WO2010037831A1 - Anti cxcr4 antibodies and their use for the treatment of cancer - Google Patents
Anti cxcr4 antibodies and their use for the treatment of cancer Download PDFInfo
- Publication number
- WO2010037831A1 WO2010037831A1 PCT/EP2009/062787 EP2009062787W WO2010037831A1 WO 2010037831 A1 WO2010037831 A1 WO 2010037831A1 EP 2009062787 W EP2009062787 W EP 2009062787W WO 2010037831 A1 WO2010037831 A1 WO 2010037831A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cdr
- sequence seq
- antibody
- cxcr4
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates to novel antibodies, in particular murine monoclonal antibodies, chimeric and humanized, able to bind specifically to chemokine receptors (CXCR) as well as the amino and nucleic acid sequences coding for such antibodies.
- CXCR chemokine receptors
- the invention relates to novel antibodies, derived compounds or functional fragments, able to bind specifically to the CXCR4 and having strong anti-tumor activities.
- the invention also comprises the use of such antibodies as a drug for the preventive and/or therapeutic treatment of cancer, as well as in the procedures or kits related to cancer diagnosis.
- the invention comprises compositions comprising such antibodies in combination or conjugation with other anticancer compounds, such as antibodies, toxins, cytotoxic/cytostatic, and the use of same for the prevention and/or treatment of certain cancers.
- Chemokines are small, secreted peptides that control the migration of leukocytes along a chemical gradient of ligand, known as chemokine gradient, especially during immune reactions (Zlotnick A. et al., 2000). They are divided into two major subfamilies, CC and CXC, based on the position of their NF ⁇ -terminal cysteine residues, and bind to G protein coupled receptors, whose two major sub families are designated CCR and CXCR. More than 50 human chemokines and 18 chemokine receptors have been discovered so far.
- CXCR4 Chemokine receptor 4
- Chemokine receptor 4 also known as fusin, CD 184, LESTR or HUMSTR
- Chemokine receptor 4 exists as two isoforms comprising 352 or 360 amino acids. Residue Asnl l is glycosylated, residue Tyr21 is modified by the addition of a sulfate group and Cys 109 and 186 are bond with a disulfide bridge on the extracellular part of the receptor (Juarez J. et al, 2004).
- This receptor is expressed by different kind of normal tissues, na ⁇ ve, non- memory T-cells, regulatory T cells, B-cells, neutrophils, endothelial cells, primary monocytes, dendritic cells, Natural Killer cells, CD34+ hematopoietic stem cells and at a low level in heart, colon, liver, kidneys and brain.
- CXCR4 plays a key role in leukocytes trafficking, B cell lymphopoiesis and myelopoiesis.
- CXCR4 receptor is over-expressed in a large number of cancers including but not limited to colon (Ottaiano A. et al., 2004), breast (Kato M. et al., 2003), prostate
- SDF-I Derived Factor-1
- CXCL12 CXCL12.
- SDF-I is secreted in large amount in lymph node, bone marrow, liver, lung and to a less extent by kidneys, brain and skin.
- CXCR4 is also recognized by an antagonistic chemokine, the viral macrophage inflammatory protein II (vMIP-II) encoded by human herpesvirus type III.
- CXCR4/SDF-1 axis plays a key role in cancer and is implicated directly in migration, invasion leading to metastases. Indeed, cancer cells express CXCR4 receptor, they migrate and enter the systemic circulation. Then cancer cells are arrested in vascular beds in organs that produce high levels of SDF-I where they proliferate, induce angiogenesis and form metastatic tumors (Murphy PM., 2001). This axis is also involved in cell proliferation via activation of Extracellular-signal-Regulated Kinase (ERK) pathway (Barbero S. et al., 2003) and angiogenesis (Romagnani P., 2004).
- ERK Extracellular-signal-Regulated Kinase
- CXCR4 receptor and its ligand SDF-I clearly promote angiogenesis by stimulating VEGF-A expression which in turns increases expression of CXCR4/SDF-1 (Bachelder R.E. et al., 2002). It is also known that tumor associated macrophages
- TAM hematopoietic stem/progenitor cells
- TSCs tissue-committed stem cells
- SDF-I may play a pivotal role in chemottracting CXCR4+ TCSCs necessary for organ/tissue regeneration but these TCSC may also be a cellular origin of cancer development (cancer stem cells theory).
- a stem cell origin of cancer was demonstrated for human leukemia and recently for several solid tumors such as brain and breast.
- CXCR4+ tumors that may derive from the normal CXCR4+ tissue/organ-specif ⁇ c stem cells such as leukemias, brain tumors, small cell lung cancer, breast cancer, hepatoblastoma, ovarian and cervical cancers (Kucia M. et al., 2005).
- CXCR4 is a validated therapeutic target for cancers.
- Chemokine receptor 2 (CXCR2), another chemokine receptor is also described as an interesting target in oncology. Indeed, CXCR2 transmits an autocrine cell growth signal in several tumor cell types and can also affect tumor growth indirectly by promoting angiogenesis (Tanaka T. et al. 2005). CXCR2 chemokine receptor encompasses 360 amino acids. It is expressed mainly in endothelial cells and specially during neovascularization. Several chemokines bind CXCR2 receptor: CXCL5, -6, -7, IL-8, GRO- ⁇ , - ⁇ and ⁇ which belong to ERL+ pro-angiogenic chemokines.
- the CXCR2 receptor share sequence homologies with CXCR4 receptor: 37% sequence identity and 48% sequence homology.
- the CXCR2/ligands axis is involved in several tumor growth mechanisms such as metastasis (Singh RK. et al., 1994) cell proliferation (Owen J.D. et al., 1997) and in ERL+ chemokines-mediated angiogenesis (Strieter R.M. et al., 2004; Romagnani et al., 2004).
- tumor-associated macrophages and neutrophils are key elements of inflammatory- induced tumor growth and chemokines such as CXCL5, IL-8 and GRO- ⁇ initiate neutrophils recruitment.
- chemokine receptors Dimerization has emerged as a common mechanism for regulating the function of G-protein-coupled receptors, among these are chemokine receptors (Wang J. and Norcross M., 2008). Homo- and heterodimerization in response to chemokine binding has been shown to be required for the initiation and the alteration of signaling by a number of chemokine receptors. Growing evidence supports the concept that receptor dimers or oligomers are probably the basic functional unit of chemokine receptors. Chemokine receptor dimers are found in the absence of ligands and chemokines induce conformational changes of receptor dimers.
- CXCR4 is known to form homodimers but also heterodimers, for examples with the ⁇ -opioid receptor (DOR) (Hereld D., 2008) or CCR2 (Percherancier Y. et al., 2005).
- DOR ⁇ -opioid receptor
- CCR2 Percherancier Y. et al., 2005.
- peptides derived from the transmembrane domains of CXCR4 inhibited activation by blocking the ligand- induced conformational transitions of the dimer (Percherancier Y. et al., 2005).
- CXCR4-TM4 peptide a synthetic peptide of the transmembrane region of CXCR4, decreases energy transfer between protomers of CXCR4 homodimers and inhibits SDF-I -induced migration and actin polymerization in malignant cells (Wang J. et al., 2006). More recently, it was also described that CXCR7 formed functional heterodimers with CXCR4 and enhanced SDF-1-induced signaling (Sierro F. et al., 2007). Other examples of constitutive heterodimers include studies showing CXCRl and CXCR2 interact as well as forming respective homodimers.
