substances 0.000 claims description 3
- 235000010241 potassium sorbate Nutrition 0.000 claims description 3
- 229940069338 potassium sorbate Drugs 0.000 claims description 3
- 230000008569 process Effects 0.000 claims description 3
- 239000008213 purified water Substances 0.000 claims description 3
- OULAJFUGPPVRBK-UHFFFAOYSA-N tetratriacontan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCO OULAJFUGPPVRBK-UHFFFAOYSA-N 0.000 claims description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 15
- 108090000445 Parathyroid hormone Proteins 0.000 description 14
- 239000000203 mixture Substances 0.000 description 14
- 108090000765 processed proteins & peptides Proteins 0.000 description 12
- 238000009472 formulation Methods 0.000 description 10
- 102100036893 Parathyroid hormone Human genes 0.000 description 9
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 210000003491 skin Anatomy 0.000 description 8
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 239000006071 cream Substances 0.000 description 6
- 239000002207 metabolite Substances 0.000 description 6
- 102000003982 Parathyroid hormone Human genes 0.000 description 5
- 239000013543 active substance Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 239000003480 eluent Substances 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 229940024606 amino acid Drugs 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000004128 high performance liquid chromatography Methods 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 3
- 238000005515 capillary zone electrophoresis Methods 0.000 description 3
- 230000004663 cell proliferation Effects 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 210000002381 plasma Anatomy 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- CBPJQFCAFFNICX-IBGZPJMESA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-4-methylpentanoic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H](CC(C)C)C(O)=O)C3=CC=CC=C3C2=C1 CBPJQFCAFFNICX-IBGZPJMESA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- -1 Fmoc amino acids Chemical class 0.000 description 2
- 101001135770 Homo sapiens Parathyroid hormone Proteins 0.000 description 2
- 101001135995 Homo sapiens Probable peptidyl-tRNA hydrolase Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 125000004122 cyclic group Chemical group 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 102000058004 human PTH Human genes 0.000 description 2
- 239000008311 hydrophilic ointment Substances 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 210000002510 keratinocyte Anatomy 0.000 description 2
- 239000012299 nitrogen atmosphere Substances 0.000 description 2
- 239000000199 parathyroid hormone Substances 0.000 description 2
- 125000001151 peptidyl group Chemical group 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- OGBMKVWORPGQRR-UMXFMPSGSA-N teriparatide Chemical compound C([C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CNC=N1 OGBMKVWORPGQRR-UMXFMPSGSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- OTKXCALUHMPIGM-FQEVSTJZSA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-5-[(2-methylpropan-2-yl)oxy]-5-oxopentanoic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H](CCC(=O)OC(C)(C)C)C(O)=O)C3=CC=CC=C3C2=C1 OTKXCALUHMPIGM-FQEVSTJZSA-N 0.000 description 1
- DHBXNPKRAUYBTH-UHFFFAOYSA-N 1,1-ethanedithiol Chemical compound CC(S)S DHBXNPKRAUYBTH-UHFFFAOYSA-N 0.000 description 1
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- BZLVMXJERCGZMT-UHFFFAOYSA-N Methyl tert-butyl ether Chemical compound COC(C)(C)C BZLVMXJERCGZMT-UHFFFAOYSA-N 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical group [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- 239000003875 Wang resin Substances 0.000 description 1
- NERFNHBZJXXFGY-UHFFFAOYSA-N [4-[(4-methylphenyl)methoxy]phenyl]methanol Chemical compound C1=CC(C)=CC=C1COC1=CC=C(CO)C=C1 NERFNHBZJXXFGY-UHFFFAOYSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 238000005266 casting Methods 0.000 description 1
- 210000004027 cell Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 238000003795 desorption Methods 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000006253 efflorescence Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 230000007803 itching Effects 0.000 description 1
- 229940124280 l-arginine Drugs 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000001906 matrix-assisted laser desorption--ionisation mass spectrometry Methods 0.000 description 1
- 230000007102 metabolic function Effects 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000013586 microbial product Substances 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 230000000849 parathyroid Effects 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 230000025053 regulation of cell proliferation Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 210000004927 skin cell Anatomy 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 229960005460 teriparatide Drugs 0.000 description 1
- 125000004213 tert-butoxy group Chemical group [H]C([H])([H])C(O*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000008312 unguentum emulsifican Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/29—Parathyroid hormone, i.e. parathormone; Parathyroid hormone-related peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
Definitions
- the invention relates to the use of hPTH-1-37 for the manufacture of a medicament for the treatment of inflammatory-scaly diseases, the use of its derivatives for the manufacture of a medicament for the treatment of inflammatory-scaly diseases, a process for the preparation of hPTH-1-37 and a drug comprising hPTH-1-37 or its derivatives.
- Hemoparatide is the naturally occurring form of the parathyroid hormone parathyroid hormone (hPTH) processed from human blood (Hock et al., 1997).
- PTH is a vital, parathyroid-derived peptide that plays a key role in many metabolic functions. In particular, it regulates cell proliferation and differentiation of keratinocytes in the skin.
- Hemoparatide is the most important bioactive form of PTH in the human body, as evidenced by the efficacy and concentration of this peptide in blood plasma.
- the effects of hPTH on the Skin does not develop in the organism therefore not by the complete molecule, but by the processed form hPTH-1-37.
- US-B-6066618 discloses a method for inhibiting the proliferation of mammalian skin cells, wherein hPTH 1-34 is used as the antiproliferative peptide. Furthermore, in DE-A-19508672 cyclic parathyroid hormone fragments of z. B. hPTH (I-34) discloses which u. a. can be used to treat psoriasis. Both disclosures have foreign derivatives of human parathyroid hormone in the content, which are therefore expected to be more adverse effects and a poorer bioavailability.
- WO-A-2004/024758 discloses parathyroid hormone peptides from fish. These are u. a. for the treatment of psoriasis.
- US-A-2007/0117157 describes the treatment of psoriasis with parathyroid hormone peptides from fish.
- the PTH derivatives described therein have an amino acid homology of only 53% to human PTH and have a markedly altered biological activity.
- WO 02/28420 relates to methods of regulating cell differentiation and proliferation, e.g. for the treatment of psoriasis by administration of nucleic acid molecules encoding PTH.
- WO-A-89/03873 relates to the regulation of cell proliferation by using peptides such as PTH (1-34). However, this application does not relate to PTH peptides 1-37.
- WO 2005-A-007184 relates to cyclic analogs of hPTH.
- WO-A-2008/150929 relates to topically administrable composition comprising hPTH 1-37 for the treatment of psoriasis in certain galenic preparations.
- the chemical synthesis of Hemoparatide has been carried out by several producers, providing the product for preclinical and clinical investigations and studies.
- the synthesis of hPTH is not trivial, so even products with high levels of impurities in incompletely synthesized peptides have been marketed.
- An object of the present invention is to provide a high purity form of hemoparatide for use as a therapeutic.
- galenic forms In addition to the purity requirements of hemoparatides, galenic forms must be found that optimize the use of the high-purity peptide, are adapted to the status and purpose of the treatment, and allow Hemoparatide to be used locally in inflammatory scaly (erythemato-squamous) skin conditions . Such formulations for Hemoparatide, even in highly pure form, are not yet available. Therefore, for today's regulations on the one hand, a sufficiently pure active substance must be available, which on the other hand can be provided in appropriate galenic forms, moreover can be produced commercially, and thus can be regarded as a highly pure form with the highest demands. A further object can thus be seen to provide the high-purity hPTH to be provided in a suitable pharmaceutical dosage form.
- An object of the present invention is the use of hPTH-1-37 with the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID NO: 1) for the manufacture of a medicament for the treatment of inflammatory-scaly (erythemato-squamous) diseases, in particular psoriasis.
- hPTH-1-37 has a molecular weight of 4401.13 Da.
- Another object of the present invention are derivatives of hPTH-1-37, namely their natural and pharmacologically acceptable derivatives, in particular amidated, acylated, phosphorylated and glycosylated derivatives for the manufacture of a medicament for the treatment of inflammatory scaly (erythemato-squamous) diseases, in particular psoriasis ,
- Another aspect of the invention is a process for the preparation of hPTH-1-37 or its derivatives, characterized in that they are synthesized by chemical synthesis from the partial sequences SVSEIQLMHNL (SEQ ID No. 2) and GKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 3) or SVSEIQLMHNL (SEQ ID No. 2), GKHLNSMERVEW (SEQ ID No. 4) and LRKKLQDVH N FVAL (SEQ ID No. 5) are prepared and purified by chromatography.
- the hemoparatides (hPTH-1-37) or its derivatives are used for the preparation of a medicament in various pharmaceutical application forms, in particular as a lyophilisate.
- a hydrophilic ointment is used in particular according to the German Pharmacopoeia as a galenic basis of application. It has surprisingly been found that the active substance is very stable except for methionine-oxidized metabolites in this formulation. These oxidized metabolites also occur as natural PTH forms in the blood plasma, but can be avoided by working in a nitrogen atmosphere and are free from side effects as naturally occurring endogenous derivatives.
- a further aspect of the invention is a pharmaceutical composition containing from 300 micrograms to 30 milligrams of hPTH-1-37 per gram of preparation (SEQ ID No. 1) and / or from 300 micrograms to 30 milligrams of its derivatives.
- the formulation in one embodiment contains typical ointment bases into which the peptide hPTH-1-37 is incorporated.
- a typical ointment contains:
- Anhydrous citric acid 0.01 - 1.5 g, especially 0.07 g
- Benzalkonium chloride 50-200 mg, especially 100 mg
- the amount of hPTH 1-37 may be 0.01 to 1.0% by weight based on the ointment base.
- Figure 1 discloses an HPLC chromatogram of the high purity hemoparatide
- FIG. 2 shows a MALDI (matrix assisted laser desorption / ionization) MS spectrum of hPTH (l-37) end product.
- Figure 3 discloses a chromatogram of capillary zone electrophoresis (CZE) of hPTH (l-37) end product.
- Figures 4A and 4B disclose HPLC chromatograms of hPTH- (1-37).
- Figure 4A shows a chromatogram of freshly prepared hPTH- (1-37).
- Figure 5 discloses the comparison between the HPLC chromatograms of freshly prepared hPTH-1-37
- the peptides of the invention are prepared by chemical synthesis in solution or on the solid support. This can be different
- the peptides according to the invention can be obtained from the protected peptide fragment by convergent synthesis.
- the temporary Fmoc protecting groups were cleaved with 20% piperidine in N-methyl-2-pyrrolidinone within 2-10 minutes. After removal of the Fmoc protecting group, the peptidyl resin was washed thoroughly and repeatedly with NMP followed by dichloromethane and dried. The dry resin was then suspended to cleave the peptide in a freshly prepared mixture of trifluoroacetic acid, ethanedithiol and water (94: 3: 3, vol, 20 ml per 1 g peptidyl resin) and shaken for three hours. The mixture was filtered, the residue was washed with further elimination mixture and the combined filtrates are added slowly with cooling to 10 times the volume of cold tert-butyl methyl ether. The precipitated deprotected peptidic material was stored overnight at + 4 ° C and then isolated by filtration or centrifugation and dried in vacuo.