- CXCR4 and CXCR2 receptors are interesting tumor targets. Interfering with those receptors should inhibit tumor growth and metastases in a very efficient way, by decreasing tumor cell proliferation, angiogenesis, tumor cell migration and invasion, neutrophils and macrophages recruitment by tumors and by inhibiting CXCR4 cancer stem cells.
- One of the inventive aspects of the present invention is to generate a mouse monoclonal antibody inducing CXCR4 dimers conformational changes.
- the invention encompasses a CXCR4 Mab 414H5 (or fragments thereof) able to bind and to induce conformational changes of both CXCR4 homodimers and CXCR4/CXCR2 heterodimers, and having strong anti-tumor activities both in mice xenograft and survival models.
- the invention also encompasses a CXCR4 Mab 515H7 (or fragments thereof) able to bind and to induce conformational changes of both CXCR4 homodimers and CXCR4/CXCR2 heterodimers, and having strong anti-tumor activities.
- Anti-CXCR4 414H5 Mab inhibits tumor growth in MDA-MB-231 xenograft model and increases mice survival in U937 model. They induce conformational changes on CXCR4 homodimers but also on CXCR4/CXCR2 heterodimers. This new property should be of interest for cancer therapy application given the important roles of these two chemokine receptors in cancer.
- Mab (h7C10) targeting both IGF-IR and insulin/IGF- 1 hybrid receptors was more potent to inhibit tumor growth in vivo than a Mab targeting solely IGF-IR (Pandini G.,
- the anti-CXCR4 Mabs 414H5 and 515H7 are silent antagonists for CXCR4, they do not change basal signal in in vitro assays but inhibit signaling induced by SDF-I in different assays (GTP ⁇ S binding, cAMP release) and are also able to inhibit SDF-I induced tumor cells proliferation and migration in vitro.
- Molecules acting as either partial agonists or inverse agonists exhibit intrinsic activity in the absence of ligands. These types of molecules stabilize, respectively a high-affinity or a low-affinity GPCR state, even in the absence of ligand, thereby activating or inhibiting downstream signaling cascades (Galandin et al, 2007; Kenakin, 2004). In case of 414H5 and 515H7 Mabs, these molecules behaved as silent antagonists, without any intrinsic activity at CXCR4 receptor in the absence of SDF-I . This pharmacological feature is likely to be associated with less adverse side-effects as compared to partial or inverse agonists, as already observed for opioid receptor ligands (Bosier and Hermans, 2007).
- 414H5 and 515H7 Mabs are totally dependent on the presence of SDF-I and no modulation of CXCR4 receptor activity will be observed in tissues and organs where SDF-I ligand is not expressed, secreted or provided by the blood flow.
- 414H5 and 515H7 Mabs are likely to be less toxic as compared to other CXCR4 receptor ligands with positive or negative efficacy.
- silent antagonists are the minority species in the pharmacological space (Wurch et al., 1999, Kenakin, 2004).
- inventors have managed to generate antibodies capable of binding to CXCR4 but also capable of inducing conformational changes of the CXCR4 homodimers and/or heterodimers. More particularly, the antibodies of the invention are capable of inducing conformational changes of the CXCR4 homodimers but also of the CXCR4/CXCR2 heterodimers.
- CXCR4 dimers must be understood as encompassing the CXCR4 homodimers and also the CXCR4/CXCR2 heterodimers. It must be mentioned at this stage that such antibodies have never been described in the prior art. Moreover, it must be mentioned that the existence of CXCR4/CXCR2 heterodimers was never described.
- a part of the invention is the discovery of the existence of a heterodimer formed by CXCR4 and CXCR2. So, in a particular aspect, the present invention is directed to an isolated complex comprising or consisting of the CXCR4/CXCR2 heterodimer.
- CXCR4 compound part of said CXCR4/CXCR2 heterodimer complex is one of the two human CXCR4 iso forms selected from the group consisting of: - the chemokine (C-X-C motif) receptor 4 isoform b [Homo sapiens] having the sequence as depicted under the Genbank accession number NP 003458 SEQ ID No.
- chemokine (C-X-C motif) receptor 4 isoform a [Homo sapiens] having the sequence as depicted under the Genbank accession number NP OO 1008540 SEQ ID No. 30: MSIPLPLLQIYTSDNYTEEMGSGD YDSMKEPCFREENANFNKIFLPTIYSIIFLTGI VGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFG NFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVG VWIP ALLLTIPDFIF ANVSEADDRYICDRFYPNDL WVVVFQFQHIMVGLILPGIVI LSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGC EFENTVHKWISITEALAFFHCCLNPILY AFLGAKFKTSAQHALTSVSRGSSLKILS KG
- SDF-I stromal cell-derived factor-1
- CXCR2 compound part of said CXCR4/CXCR2 heterodimer complex is selected from the group consisting of:
- interleukin 8 receptor beta [Homo sapiens] having the sequence as depicted under the Genbank accession number NP 001548 SEQ ID No. 31 :
- the present invention also comprises an isolated RNA or
- This invention further comprises a nucleic construct, preferably an expression vector, such as a plasmid, encoding said CXCR4/CXCR2 heterodimer complex.
- the invention further comprises a composition comprising at least one nucleic construct, preferably an expression vector, such as a plasmid, encoding the part CXCR4 of said CXCR4/CXCR2 heterodimer complex, and a second construct, preferably an expression vector, such as a plasmid, encoding the part CXCR2 of said CXCR4/CXCR2 heterodimer complex.
- the invention further comprises a method for the preparation of a recombinant host cell which expresses said CXCR4/CXCR2 heterodimer complex, wherein this method comprises a step of transforming said host cell: a) with a nucleic construct, preferably an expression vector, such as a plasmid, encoding said CXCR4/CXCR2 heterodimer complex; or b) with at least one nucleic construct, preferably an expression vector, such as a plasmid, encoding the part CXCR4 of said CXCR4/CXCR2 heterodimer complex, and a second construct, preferably an expression vector, such as a plasmid, encoding the part CXCR2 of said CXCR4/CXCR2 heterodimer complex.
- said host cell is an eukaryotic cell, such as a mammalian cell.
- the nucleic construct(s) encoding said CXCR4/CXCR2 heterodimer complex encode also for a first marker which is associated (particularly by covalent coupling) with the CXCR4 sequence, such as the luc marker, and for a second marker which is associated (particularly by covalent coupling) with the CXCR2 sequence, such as the GFP marker (i.e. for BRET analysis).
- the invention also comprises a method for selecting a compound having an anticancer activity or which can be used for the preparation of a composition for the treatment of cancer, characterized in that said method comprises the step of: a) contacting a recombinant host cell of the present invention which expresses said CXCR4/CXCR2 heterodimer complex, with the compound to be tested; and b) determining whether this compound is capable of modulating, preferably inhibiting, the activity of this CXCR4/CXCR2 heterodimer complex in the recombinant host cell.
- a subject of the present invention is a process for the generation and the selection of antibodies according to the invention.