- the crude peptide was dissolved in 10% acetic acid and purified by chromatography (Waters Prep-Pak C18, 47 x 300 mm, eluent A: 0.7% trifluoroacetic acid (TFA) in water, eluant B: 0.7% TFA in acetonitrile / water 4 : 1 (vol), gradient: 35-55% Eluent B in 40 minutes, detection: UV at 215 nm, flow rate: 40 ml / min). Fractions containing the product in sufficient purity (determined by analytical HPLC) were combined and freeze-dried.
- TFA trifluoroacetic acid
- the dry product was taken up in 10% acetic acid and chromatographed in the presence of acetic acid / acetate (Waters Prep-Pak C18, 47 x 300 mm, equilibrated with 0.1 M ammonium acetate solution, eluent A: 10% acetic acid in Water: eluent B: 2% acetic acid in acetonitrile / water 4: 1 (vol), gradient: 10-60% eluent B in 40 minutes, detection: UV at 215 nm, flow rate: 40 ml / min). Fractions of sufficient purity were combined and freeze-dried.
- Tab. 1 The essential specifications that are used for the shape of the peptide as a high-purity product.
- the galenic application are preferably creams on an oil-in-water basis, in the aqueous phase, the water-soluble hemoparatide is incorporated.
- Hemoparatide was incorporated into this base in concentrations of 0.03 wt%, 0.1 wt% and 0.3 wt%.
- the active substance is very stable except for methionine-oxidized metabolites in this formulation.
- These oxidized metabolites also occur as natural PTH forms in the blood plasma, but can be avoided by working in a nitrogen atmosphere and are free from side effects as naturally occurring endogenous derivatives.
- To use the cream formulation it is applied as usual in galenic units preferably twice a day thinly on the skin.
- the hPTH-1-37 cream was applied twice a day thinly on the lateral calf area to the right, dorsal to the arrows:
- the treated area has an area of approx. 4 x 10 cm.
- the ointment per application contains a total of> 20 ⁇ g hPTH-1-37, ie 40 ⁇ g per day.
- Left picture shows the right lower leg before treatment, right picture after 14 days of treatment.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Endocrinology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Dermatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Verwendung von hPTH-1-37 mit der Aminosäurensequenz SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) oder seiner natürlichen und pharmakologisch verträglichen Derivate, insbesondere amidierte, acylierte, phosphorylierte und glycosylierte Derivate zur Herstellung eines Arzneimittels zur Behandlung von entzündlich-schuppenden (erythemato-squamösen) Erkrankungen, insbesondere von Psoriasis, wobei hPTH-1-37 (SEQ ID No. 1) in einer Menge von 300 μg bis mg pro Gramm Arzneimittel vorliegt.
Description
Herstellung und Verwendung von hochreinem Hemoparatide (hPTH-1-37') für die Behandlung von entzündlich-schuppenden Erkrankungen der Haut
Die Erfindung betrifft die Verwendung von hPTH-1-37 zur Herstellung eines Arzneimittels zur Behandlung von entzündlich-schuppenden Erkrankungen, die Verwendung seiner Derivate zur Herstellung eines Arzneimittels zur Behandlung von entzündlich-schuppenden Erkrankungen, ein Verfahren zur Herstellung von hPTH-1-37 sowie ein Arzneimittel, welches hPTH-1-37 oder dessen Derivate umfasst.
Hemoparatide (hPTH-1-37) ist die natürlich vorkommende Form des prozessierten Nebenschilddrüsenhormons Parathormon (hPTH), das aus menschlichem Blut dargestellt wurde (Hock et al., 1997). PTH ist ein lebenswichtiges, in der Nebenschilddrüse gebildetes Peptid, das bei zahlreichen Stoffwechselfunktionen eine Schlüsselrolle spielt. Insbesondere reguliert es in der Haut Zellproliferation und Differenzierung der Keratinozyten.
Beim Fehlen von oder Mangel an hPTH treten gravierende Erkrankungen der Haut wie Entzündung, Verdickung und Schuppung auf, da PTH die Zellproliferation der unreifen Keratinozyten hemmt und gleichzeitig deren Umwandlung in reife Hornzellen, die die oberste Schicht der Haut bilden, fördert (Whitfield et al. 2004). Daher können solche entzündlich-schuppenden (erythematom-squamöse) Hauterkrankungen durch die topische Zuführung von PTH therapiert werden. Die Behandlung dieser Erkrankungen, die sowohl die Bereitstellung eines hochreinen Wirkstoffes als auch die Applikation auf die Haut umfasst, wird im folgenden beschrieben und ist Gegenstand der Erfindung.
Hemoparatide ist, wie aus der Wirksamkeit und Konzentration dieses Peptides im Blutplasma hervorgeht, die bedeutendste bioaktive Form des PTH im menschlichen Körper. Die oben beschriebenen Wirkungen von hPTH auf die
Haut entstehen im Organismus daher nicht durch das vollständige Molekül, sondern durch die prozessierte Form hPTH-1-37.
US-B-6066618 offenbart ein Verfahren zur Inhibierung der Proliferation von Säugetierhautzellen, wobei hPTH 1-34 als antiproliferatives Peptid eingesetzt wird. Ferner sind in DE-A-19508672 zyklische Parathormonfragmente von z. B. hPTH(l-34) offenbart, welche u. a. zur Behandlung von Psoriasis eingesetzt werden können. Beide Offenbarungen haben körperfremde Derivate von humanem Parathormon zum Inhalt, bei denen daher verstärkt unerwünschte Wirkungen und eine schlechtere Bioverfügbarkeit zu erwarten sind.