- the invention concerns a process for the selection of an anti CXCR4 antibody, or one of its functional fragments or derivatives, capable to inhibit both ligand-dependent and ligand-independent activation of CXCR4, said process comprising the following steps: i) screening the generated antibodies and selecting antibodies capable to bind specifically to CXCR4 and also to modulate CXCR4 activation; ii) testing the selected antibodies of step i) and selecting antibodies capable to induce CXCR4 homodimers conformational change, and then iii) testing the selected antibodies of step ii) and selecting antibodies capable to induce CXCR4/CXCR2 heterodimers conformational change.
- the selected antibodies of the invention must inhibit the CXCR4 activation.
- the generation of the antibody can be realized by any method known by the man skilled in the art, such as for example, fusion of a myeloma cell with spleen cells from immunized mice or other species compatible with the selected myeloma cells [Kohler & Milstein, 1975, Nature, 256:495-497].
- the immunized animals could include transgenic mice with human immunoglobulin loci which then directly produce human antibodies.
- Another possible embodiment could consist in using phage display technologies to screen libraries.
- the screening step i) can be realized by any method or process known by the man skilled in the art.
- ELISA BIAcore
- immunohistochemistry FACS analysis and functional screens.
- a preferred process consists in a screen by FACS analysis on CXCR4 transfectant and on at least a tumoral cell line to be sure that the produced antibodies will be able to also recognize the native receptor on tumor cells. This process will be described more precisely in the following examples.
- to modulate CXCR4 activation it is intended to modulate at leas one of the activity depicted in the examples 4, 5, 7 and 13 below:
- this modulation of at least one of these activities is an inhibition of the activity.
- said steps ii) and iii) of selection of the process of the invention consist in evaluating antibodies by BRET analysis on cells expressing CXCR4-RLuc/CXCR4-YFP and CXCR4-Rluc/CXCR2-YFP, respectively, and selecting antibodies capable to inhibit at least 40 %, preferably 45 %, 50 %, 55 % and most preferably 60 % of the BRET signal.
- the technology BRET is a technology known as being representative of the protein dimerization [Angers et al, PNAS, 2000, 97:3684-89].
- the technology BRET, used in the steps ii) and iii) of the process, is well known by the man skilled in the art and will be detailed in the following examples. More particularly, BRET (Bio luminescence Resonance Energy Transfer) is a non-radiative energy transfer occurring between a bio luminescent donor (Renilla Luciferase (Rluc)) and a fluorescent acceptor, a mutant of GFP (Green Fluorescent Protein) or YFP (Yellow fluorescent protein). In the present case EYFP (Enhanced Yellow Fluorescent Protein) was used.
- the efficacy of transfer depends on the orientation and the distance between the donor and the acceptor. Then, the energy transfer can occur only if the two molecules are in close proximity (1-10 nm). This property is used to generate protein- protein interaction assays. Indeed, in order to study the interaction between two partners, the first one is genetically fused to the Renilla Luciferase and the second one to the yellow mutant of the GFP. Fusion proteins are generally, but not obligatory, expressed in mammalian cells. In presence of its membrane permeable substrate (coelenterazine), Rluc emits blue light. If the GFP mutant is closer than 10 nm from the Rluc, an energy transfer can occur and an additional yellow signal can be detected.
- the BRET signal is measured as the ratio between the light emitted by the acceptor and the light emitted by the donor. So the BRET signal will increase as the two fusion proteins are brought into proximity or if a conformational change brings Rluc and GFP mutant closer.
- any method known by the man skilled in the art can be used to measure CXCR4 dimers conformational changes. Without limitation, the following technologies can be mentioned: FRET (Fluorescence Resonance Energy Transfer), HTRF (Homogenous Time resolved Fluorescence), FLIM (Fluorescence Lifetime Imaging Microscopy) or SW-FCCS single wavelength fluorescence cross-correlation spectroscopy).
- step ii) consists in evaluating antibodies by BRET analysis on cells expressing both CXCR4-
- step iii) consists in evaluating antibodies by BRET analysis on cells expressing both CXCR4- RLuc/CXCR2-YFP and selecting antibodies capable to inhibit at least 40 %, of the BRET signal.
- a subject of the invention is an isolated antibody, or one of its functional fragments or derivatives, being obtained by said process.
- Said antibody or one of its said fragments or derivatives is capable of binding specifically to the human CXCR4 and, if necessary, preferably moreover capable of inhibiting the natural attachment of its ligand, said antibody being also capable to induce CXCR4 dimers conformational changes.
- the invention does not relate to the antibodies in natural form, that is to say they are not in their natural environment but that they have been able to be isolated or obtained by purification from natural sources, or else obtained by genetic recombination, or by chemical synthesis, and that they can then contain unnatural amino acids as will be described further on.
- an antibody or one of its functional fragments or derivatives, said antibody being characterized in that it comprises at least one complementary determining region CDR chosen from CDRs comprising the amino acid sequence SEQ ID Nos. 1 to 12.
- an antibody or one of its functional fragments or derivatives, said antibody being characterized in that it comprises at least one complementary determining region CDR chosen from CDRs comprising the amino acid sequence SEQ ID Nos. 2, 5 or 40 to 49.
- the invention relates to an isolated antibody, or a derived compound or functional fragment of same, comprising at least one CDR chosen among the CDRs of sequences SEQ ID Nos. 1, 2, 3, 4, 5 or 6 or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID No. 1, 2, 3, 4, 5 or 6.
- the invention relates to an isolated antibody, or a derived compound or functional fragment of same, comprising at least one CDR chosen among the CDRs of sequences SEQ ID Nos. 40, 2, 41, 42, 5 or 43 or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 40, 2, 41, 42, 5 or 43.
- a “derived compound” or “derivative” of an antibody means in particular a binding protein composed of a peptide scaffold and at least one of the CDRs of the original antibody in order to preserve its ability to recognize CXCR4.
- Such derived compounds well-known to a person skilled in the art, will be described in more detail later in the present description.
- the invention comprises the antibodies, their derived compounds or their functional fragments, according to the present invention, notably chimeric or humanized, obtained by genetic recombination or chemical synthesis.
- the antibody according to the invention is characterized in that it consists of a monoclonal antibody.
- a monoclonal antibody is understood to mean an antibody arising from a nearly homogeneous antibody population. More particularly, the individual antibodies of a population are identical except for a few possible naturally-occurring mutations which can be found in minimal proportions.
- a monoclonal antibody consists of a homogeneous antibody arising from the growth of a single cell clone (for example a hybridoma, a eukaryotic host cell trans fected with a DNA molecule coding for the homogeneous antibody, a prokaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody, etc.) and is generally characterized by heavy chains of one and only one class and subclass, and light chains of only one type.
- Monoclonal antibodies are highly specific and are directed against a single antigen.
- each monoclonal antibody is directed against a single epitope of the antigen. It must be understood here that the invention does not relate to antibodies in natural form, i.e., they are not taken from their natural environment but are isolated or obtained by purification from natural sources or obtained by genetic recombination or chemical synthesis and thus they can carry unnatural amino acids as will be described below.
- the antibody, or its derived compounds or functional fragments is characterized in that it comprises a light chain comprising at least one CDR chosen among the CDRs of amino acid sequences SEQ ID No. 1, 2 or 3, or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID No. 1, 2 or 3; or it comprises a heavy chain comprising at least one CDR chosen among the CDRs of amino acid sequences SEQ ID Nos. 4, 5 or 6, or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 4, 5 or 6.
- the antibodies of the invention, or one of their derived compounds or functional fragments are characterized in that they comprise a light chain comprising at least one of the three CDRs of the sequences SEQ ID No. 1, 2 or 3, or at least one sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 1, 2 or 3.
- the antibodies of the invention, or one of their derived compounds or functional fragments are characterized in that they comprise a light chain comprising the following three CDRs, respectively CDR-Ll, CDR-L2 and CDR-L3, wherein:
- - CDR-Ll comprises the sequence SEQ ID No. 1 or 9, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 1 or 9;
- - CDR-L2 comprises the sequences SEQ ID No. 2 or 10, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 2 or 10;
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a light chain comprising the CDR-Ll of the sequence SEQ ID No. 1, the CDR-L2 of the sequence SEQ ID No. 2 and the CDR-L3 of the sequence SEQ ID No. 3.
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a light chain comprising the CDR-Ll of the sequence SEQ ID No. 9, the CDR-L2 of the sequence SEQ ID No. 10 and the CDR-L3 of the sequence SEQ ID No. 3.
- the antibodies of the invention are characterized in that they comprise a heavy chain comprising at least one of the three CDRs of the sequences SEQ ID Nos. 4, 5 or 6, or at least one sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 4, 5 or 6.
- the antibodies of the invention are characterized in that they comprise a heavy chain comprising the following three CDRs, respectively CDR-Hl, CDR-H2 and CDR- H3, wherein:
- - CDR-Hl comprises the sequence SEQ ID Nos. 4, 7 or 11, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID Nos. 4, 7 or 11;
- - CDR-H2 comprises the sequences SEQ ID Nos. 5 or 12, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 5 or 12; and - CDR-H3 comprises the sequences SEQ ID No. 6 or 8, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 6 or 8.
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a heavy chain comprising the CDR-Hl of the sequence SEQ ID No. 7, the CDR-H2 of the sequence SEQ ID No. 5 and the CDR-H3 of the sequence SEQ ID No. 8.
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a heavy chain comprising the CDR-Hl of the sequence SEQ ID No. 11, the CDR-H2 of the sequence SEQ ID No. 12 and the CDR-H3 of the sequence SEQ ID No. 6. More particularly, according to a preferred embodiment of the invention, the antibody, or its derived compounds or functional fragments, is characterized in that it comprises a light chain comprising at least one CDR chosen among the CDRs of amino acid sequences SEQ ID Nos. 40, 2 or 41 or at least one CDR whose sequence has at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID No.
- the antibodies of the invention are characterized in that they comprise a light chain comprising at least one of the three CDRs of the sequences SEQ ID Nos. 40, 2 or 41, or at least one sequence with at least 80%, preferably 85%, 90%,
- the antibodies of the invention are characterized in that they comprise a light chain comprising the following three CDRs, respectively CDR-Ll, CDR-L2 and CDR-L3, wherein:
- - CDR-Ll comprises the sequence SEQ ID No. 40 or 46, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 40 or 46;
- - CDR-L2 comprises the sequences SEQ ID No. 2 or 47, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 2 or 47; and - CDR-L3 comprises the sequence SEQ ID No. 41, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No 41.
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a light chain comprising the CDR-Ll of the sequence SEQ ID No. 40, the CDR-L2 of the sequence SEQ ID No. 2 and the CDR-L3 of the sequence SEQ ID No. 41.
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a light chain comprising the CDR-Ll of the sequence SEQ ID No. 46, the CDR-L2 of the sequence SEQ ID No. 47 and the CDR-L3 of the sequence SEQ ID No. 41. More particularly, the antibodies of the invention, or one of their derived compounds or functional fragments, are characterized in that they comprise a heavy chain comprising at least one of the three CDRs of the sequences SEQ ID Nos. 42, 5 or 43, or at least one sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 42, 5 or 43.
- the antibodies of the invention are characterized in that they comprise a heavy chain comprising the following three CDRs, respectively CDR-Hl, CDR-H2 and CDR- H3, wherein:
- - CDR-Hl comprises the sequence SEQ ID Nos. 42, 44 or 48, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID Nos. 42, 44 or 48;
- - CDR-H2 comprises the sequences SEQ ID No. 5 or 49, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 5 or 49;
- - CDR-H3 comprises the sequences SEQ ID No. 45 or 43, or a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 45 or 43.
- antibodies, or one of their derived compounds or functional fragments are characterized in that they comprise a heavy chain comprising the CDR-Hl of the sequence SEQ ID No. 44, the CDR-H2 of the sequence SEQ ID No. 5 and the CDR-H3 of the sequence SEQ ID No. 45.
- antibodies or one of their derived compounds or functional fragments, are characterized in that they comprise a heavy chain comprising the CDR-Hl of the sequence SEQ ID No. 48, the CDR-H2 of the sequence SEQ ID No. 49 and the CDR-H3 of the sequence SEQ ID No. 43.
- polypeptides In the present description, the terms “polypeptides”, “polypeptide sequences”, “peptides” and “proteins attached to antibody compounds or to their sequences” are interchangeable.
- the invention does not relate to antibodies in natural form, i.e., they are not taken from their natural environment but are isolated or obtained by purification from natural sources or obtained by genetic recombination or chemical synthesis and thus they can carry unnatural amino acids as will be described below.
- complementarity-determining region means the hypervariable regions of the heavy and light chains of immunoglobulins as defined by
- CDR Kabat et al. (Kabat et al., Sequences of proteins of immunological interest, 5 th Ed., U.S. Department of Health and Human Services, NIH, 1991, and later editions).
- CDR CDR
- CDRs CDRs
- the terms "CDR” and "CDRs” are used to indicate, depending on the case, one or more, or even all, of the regions containing the majority of the amino acid residues responsible for the antibody's binding affinity for the antigen or epitope it recognizes.
- CDR regions or CDR(s) it is intended to indicate the hypervariable regions of the heavy and light chains of the immunoglobulins as defined by IMGT.
- the IMGT unique numbering has been defined to compare the variable domains whatever the antigen receptor, the chain type, or the species [Lefranc M. -P., Immunology Today 18, 509 (1997) / Lefranc M.-P., The Immunologist, 7, 132-136 (1999) / Lefranc, M.-P., Pommie, C, Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc, Dev. Comp. Immunol, 27, 55-77 (2003)].
- cystein 23 (lst-CYS), tryptophan 41 (CONSERVED-TRP), hydrophobic amino acid 89, cystein 104 (2nd-CYS), phenylalanine or tryptophan 118 (J-PHE or J- TRP).
- the IMGT unique numbering provides a standardized delimitation of the framework regions (FRl-IMGT: positions 1 to 26, FR2-IMGT: 39 to 55, FR3-IMGT: 66 to 104 and FR4-IMGT: 118 to 128) and of the complementarity determining regions: CDRl-IMGT: 27 to 38, CDR2-IMGT: 56 to 65 and CDR3-IMGT: 105 to 117. As gaps represent unoccupied positions, the CDR-IMGT lengths (shown between brackets and separated by dots, e.g. [8.8.13]) become crucial information.