Darüber hinaus sind in WO-A-2004/024758 Parathormon-Peptide aus Fischen offenbart. Diese eignen sich u. a. zur Behandlung von Psoriasis.
Auch US-A-2007/0117157 beschreibt die Behandlung von Psoriasis mit Parathormon-Peptiden aus Fischen. Die dort beschriebenen PTH-Derivate besitzen jedoch eine Aminosäure-Homologie von nur 53% gegenüber humanem PTH und weisen eine deutlich veränderte biologische Aktivität auf.
Die WO 02/28420 betrifft Verfahren zur Regulation der Zelldifferentiation und Proliferation, z.B. zur Behandlung von Psoriasis durch Gabe von Nukleinsäuremolekülen, die für PTH kodieren.
Die WO-A-89/03873 betrifft die Regulation der Zellproliferation durch Verwendung von Peptiden wie PTH (1-34). Diese Anmeldung betrifft aber keine PTH-Peptide 1-37.
Die WO 2005-A-007184 betrifft zyklische Analoga des hPTH.
Die WO-A-2008/150929 betrifft topikal verabreichbare Zusammensetzung mit hPTH 1-37 zur Behandlung von Psoriasis in bestimmten galenischen Zubereitungen.
Die chemische Synthese von Hemoparatide haben verschiedene Produzenten durchgeführt und somit das Produkt für präklinische und klinische Untersuchungen und Studien geliefert. Die Synthese des hPTH ist nicht trivial, sodass sogar Produkte mit hohen Verunreinigungen an unvollständig synthetisierten Peptiden vertrieben wurden.
Eine Aufgabe der vorliegenden Erfindung ist die Bereitstellung einer hochreinen Form vom Hemoparatide zur Verwendung als Therapeutikum.
Neben den Anforderungen an die Reinheit von Hemoparatide müssen auch galenische Formen gefunden werden, die die Verwendung des hochreinen Peptides optimieren, dem jeweiligen Status und Ziel der Behandlung angepasst sind und es erlauben, Hemoparatide lokal bei den entzündlich- schuppenden (erythemato-squamösen) Hauterkrankungen anzuwenden. Solche Formulierungen für Hemoparatide, auch in hochreiner Form, liegen bisher nicht vor. Deshalb muss für heutige Vorschriften einerseits ein ausreichend reiner Wirkstoff verfügbar sein, der andererseits in entsprechenden galenischen Formen bereitgestellt werden kann, darüber hinaus kommerziell herstellbar ist, und somit als hochreine Form mit höchstem Anspruch angesehen werden kann. Eine weitere Aufgabe kann also darin gesehen werden, das zur Verfügung zu stellende, hochreine hPTH in einer angemessenen galenischen Darreichungsform bereitzustellen.
Diese Aufgaben werden durch die Verwendung gemäß Anspruch 1 und das Verfahren gemäß Anspruch 3 gelöst.
Ein Gegenstand der vorliegenden Erfindung ist die Verwendung von hPTH-1-37 mit der Aminosäurensequenz SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID NO. 1) zur Herstellung eines Arzneimittels zur Behandlung von entzündlich-schuppenden (erythemato-squamösen) Erkrankungen, insbesondere von Psoriasis.
In einer Ausführungsform weist das hPTH-1-37 ein Molekulargewicht von 4401.13 Da auf.
Ein weiterer Gegenstand der vorliegenden Erfindung sind Derivate von hPTH- 1-37, nämlich ihre natürlichen und pharmakologisch verträglichen Derivate, insbesondere amidierte, acylierte, phosphorylierte und glycosylierte Derivate zur Herstellung eines Arzneimittels zur Behandlung von entzündlichschuppenden (erythemato-squamösen) Erkrankungen, insbesondere von Psoriasis.
Ein weiterer Aspekt der Erfindung ist ein Verfahren zur Herstellung von hPTH- 1-37 oder seiner Derivate, dadurch gekennzeichnet, dass diese über chemische Synthese aus den Teilsequenzen SVSEIQLMHNL (SEQ ID No. 2) und GKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID NO. 3) oder SVSEIQLMHNL(SEQ ID No. 2), GKHLNSMERVEW (SEQ ID NO. 4) und LRKKLQDVH N FVAL (SEQ ID No. 5) hergestellt und chromatographisch gereinigt werden.
In einer Ausgestaltung der Erfindung werden das Hemoparatide (hPTH-1-37) oder dessen Derivate zur Herstellung eines Arzneimittels in verschiedenen galenischen Applikationsformen, insbesondere als Lyophilisat, verwendet. In einer Ausführungsform dieses Arzneimittels wird eine hydrophile Salbe insbesondere nach Deutschem Arzneibuch als galenische Applikationsgrundlage verwendet. Es wurde überraschend festgestellt, dass der Wirkstoff bis auf methionin-oxidierte Metabolite in dieser Formulierung sehr stabil ist. Diese oxidierten Metaboliten kommen auch als natürliche PTH- Formen im Blutplasma vor, können aber durch Arbeiten in Stickstoffatmosphäre vermieden werden und sind als natürlich vorkommende körpereigene Derivate nebenwirkungsfrei.
Einen weitereren Aspekt der Erfindung stellt ein Arzneimittel dar, enthaltend 300 Mikrogramm bis 30 Milligramm von hPTH-1-37 pro Gramm Zubereitung (SEQ ID No. 1) und/oder 300 Mikrogramm bis 30 Milligramm seiner Derivate.