- the IMGT unique numbering is used in 2D graphical representations, designated as IMGT Colliers de Perles [Ruiz, M.
- CDR or CDRs Three heavy chain CDRs and 3 light chain CDRs exist.
- the term CDR or CDRs is used here in order to indicate, according to the case, one of these regions or several, or even the whole, of these regions which contain the majority of the amino acid residues responsible for the binding by affinity of the antibody for the antigen or the epitope which it recognizes.
- the CDRs will be defined by IMGT numbering, Kabat numbering and by common numbering.
- Common numbering regroups the residues part of each CDR which are common to the CDRs as defined by the IMGT and the Kabat numbering systems.
- IMGT numbering system defines the CDRs according to the IMGT system as above defined whereas Kabat numbering system defines the CDRs according to the Kabat system as above defined.
- CDR-Ll consists of SEQ ID No. 1 (QSLYNSRTRKNY) in the common and IMGT numbering systems and of SEQ ID No. 9 (KSSQSLYNSRTRKNYLA) in the Kabat numbering system.
- the CDR-L2 consists of SEQ ID No. 2 (WAS) in the common and IMGT numbering systems and of SEQ ID No. 10 (WASTRES) in the Kabat numbering system.
- the CDR-L3 consists of SEQ ID No. 3 (KQSYNLRT) for each of the three numbering systems.
- the CDR-Hl consists of the SEQ ID No. 4 (TDYY) in the common numbering system, of SEQ ID No. 7 (GFTFTDYY) in the IMGT numbering system and of SEQ ID No. 11 (TDYYMS) in the kabat numbering system.
- the CDR-H2 consists of SEQ ID No. 5 (IRNKANGYTT) in the common and
- IMGT numbering systems and of SEQ ID No. 12 (FIRNKANGYTTEYSASVKG) in the kabat numbering system.
- the CDR-H3 consists in the SEQ ID No. 6 (DIPGFAY) in the common and kabat numbering systems whereas it consists of SEQ ID No. 8 (ARDIPGFAY) in the IMGT numbering system.
- DIPGFAY SEQ ID No. 6
- ARDIPGFAY SEQ ID No. 8
- CDR-Ll consists of SEQ ID No. 40 (QSLFNSRTRKNY) in the common and IMGT numbering systems and of SEQ ID No. 46 (KSSQSLFNSRTRKNYLA) in the Kabat numbering system.
- the CDR-L2 consists of SEQ ID No. 2 (WAS) in the common and IMGT numbering systems and of SEQ ID No. 47 (WASARDS) in the Kabat numbering system.
- the CDR-L3 consists of SEQ ID No. 41 (MQSFNLRT) for each of the three numbering systems.
- the CDR-Hl consists of the SEQ ID No. 42 (DNY) in the common numbering system, of SEQ ID No. 44 (GFTFTDNY) in the IMGT numbering system and of SEQ ID No. 48 (DNYMS) in the kabat numbering system.
- the CDR-H2 consists of SEQ ID No. 5 (IRNKANGYTT) in the common and IMGT numbering systems and of SEQ ID No. 49 (FIRNKANGYTTDYSASVRG) in the kabat numbering system.
- the CDR-H3 consists in the SEQ ID No. 43 (DVGSNYFDY) in the common and kabat numbering systems whereas it consists of SEQ ID No. 45 (ARDVGSNYFDY) in the IMGT numbering system.
- the "percentage identity" between two sequences of nucleic acids or amino acids means the percentage of identical nucleotides or amino acid residues between the two sequences to be compared, obtained after optimal alignment, this percentage being purely statistical and the differences between the two sequences being distributed randomly along their length.
- the comparison of two nucleic acid or amino acid sequences is traditionally carried out by comparing the sequences after having optimally aligned them, said comparison being able to be conducted by segment or by using an "alignment window”.
- Optimal alignment of the sequences for comparison can be carried out, in addition to comparison by hand, by means of the local homology algorithm of Smith and Waterman (1981) [Ad. App. Math.
- the percentage identity between two nucleic acid or amino acid sequences is determined by comparing the two optimally-aligned sequences in which the nucleic acid or amino acid sequence to compare can have additions or deletions compared to the reference sequence for optimal alignment between the two sequences. Percentage identity is calculated by determining the number of positions at which the amino acid nucleotide or residue is identical between the two sequences, preferably between the two complete sequences, dividing the number of identical positions by the total number of positions in the alignment window and multiplying the result by 100 to obtain the percentage identity between the two sequences.
- the BLAST program "BLAST 2 sequences" (Tatusova et al,
- amino acid sequence exhibiting at least 80%, preferably 85%, 90%, 95% and 98% identity with a reference amino acid sequence
- preferred examples include those containing the reference sequence, certain modifications, notably a deletion, addition or substitution of at least one amino acid, truncation or extension.
- substitutions are preferred in which the substituted amino acids are replaced by "equivalent” amino acids.
- the expression “equivalent amino acids” is meant to indicate any amino acids likely to be substituted for one of the structural amino acids without however modifying the biological activities of the corresponding antibodies and of those specific examples defined below.
- Equivalent amino acids can be determined either on their structural homology with the amino acids for which they are substituted or on the results of comparative tests of biological activity between the various antibodies likely to be generated.
- table 1 summarizes the possible substitutions likely to be carried out without resulting in a significant modification of the biological activity of the corresponding modified antibody; inverse substitutions are naturally possible under the same conditions.
- the preferred characteristic CDRs of the antibodies of the invention, or of one of their derived compounds or functional fragments will be the three CDRs of the heavy chain, i.e., for the 414H5 the CDRs coded by sequences SEQ ID Nos. 7, 5, 8 and 11, 12, 6, respectively defined according to IMGT and Kabat and, for the 515H7, the CDRs coded by sequences SEQ ID Nos.
- the present invention relates to a murine antibody, or derived compounds or functional fragments of same.
- Another embodiment of the invention discloses an antibody, or its derived compounds or functional fragments, comprising a light chain comprising the following three CDRs:
- sequence SEQ ID No. 4 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 4; CDR-H2 of the sequence SEQ ID No. 5 or of a sequence with at least 80%, preferably
- Still another embodiment of the invention discloses an antibody, or a derived compound or functional fragment of same, comprising a light chain comprising the following three CDRs:
- Still another embodiment of the invention discloses an antibody, or a derived compound or functional fragment of same, comprising a light chain comprising the following three CDRs:
- An antibody, or a derived compound or functional fragment of same, according to the invention is characterized in that it comprises:
- an antibody, or a derived compound or functional fragment of same is characterized in that it comprises: - a light chain comprising the CDR-Ll of the sequence SEQ ID No. 9, the CDR-L2 of the sequence SEQ ID No. 10 and the CDR-L3 of the sequence SEQ ID No. 3; and
- the antibody of the invention is characterized in that it comprises a light- chain sequence comprising the amino acid sequence SEQ ID No. 13 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 13; and in that it comprises a heavy-chain sequence comprising the amino acid sequence SEQ ID No. 14 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 14.