Die Formulierung enthält in einer Ausführungsform typische Salbengrundlagen, in die das Peptid hPTH-1-37 eingearbeitet wird. Eine typische Salbe enthält:
Emulgierender Cetylstearylalkohol Typ A 15 - 25 g, insbesondere 21 g
Dünnflüssiges Wachs 5 - 15 g, insbesondere 10 g
Glycerol 85% 3 - 8 g, insbesondere 5 g
Kaliumsorbat 0,08 - 1,20 g, insbesondere 0,14 g
Wasserfreie Citronensäure 0,01 - 1,5 g, insbesondere 0,07 g
Benzalkoniumchlorid 50 - 200 mg, insbesondere 100 mg
EDTA 50 - 200 mg, insbesondere 100 mg
Gereinigtes Wasser ad 100 mg
Die Menge von hPTH 1- 37 kann 0,01 bis 1,0 Gew.%, bezogen auf die Salbengrundlage betragen.
Beschreibung der Figuren
Figur 1 offenbart ein HPLC-Chromatogramm des hochreinen Hemoparatide
In Figur 2 ist ein MALDI (Matrix assisted laser desorption/ionisation)-MS- Spektrum von hPTH-(l-37)-Endprodukt dargestellt.
Figur 3 offenbart ein Chromatogramm der Kapillarzonenelektrophorese (CZE) von hPTH-(l-37)-Endprodukt.
Die Figuren 4A und 4B offenbaren HPLC-Chromatogramme von hPTH-(l-37).
Figur 4A zeigt ein Chromatogramm von frisch hergestelltem hPTH-(l-37).
Figur 4B ist ein Chromatogramm von neun Monaten gelagertem hPTH-(l-37).
Es sind nur sehr geringe Mengen an methionin-oxidierten Metaboliten nachweisbar (siehe Satelliten-Peaks). Ferner offenbart Figur 5 den Vergleich zwischen den HPLC-Chromatogrammem von frisch hergestelltem hPTH-1-37
(A) und einem kommerziell erhältlichen Präparat. Die überraschend gute
Qualität lässt sich durch das Fehlen von Sateliten-Peaks in 5A gegenüber 5B ersehen.
Die Herstellung des Wirkstoffes und dessen Formulierung ist im Folgenden beschrieben :
Chemische Synthese von hPTH-1-37
Die erfindungsgemäßen Peptide werden durch chemische Synthese in Lösung oder am festen Träger hergestellt. Hierzu können verschiedene
Schutzgruppenkombinationen, z.B. die Fmoc- oder Boc-geschützte
Aminosäuren eingesetzt werden. Neben der schrittweisen
Festphasenpeptidsynthese nach dem klassischen Merrifield-Prinzip können die erfindungsgemäßen Peptide aus dem geschütztem Peptidfragment durch konvergente Synthese gewonnen werden.
hPTH-1-37 mit der Aminosäuresequenz
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL
wurde unter Verwendung Fmoc(fluorenylmethoxycarbonyl)-geschützter Aminosäuren durch schrittweise Festphasensynthese hergestellt. Die Synthese wurde auf einem mit Fmoc-Leucin beladenen Wang-Harz (0,69 mmol/g, 100 - 200 mesh) als festem Träger durchgeführt. Die Aktivierung der Fmoc- Aminosäuren, die in 10-fachem molaren Überschuss eingesetzt wurden, wurde mit [(2-(lH-Benzotriazol-l-yl)-l,l,3,3-tetramethyluronium-hexa-fluoro-phos- phat] (HBTU) unter Zusatz von 1-Hydroxybenzotriazol (HOBt) und Diisopropylethylamin (DIEA) in N-Methyl-2-pyrrolidinon (NMP) bei Raumtemperatur durchgeführt. Acylierungsreaktionen wurden typischerweise für 45 Minuten durchgeführt. Folgende Aminosäurederivate wurden zur Synthese eingesetzt: Fmoc-L-Ala, Fmoc-L-Arg(Pbf), Fmoc-L-Asn(Trt), Fmoc-L- Asp(OtBu), Fmoc-L-Glu(OtBu), Fmoc-L-Gln(Trt), Fmoc-Gly, Fmoc-L-His(Trt), Fmoc-L-Ile, Fmoc-L-Leu, Fmoc-L-Lys(Boc), Fmoc-L-Met, Fmoc-L-Phe, Fmoc-L-
Ser(tBu), Fmoc-L-Trp(Boc) und Fmoc-L-Val. Die temporären Fmoc- Schutzgruppen wurden mit 20% Piperidin in N-Methyl-2-pyrrolidinon innerhalb von 2-10 Minuten abgespalten. Nach Entfernung der Fmoc-Schutzgruppe wurde das Peptidylharz sorgfältig und mehrfach mit NMP und anschließend Dichlormethan gewaschen und getrocknet. Das trockene Harz wurde anschließend zur Abspaltung des Peptides in einer frisch hergestellten Mischung aus Trifluoressigsäure, Ethandithiol und Wasser (94 : 3 : 3, vol, 20 ml pro 1 g Peptidylharz) suspendiert und für drei Stunden geschüttelt. Die Mischung wurde filtriert, der Rückstand mit weiterer Abspaltmischung gewaschen und die vereinigten Filtrate werden unter Kühlung langsam zum 10-fachen Volumen kaltem tert-Butylmethylether gegeben. Das ausgefallene entschützte peptidische Material wurde über Nacht bei +4°C gelagert und anschließend durch Filtration oder Zentrifugation isoliert und im Vakuum getrocknet.