- Another embodiment of the invention discloses an antibody, or its derived compounds or functional fragments, comprising a light chain comprising the following three CDRs:
- Still another embodiment of the invention discloses an antibody, or a derived compound or functional fragment of same, comprising a light chain comprising the following three CDRs: - CDR-Ll of the sequence SEQ ID No. 40 or of a sequence with at least 80% identity after optimal alignment with sequence SEQ ID No. 40;
- Still another embodiment of the invention discloses an antibody, or a derived compound or functional fragment of same, comprising a light chain comprising the fo Ho wing three CDRs :
- An antibody, or a derived compound or functional fragment of same, according to the invention is characterized in that it comprises:
- an antibody, or a derived compound or functional fragment of same, according to the invention is characterized in that it comprises:
- the antibody of the invention is characterized in that it comprises a light- chain sequence comprising the amino acid sequence SEQ ID No. 50 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 50; and in that it comprises a heavy-chain sequence comprising the amino acid sequence SEQ ID No. 51 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 51.
- the invention also relates to any compound derived from an antibody as described in the invention. More particularly, the antibody of the invention, or its derived compounds or functional fragments, is characterized in that said derived compound consists of a binding protein comprising a peptide scaffold on which is grafted at least one CDR in such a way as to preserve all or part of the paratope recognition properties of the initial antibody.
- One or more sequences among the six CDR sequences described in the present invention can also be present on the various immunoglobulin protein scaffolding.
- the protein sequence makes it possible to recreate a peptide skeleton favorable to the folding of the grafted CDRs, enabling them to preserve their paratope antigen- recognition properties.
- a person skilled in the art knows how to determine the type of protein scaffold on which to graft at least one of the CDRs arising from the original antibody. More particularly, it is known that to be selected such scaffolds must meet the greatest number of criteria as follows (Skerra A., J. MoI. Recogn., 2000, 13:167-187): - good phylogenetic conservation; known three-dimensional structure (as, for example, by crystallography, NMR spectroscopy or any other technique known to a person skilled in the art); small size; - few or no post-transcriptional modifications; and/or easy to produce, express and purify.
- the origin of such protein scaffolds can be, but is not limited to, the structures selected among: fibronectin and preferentially fibronectin type III domain 10, lipocalin, anticalin (Skerra A., J. BiotechnoL, 2001, 74(4):257-75), protein Z arising from domain B of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the "ankyrin repeat” (Kohl et ah, PNAS, 2003, vol. 100, No. 4, 1700- 1705), the "armadillo repeat", the "leucine-rich repeat” and the "tetratricopeptide repeat”.
- fibronectin and preferentially fibronectin type III domain 10 lipocalin
- anticalin Skerra A., J. BiotechnoL, 2001, 74(4):257-75
- protein Z arising from domain B of protein A of Staphylococcus aureus
- Scaffolds derived from toxins such as, for example, toxins from scorpions, insects, plants, mo Husks, etc., and the protein inhibiters of neuronal NO synthase (PIN) should also be mentioned.
- An example, in no way limiting, of such hybrid constructions, is the insertion of the CDR-Hl (heavy chain) of an antiCD4 antibody, namely 13B8.2, in one of the loops in the PIN, the new binding protein thus obtained preserving the same binding properties as the original antibody (Bes et al., Biochem. Biophys. Res. Commun., 2006, 343(1), 334-344).
- such peptide scaffolds can comprise from one to six CDRs arising from the original antibody.
- a person skilled in the art will select at least one CDR from the heavy chain, the latter being known to be primarily responsible for the specificity of the antibody.
- the selection of one or more relevant CDRs is obvious to a person skilled in the art, who will then choose suitable known techniques (Bes et al, FEBS letters 508, 2001, 67-74).
- a specific aspect of the present invention relates to a method for selecting a compound derived from an antibody according to the invention, said derived compound being capable of inhibiting in vitro and/or in vivo the growth of tumor cells and said derived compound comprising a peptide scaffold on which is grafted at least one antibody CDR, characterized in that it comprises the following steps: a) the placing in contact in vitro of a compound composed of a peptide scaffold on which is grafted at least one antibody CDR with a biological sample containing tumor cells able to grow and under conditions allowing these cells to grow; and b) selection of said compound if said compound is capable of inhibiting the growth of these tumor cells, and characterized in that said at least one grafted CDR is selected among the following CDRs: the CDR of sequence SEQ ID No.
- sequence SEQ ID No. 4, 7, 11, 42, 44, 48 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequence SEQ ID No. 4, 7, 11, 42, 44, 48;
- the method can include in step a) the placing in contact in vitro of a compound comprising a peptide scaffold on which is grafted at least two or three antibody CDRs.
- the peptide scaffold is selected among the scaffolds or binding proteins whose structures were mentioned above.
- the present invention thus relates to an antibody, or its derived compounds or functional fragments, characterized in that the peptide scaffold is selected among proteins that are a) phylogenetically well preserved, b) of robust architecture, c) with a well-known 3-D molecular organization, d) of small size and/or e) comprising regions that can be modified by deletion and/or insertion without modifying stability properties.
- the antibody of the invention is characterized in that said peptide scaffold is selected among i) scaffolds arising from f ⁇ bronectin, preferentially f ⁇ bronectin type 3 domain 10, lipocalin, anticalin, protein Z arising from domain B of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the "ankyrin repeat” (Kohl et al, PNAS, 2003, vol. 100, No. 4, 1700-1705), the "armadillo repeat", the "leucine-rich repeat” and the "tetratricopeptide repeat” or iii) protein inhibiters of neuronal NO synthase (PIN).
- f ⁇ bronectin preferentially f ⁇ bronectin type 3 domain 10
- lipocalin arising from domain B of protein A of Staphylococcus aureus
- thioredoxin A or proteins with a repeated motif such as the "ankyrin repeat” (Kohl
- Another aspect of the invention relates to the functional fragments of the antibody described above. More particularly, the invention targets an antibody, or its derived compounds or functional fragments, characterized in that said functional fragment is selected among the fragments Fv, Fab, (Fab')2, Fab', scFv, scFv-Fc and diabodies, or any fragment whose half-life has been increased such as PEGylated fragments.
- PEGylation PEGylated fragments are referred to as Fv-PEG, scFv-PEG, Fab-PEG,
- said functional fragments will comprise or include a partial sequence of the variable heavy or light chain of the antibody from which they are derived, said partial sequence being sufficient to retain the same binding specificity as the antibody from which it arises and sufficient affinity, preferably at least equal to 1/100, more preferably at least 1/10 of that of the antibody from which it arises.
- Such a functional fragment will contain at least five amino acids, preferably 6, 7, 8, 10, 15, 25, 50 or 100 consecutive amino acids of the sequence of the antibody from which it arises.
- these functional fragments will be of the types Fv, scFv, Fab, F(ab') 2 , F(ab'), scFv-Fc or diabodies, which generally have the same binding specificity as the antibody from which they result.
- fragments of the antibody of the invention can be obtained from the antibodies described above by methods such as enzyme digestion, including pepsin or papain, and/or by cleavage of the disulfide bridges by chemical reduction.
- the antibody fragments can be also obtained by recombinant genetics techniques also known to a person skilled in the art or by peptide synthesis by means, for example, of automatic peptide synthesizers such as those sold by Applied BioSystems, etc.
- table 2 summarizes the various amino acid sequences corresponding to the antibody of the invention.