Das Rohpeptid wurde in 10% Essigsäure gelöst und chromatographisch gereinigt (Waters Prep-Pak C18, 47 x 300 mm; Eluens A: 0,7% Trifluoressigsäure (TFA) in Wasser; Eluens B: 0,7% TFA in Acetonitril / Wasser 4: 1 (vol); Gradient: 35 - 55% Eluens B in 40 Minuten; Detektion : UV bei 215 nm; Flussrate: 40 ml/min). Fraktionen, die das Produkt in ausreichender Reinheit enthalten (bestimmt durch analytische HPLC) wurden vereinigt und gefriergetrocknet. Zum Austausch des Trifluoracetatgegenions gegen Acetat wurde das trockene Produkt in 10% Essigsäure aufgenommen und in Gegenwart von Essigsäure/Acetat chromatographiert (Waters Prep-Pak C18, 47 x 300 mm, equilibriert mit 0,1 M Amoniumacetatlösung; Eluens A: 10% Essigsäure in Wasser; Eluens B: 2% Essigsäure in Acetonitril / Wasser 4 : 1 (vol); Gradient: 10-60% Eluens B in 40 Minuten; Detektion : UV bei 215 nm; Flussrate: 40ml/min). Fraktionen genügender Reinheit wurden vereinigt und gefriergetrocknet. Trockenes Endprodukt wurde anschließend durch RP-HPLC (Abbildung 1), MALDI-MS (Abbildung 2) und Kapillarzonenelektrophorese (Abbildung 3) analysiert, und es wurde überraschend ein hochreines Produkt gefunden, dessen Spezifikation sich von früheren Synthesen durch deutlich
bessere Qualität unterscheidet (siehe Abbildung 4A und 4B). Die überraschend gute Qualität ist auch in einer Tabelle (Tabelle 1) gegenüber kommerziell erhältlichem Produkt (Abbildung 5A gegenüber 5B) zu erkennen.
Typische Charakteristik für hPTH-1-37 und hochreines Hemoparatide Präparat
Tab. 1 : Die wesentlichen Spezifikationen, die für die Form des Peptides als hochreines Produkt herangezogen werden.
Die hohe Stabilität des Präparates von hochreinem Hemoparatide in lyophilisierter Form bei einer Temperatur von +4°C ist durch entsprechende Analytik belegt, wobei frisches Material (Abbildung 4A) mit neun Monaten
gelagertem Material (Abbildung 4B) verglichen ist. Es erscheinen nach dieser Lagerzeit nur geringe Methionin-oxidierte Metabolite.
Herstellung einer neuen Formulierungen von Hemoparatide
Für die galenische Anwendung eignen sich vorzugsweise Cremes auf Öl-inWasser-Basis, in deren wässrige Phase das wasserlösliche Hemoparatide eingearbeitet ist.
Eine solche Cremegrundlage stellt die hydrophile Salbe nach Deutschem Arzneibuch (Unguentum emulsificans aquosum DAB) dar.
Emulgierender Cetylstearylalkohol Typ A 21 g
Dünnflüssiges Wachs 10 g
Glycerol 85% 5 g
Kaliumsorbat 0,14 g
Wasserfreie Citronensäure 0,07 g
Benzalkoniumchlorid 100 mg
EDTA 100 mg
Gereinigtes Wasser ad 100 g
Tab. 2 : Alle eingesetzten Rohstoffe sind Pharma-konform.
Hemoparatide wurde in Konzentrationen von 0,03 Gew.-%, 0,1 Gew.-% und 0,3 Gew.-% in diese Grundlage eingebracht.
Es wurde überraschend festgestellt, dass der Wirkstoff bis auf methionin- oxidierte Metabolite in dieser Formulierung sehr stabil ist. Diese oxidierten Metaboliten kommen auch als natürliche PTH-Formen im Blutplasma vor, können aber durch Arbeiten in Stickstoffatmosphäre vermieden werden und sind als natürlich vorkommende körpereigene Derivate nebenwirkungsfrei.
Zur Benutzung der Creme-Formulierung wird diese wie üblich in galenischen Einheiten vorzugsweise zweimal täglich dünn auf die Haut aufgetragen.
Nachweis der mikrobiellen Stabilität im Konservierunqsbelastunqstest
Im Konservierungsbelastungstest wurde die mikrobielle Produktstabilität der erfindungsgemäßen Rezeptur nach Pharma-Richtlinien (Plattengussverfahren) nachgewiesen. Die Ergebnisse zeigen, dass alle Anforderungen, die für eine Hautmedikation notwendig sein werden, erfüllt werden.
Verträglichkeit und Sicherheit der Hemoparatide-Cremeformulierunq
Beim Menschen ist die gute Verträglichkeit des hochreinen Produktes bei subcutaner Injektion in wässriger Lösung durch eine Studie Phase I belegt. Erfindungsgemäß entwickelte Formulierungen für die topische Anwendung des hochreinen Wirkstoffes Hemoparatide können also in hohem Maß als sicher und verträglich gelten (siehe Figur 6).
Nachweis des Behandlungserfolges durch Anwendung von Hemoparatide-Creme bei Psoriasis:
Die hPTH-1-37 Creme wurde täglich zwei Mal dünn auf dem seitlichen Wadenareal rechts dorsal zu den Pfeilen aufgetragen :
1. Das behandelte Areal hat eine Fläche von ca. 4 mal 10 cm.
2. Es wurden jeweils morgens und abends ca. 250 mg Salbe gleichmäßig aufgetragen, indem die Salbe mit dem Zeigefinger verteilt wurde. 3. Die Salbe pro Applikation enthält insgesamt > 20 μg hPTH-1-37 also 40 μg pro Tag.
4. linkes Bild zeigt den rechten Unterschenkel vor Behandlung, rechtes Bild nach 14 Tagen der Behandlung.
Deutlich ist die Auflockerung der Effloreszenz und Rückgang der entzündlichen Reaktion nach 14 Tagen zu erkennen. Der Juckreiz lässt auch in den angrenzenden Arealen nach, und die Wirkung ist bei längerer Behandlung und Absetzen der Medikation nach über 4 Wochen nachhaltig.
Literatur
Hock D, Mägerlein M, Heine G, Ochlich PP, Forssmann WG (1997) Isolation and characterization of the bioactive circulating human parathyroid hormone, hPTH-1-37. FEBS Lett. 400: 221-225.
Whitfield JF (2004) Taming psoriatic keratinocytes - PTHs' uses go up another notch. JCB 93: 251-256.
Claims
1. Verwendung von hPTH-1-37 mit der Aminosäurensequenz SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID NO. 1) oder seiner natürlichen und pharmakologisch verträglichen Derivate, insbesondere amidierte, acylierte, phosphorylierte und glycosylierte Derivate zur Herstellung eines Arzneimittels zur Behandlung von entzündlich-schuppenden (erythemato-squamösen) Erkrankungen, insbesondere von Psoriasis, wobei hPTH-1-37 (SEQ ID NO. 1) in einer Menge von 300 μg bis mg pro Gramm Arzneimittel vorliegt.
2. Verwendung gemäß Anspruch 1, wobei hPTH-1-37 (SEQ ID NO. 1) in einer Menge von 0,6 bis 3 Gew.% im Arzneimittel vorliegt. 3. Verfahren zur Herstellung von hPTH-1-37 oder seiner Derivate, dadurch gekennzeichnet, dass diese über chemische Synthese aus den Teilsequenzen SVSEIQLMHNL (SEQ ID No. 2) und GKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID NO .
3) oder SVSEIQLM H N L(SEQ ID NO . 2), GKHLNSMERVEW (SEQ ID No. 4) und LRKKLQDVHNFVAL (SEQ ID NO. 5) hergestellt und chromatographisch gereinigt werden.
4. Salbe enthaltend 300 μg bis 30 mg pro Gramm Salbe hPTH-1-37 SEQ ID No. 1 oder seiner natürlichen und pharmakologisch verträglichen Derivate, insbesondere amidierte, acylierte, phosphorylierte und glycosylierte Derivate, insbesondere 6 mg bis 30 mg hPTH-1-37 pro Gramm Salbe.
5. Salbe nach Anspruch 4, wobei die Salbengrundlage ist:
Emulgierender Cetylstearylalkohol Typ A 15 - 25 g, insbesondere 21 g
Dünnflüssiges Wachs 5 - 15 g, insbesondere 10 g
Glycerol 85% 3 - 8 g, insbesondere 5 g
Kaliumsorbat 0,08 - 1,20 g, insbesondere 0,14 g
Wasserfreie Citronensäure 0,01 - 1,5 g, insbesondere 0,07 g
Benzalkoniumchlorid 50 - 200 mg, insbesondere 100 mg
EDTA 50 - 200 mg, insbesondere 100 mg
Gereinigtes Wasser ad 100 mg
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP09783807A EP2344182A1 (de) | 2008-10-07 | 2009-10-07 | HERSTELLUNG UND VERWENDUNG VON HOCHREINEM HEMOPARATIDE (hPTH-1-37) FÜR DIE BEHANDLUNG VON ENTZÜNDLICH-SCHUPPENDEN ERKRANKUNGEN DER HAUT |
US13/123,046 US20110263509A1 (en) | 2008-10-07 | 2009-10-07 | Preparation and use of high-purity hemoparatide (hpth-1-37) for the treatment of inflammatory scaling diseases of the skin |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP08166024.3 | 2008-10-07 | ||
EP08166024 | 2008-10-07 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2010040769A1 true WO2010040769A1 (de) | 2010-04-15 |
Family
ID=40802091
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2009/063017 WO2010040769A1 (de) | 2008-10-07 | 2009-10-07 | HERSTELLUNG UND VERWENDUNG VON HOCHREINEM HEMOPARATIDE (hPTH-1-37) FÜR DIE BEHANDLUNG VON ENTZÜNDLICH-SCHUPPENDEN ERKRANKUNGEN DER HAUT |
Country Status (3)
Country | Link |
---|---|
US (1) | US20110263509A1 (de) |
EP (1) | EP2344182A1 (de) |
WO (1) | WO2010040769A1 (de) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1989003873A1 (en) * | 1987-10-20 | 1989-05-05 | Holick Michael F | Regulation of cell proliferation and differentiation using peptides |
WO2003099849A2 (en) * | 2002-05-23 | 2003-12-04 | Michael Holick | Use of a parathyroid hormone peptide analogs for the treatment of vaginal atrophy |
WO2008150929A1 (en) * | 2007-05-29 | 2008-12-11 | Manhattan Pharmaceuticals, Inc. | Topical compositions comprising a macromolecule and methods of using same |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5512278A (en) * | 1994-01-11 | 1996-04-30 | Phylomed Corporation | Ointment base useful for pharmaceutical preparations |
DE19957918A1 (de) * | 1999-11-25 | 2001-06-13 | Ulrich Doht | Desinfektionsreiniger zur Reinigung und Pflege sowie Verfahren zu seiner Herstellung |
WO2001072262A2 (en) * | 2000-03-27 | 2001-10-04 | Schott Glas | New cosmetic, personal care, cleaning agent, and nutritional supplement compositions comprising bioactive glass and methods of making and using the same |
-
2009
- 2009-10-07 WO PCT/EP2009/063017 patent/WO2010040769A1/de active Application Filing
- 2009-10-07 EP EP09783807A patent/EP2344182A1/de not_active Withdrawn
- 2009-10-07 US US13/123,046 patent/US20110263509A1/en not_active Abandoned
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1989003873A1 (en) * | 1987-10-20 | 1989-05-05 | Holick Michael F | Regulation of cell proliferation and differentiation using peptides |
WO2003099849A2 (en) * | 2002-05-23 | 2003-12-04 | Michael Holick | Use of a parathyroid hormone peptide analogs for the treatment of vaginal atrophy |
WO2008150929A1 (en) * | 2007-05-29 | 2008-12-11 | Manhattan Pharmaceuticals, Inc. | Topical compositions comprising a macromolecule and methods of using same |
Non-Patent Citations (1)
Title |
---|
See also references of EP2344182A1 * |
Also Published As
Publication number | Publication date |
---|---|
EP2344182A1 (de) | 2011-07-20 |
US20110263509A1 (en) | 2011-10-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP0067425B1 (de) | Gegebenenfalls geschützte Peptide, Verfahren zu ihrer Herstellung und diese enthaltende Arzneimittel | |
DE69938174T2 (de) | Peptidzusammensetzungen und formulierungen unter verwendung derselben | |
EP0209061B1 (de) | Neue Polypeptide mit blutgerinnungshemmender Wirkung, Verfahren zu deren Herstellung bzw. Gewinnung, deren Verwendung und diese enthaltende Mittel | |
DE19735587B4 (de) | Peptid mit radioprotektiver Wirkung, dieses enthaltende kosmetische oder pharmazeutische Zusammensetzung, für dieses kodierende Nukleinsäure, Herstellungsverfahren für dieses Peptid und die Verwendung als radioprotektives Agens | |
EP0001295B1 (de) | Somatostatin-analoge Cyclopeptide, Verfahren zu ihrer Herstellung, pharmazeutische Präparate enthaltend diese Verbindungen, sowie ihre therapeutische Anwendung | |
DD232498A5 (de) | Verfahren zur herstellung von desulfatohirudinen | |
DE3100974A1 (de) | Thymosin(alpha)(pfeil abwaerts)1(pfeil abwaerts)-fragmente enthaltende arzneimittel mit immunregulierender wirkung, und thymosin(alpha)(pfeil abwaerts)1(pfeil abwaerts)-fragmente | |
DE3333640A1 (de) | Verfahren zur herstellung von insulin-derivaten, deren b-kette c-terminal verlaengert ist, neue basisch modifizierte insulin-derivate diese enthaltende mittel und ihre verwendung | |
DD151059A5 (de) | Neue peptide und verfahren zu ihrer herstellung | |
DE69723448T2 (de) | Hgh-rh(1-29)nh2 analoge mit antagonistischer aktivität | |
WO1991006564A1 (de) | hPTH-FRAGMENT-(1-37), SEINE HERSTELLUNG, DIESES ENTHALTENDE ARZNEIMITTEL UND SEINE VERWENDUNG | |
DE69932255T2 (de) | Hgh-rh(1-29)nh2 analoge mit antagonistischer aktivität gegen igf-i und -ii | |
DE4203040A1 (de) | Neue parathormonfragmente, deren herstellung und diese enthaltende arzneimittel | |
WO2005004899A2 (de) | Substanzen mit biologischer aktivität des vasoaktiven intestinalen peptids für die behandlung von interstitiellen lungenerkrankungen | |
DE3117948C2 (de) | Tripeptide und diese Verbindungen enthaltende Arzneimittel | |
EP0853944B1 (de) | Präparation umfassend Thiolgruppen-haltige Proteine | |
EP2523968A1 (de) | Zyklische peptide zur regulierung von vektoriellen ionenkanälen | |
DE60128399T2 (de) | Verwendung von thrombomodulinanaloga zur regenerierung von rückenmarkverletzungen | |
WO2010040769A1 (de) | HERSTELLUNG UND VERWENDUNG VON HOCHREINEM HEMOPARATIDE (hPTH-1-37) FÜR DIE BEHANDLUNG VON ENTZÜNDLICH-SCHUPPENDEN ERKRANKUNGEN DER HAUT | |
WO1992010515A1 (de) | Derivate des humanen parathormon-fragments (1-37) in der form des amids oder ethylamids als aktiven wirkstoff | |
DE69233315T2 (de) | Pharmazeutische lysin enthaltende polypeptid-zusammensetzungen und verfahren zu deren verwendung | |
DE2559299A1 (de) | Verbindung mit peptidkette zur regulierung der glykaemie, verfahren zu ihrer herstellung und sie enthaltende arzneimittel | |
DE2532823A1 (de) | Neue polypeptide | |
EP1267916B1 (de) | Arzneimittel enthaltend tissue inhibitor of metalloproteinases-2 (timp-2) als osteoanabol wirksame substanz | |
EP0003028A1 (de) | Beta h-Endorphin-Analoge, diese enthaltende Präparate und deren Herstellung |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09783807 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REEP | Request for entry into the european phase |
Ref document number: 2009783807 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009783807 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 13123046 Country of ref document: US |