- Another specific aspect of the present invention relates to a chimeric antibody, or its derived compounds or functional fragments, characterized in that said antibody also comprises light-chain and heavy-chain constant regions derived from an antibody of a species heterologous with the mouse, notably man.
- Yet another specific aspect of the present invention relates to a humanized antibody, or its derived compounds or functional fragments, characterized in that the constant regions of the light-chain and the heavy-chain derived from human antibody are, respectively, the lambda or kappa region and the gamma- 1, gamma-2 or gamma-4 region.
- the invention relates to a murine hybridoma capable of secreting a monoclonal antibody according to the invention, notably the hybridoma of murine origin filed with the French collection for microorganism cultures (CNCM, Pasteur Institute, Paris, France) on October 22, 2007, under number 1-3860.
- Said hybridoma was obtained by the fusion of Balb/C immunized mice splenocytes and cells of the myeloma Sp 2/0- Ag 14 lines.
- the monoclonal antibody here referred to as 414H5, or its derived compounds or functional fragments, characterized in that said antibody is secreted by the hybridoma filed with the CNCM on October 22, 2007, under number 1-3860 obviously forms part of the present invention.
- the invention relates to a murine hybridoma capable of secreting a monoclonal antibody according to the invention, notably the hybridoma of murine origin filed with the French collection for microorganism cultures (CNCM, Pasteur Institute, Paris, France) on June 25, 2008, under number 1-4019.
- Said hybridoma was obtained by the fusion of Balb/C immunized mice splenocytes and cells of the myeloma Sp 2/O-Ag 14 lines.
- the monoclonal antibody here referred to as 515H7, or its derived compounds or functional fragments, characterized in that said antibody is secreted by the hybridoma filed with the CNCM on June 25, 2008, under number 1-4019 obviously forms part of the present invention.
- the antibody of the invention also comprises chimeric or humanized antibodies.
- a chimeric antibody is one containing a natural variable region (light chain and heavy chain) derived from an antibody of a given species in combination with constant regions of the light chain and the heavy chain of an antibody of a species heterologous to said given species.
- the antibodies, or chimeric fragments of same can be prepared by using the techniques of recombinant genetics.
- the chimeric antibody could be produced by cloning recombinant DNA containing a promoter and a sequence coding for the variable region of a nonhuman monoclonal antibody of the invention, notably murine, and a sequence coding for the human antibody constant region.
- a chimeric antibody according to the invention coded by one such recombinant gene could be, for example, a mouse-human chimera, the specificity of this antibody being determined by the variable region derived from the murine DNA and its isotype determined by the constant region derived from human DNA. Refer to Verhoeyn et al. (BioEssays, 8:74,
- the invention describes an antibody, or a derived compound or functional fragment of same, which consists in a chimeric antibody.
- the chimeric antibody, or a derived compound or functional fragment of same, of the invention comprises a light chain sequence comprising the amino acid sequence SEQ ID No. 64, and in that it comprises a heavy chain sequence comprising the amino acid sequence SEQ ID No. 65.
- the chimeric antibody, or a derived compound or functional fragment of same, of the invention comprises a light chain sequence comprising the amino acid sequence SEQ ID No. 66, and in that it comprises a heavy chain sequence comprising the amino acid sequence SEQ ID No. 67.
- Humanized antibodies means an antibody that contains CDR regions derived from an antibody of nonhuman origin, the other parts of the antibody molecule being derived from one (or several) human antibodies.
- some of the skeleton segment residues can be modified to preserve binding affinity (Jones et al. , Nature, 321 :522-525, 1986; Verhoeyen et al., Science, 239:1534-1536, 1988; Riechmann et al., Nature, 332:323-327, 1988).
- humanized antibodies of the invention or fragments of same can be prepared by techniques known to a person skilled in the art (such as, for example, those described in the documents Singer et al., J. Immun., 150:2844-2857, 1992; Mountain et al., Biotechnol. Genet. Eng. Rev., 10:1-142, 1992; and Bebbington et al., Bio/Technology, 10:169-175, 1992).
- Such humanized antibodies are preferred for their use in methods involving in vitro diagnoses or preventive and/or therapeutic treatment in vivo.
- the invention also relates to humanized antibodies arising from the murine antibodies described above.
- constant regions of the light-chain and the heavy-chain derived from human antibody are, respectively, the lambda or kappa and the gamma- 1, gamma-2 or gamma-4 region.
- an additional characteristic of the antibody is to exhibit effector functions, such as antibody- dependant cellular cytotoxicity (ADCC) and/or complement-dependant cytotoxicity
- a novel aspect of the present invention relates to an isolated nucleic acid characterized in that it is selected among the following nucleic acids (including any degenerate genetic code): - a nucleic acid, DNA or RNA, coding for an antibody, or for a derived compound or functional fragment of same, according to the invention;
- nucleic acid of at least 18 nucleotides capable of hybridizing under highly stringent conditions with at least one of the CDRs of nucleic acid sequences SEQ ID Nos. 15 to 26 or SEQ ID Nos. 52 to 61or a sequence with at least 80%, preferably 85%,
- nucleic acid of at least 18 nucleotides capable of hybridizing under highly stringent conditions with at least the light chain of nucleic acid sequence SEQ ID No. 27 or SEQ ID No. 62 or SEQ ID No. 68 or 70 and/or the heavy chain of nucleic acid sequence SEQ ID No. 28 or SEQ ID No. 63 or SEQ ID No. 69 or 71 or a sequence with at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 27 and/or 28 or SEQ ID Nos. 62 and/or 63 or SEQ ID Nos. 68 and/or 69 or SEQ ID Nos. 70 and/or 71.
- nucleic acid means a precise sequence of nucleotides, modified or not, defining a fragment or a region of a nucleic acid, containing unnatural nucleotides or not, and being either a double-strand DNA, a single- strand DNA or transcription products of said DNAs.
- the present invention does not relate to nucleotide sequences in their natural chromosomal environment, i.e., in a natural state.
- the sequences of the present invention have been isolated and/or purified, i.e., they were sampled directly or indirectly, for example by a copy, their environment having been at least partially modified.
- Isolated nucleic acids obtained by recombinant genetics, by means, for example, of host cells, or obtained by chemical synthesis should also be mentioned here.
- nucleic sequences exhibiting a percentage identity of at least 80%, preferably 85%, 90%, 95% and 98%, after optimal alignment with a preferred sequence means nucleic sequences exhibiting, with respect to the reference nucleic sequence, certain modifications such as, in particular, a deletion, a truncation, an extension, a chimeric fusion and/or a substitution, notably punctual.
- these are sequences which code for the same amino acid sequences as the reference sequence, this being related to the degeneration of the genetic code, or complementarity sequences that are likely to hybridize specifically with the reference sequences, preferably under highly stringent conditions, notably those defined below.
- Hybridization under highly stringent conditions means that conditions related to temperature and ionic strength are selected in such a way that they allow hybridization to be maintained between two complementarity DNA fragments.
- the highly stringent conditions of the hybridization step for the purpose of defining the polynucleotide fragments described above are advantageously as follows.
- DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1) prehybridization at 42°C for three hours in phosphate buffer (20 mM, pH 7.5) containing 5X SSC (IX SSC corresponds to a solution of 0.15 M NaCl + 0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 1OX Denhardt's, 5% dextran sulfate and 1% salmon sperm DNA; (2) primary hybridization for 20 hours at a temperature depending on the length of the probe (i.e.: 42°C for a probe >100 nucleotides in length) followed by two 20-minute washings at 20 0 C in 2X SSC + 2% SDS, one 20-minute washing at 20 0 C in 0.1X SSC + 0.1% SDS.
- IX SSC corresponds to a solution of 0.15 M NaCl + 0.015 M sodium citrate
- SDS sodium dodecyl sulf
- the last washing is carried out in 0.1X SSC + 0.1% SDS for 30 minutes at 60 0 C for a probe >100 nucleotides in length.
- the highly stringent hybridization conditions described above for a polynucleotide of defined size can be adapted by a person skilled in the art for longer or shorter oligonucleotides, according to the procedures described in Sambrook, et al. (Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory; 3rd edition, 2001).
- the invention also relates to a vector comprising a nucleic acid as described in the invention.
- the invention notably targets cloning and/or expression vectors that contain such a nucleotide sequence.
- the vectors of the invention preferably contain elements which allow the expression and/or the secretion of nucleotide sequences in a given host cell.
- the vector thus must contain a promoter, translation initiation and termination signals, as well as suitable transcription regulation regions. It must be able to be maintained in a stable manner in the host cell and may optionally have specific signals which specify secretion of the translated protein.
- These various elements are selected and optimized by a person skilled in the art according to the host cell used.
- the nucleotide sequences can be inserted in self-replicating vectors within the chosen host or be integrative vectors of the chosen host.
- Such vectors are prepared by methods typically used by a person skilled in the art and the resulting clones can be introduced into a suitable host by standard methods such as lipofection, electroporation, heat shock or chemical methods.
- the vectors are, for example, vectors of plasmid or viral origin. They are used to transform host cells in order to clone or express the nucleotide sequences of the invention.
- the invention also comprises host cells transformed by or comprising a vector as described in the present invention.
- the host cell can be selected among prokaryotic or eukaryotic systems such as bacterial cells, for example, but also yeast cells or animal cells, notably mammal cells. Insect or plant cells can also be used.
- the invention also relates to animals, other than man, that have a transformed cell according to the invention.
- Another aspect of the invention relates to a method for the production of an antibody according to the invention, or one of its functional fragments, characterized in that said method comprises the following steps: a) the culture in a medium of and the suitable culture conditions for a host cell according to the invention; and b) the recovery of said antibody, or one of its functional fragments, thus produced from the culture medium or from said cultured cells.
- the transformed cells according to the invention are of use in methods for the preparation of recombinant polypeptides according to the invention.
- Methods for the preparation of polypeptide according to the invention in recombinant form characterized in that said methods use a vector and/or a cell transformed by a vector according to the invention, are also comprised in the present invention.
- a cell transformed by a vector according to the invention is cultured under conditions that allow the expression of the aforesaid polypeptide and recovery of said recombinant peptide.
- the host cell can be selected among prokaryotic or eukaryotic systems.
- a vector according to the invention carrying such a sequence can thus be used advantageously for the production of recombinant proteins to be secreted. Indeed, the purification of these recombinant proteins of interest will be facilitated by the fact that they are present in the supernatant of the cellular culture rather than inside host cells.
- polypeptides of the invention can also be prepared by chemical synthesis.
- One such method of preparation is also an object of the invention.
- a person skilled in the art knows methods for chemical synthesis, such as solid-phase techniques (see notably Steward et ah, 1984, Solid phase peptides synthesis, Pierce Chem. Company, Rockford, 111, 2nd ed.) or partial solid-phase techniques, by condensation of fragments or by conventional synthesis in solution.
- Polypeptides obtained by chemical synthesis and capable of containing corresponding unnatural amino acids are also comprised in the invention.
- the antibodies, or the derived compounds or functional fragments of same, likely to be obtained by the method of the invention are also comprised in the present invention.
- the present invention relates to an antibody as described above, characterized in that it is, in addition, capable of specifically binding to a human chemokine family receptor and/or capable of specifically inhibiting the signaling of such a receptor.
- the invention relates to an antibody, or its derived compounds or functional fragments, consisting of an antibody that is bispecific in the sense that it comprises a second motif capable of interacting with any receptor implicated in the development of tumors, such as, for example, VEGFR, VEGF, EGFR, IGF-IR, HER2neu, HGF, cMET, FGF, tetraspanins, integrins, CXCR4 (other than the antibody of the present invention, i.e. targeting another epitope), CXCR7 or CXCR2.
- a second motif capable of interacting with any receptor implicated in the development of tumors, such as, for example, VEGFR, VEGF, EGFR, IGF-IR, HER2neu, HGF, cMET, FGF, tetraspanins, integrins, CXCR4 (other than the antibody of the present invention, i.e. targeting another epitope), CXCR7 or CXCR2.
- the bispecific or bifunctional antibodies constitute a second generation of monoclonal antibodies in which two different variable regions are combined in the same molecule (Hollinger and Bohlen, 1999, Cancer and metastasis, rev. 18:411-419). Their utility was demonstrated in both diagnostic and therapeutic domains relative to their capacity to recruit new effector functions or to target several molecules on the surface of tumor cells; such antibodies can be obtained by chemical methods (Glennie MJ et al., 1987, J. Immunol. 139, 2367-2375; Repp R. et al, 1995, J. Hemat., 377-382) or somatic methods (Staerz U.D. and Bevan M.J., 1986, PNAS 83, 1453-1457; Suresh M.R.
- bispecific antibodies can be constructed as whole IgG, bispecific Fab'2, Fab 'PEG, diabodies or bispecific scFv, but also as a tetravalent bispecific antibody in which two binding sites are present for each antigen targeted (Park et al, 2000, MoI. Immunol, 37(18): 1123-30) or the fragments of same as described above.
- the use of such bispecific antibodies has the advantage of reducing the treatment's toxicity. Indeed, the use of a bispecific antibody makes it possible to decrease the overall quantity of circulating antibodies and, consequently, possible toxicity.
- the bispecific antibody is a bivalent or tetravalent antibody.
- the present invention relates to the antibody described above, or its derived compounds or functional fragments, for use as a drug.
- the invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising as an active ingredient a compound consisting of an antibody of the invention, or one of its derived compounds or functional fragments.
- said antibody is supplemented by an excipient and/or a pharmaceutically acceptable carrier.
- the invention also relates to a composition characterized in that it comprises, in addition, as a combination product for use in a simultaneous, separated or extended fashion, an anti-tumor antibody other that an antibody directed against CXCR4.
- the present invention also relates to a pharmaceutical composition as described above that comprises at least a second antitumor compound selected among the compounds capable of specifically inhibiting the tyrosine kinase activity of receptors such as IGF-IR, EGFR, HER2/neu, cMET, VEGFR or VEGF, or any other antitumor compound known to a person skilled in the art.
- a second antitumor compound selected among the compounds capable of specifically inhibiting the tyrosine kinase activity of receptors such as IGF-IR, EGFR, HER2/neu, cMET, VEGFR or VEGF, or any other antitumor compound known to a person skilled in the art.
- said second compound can be selected among the antibodies antiEGFR, antiIGF-IR, antiHER2/neu, anticMET,
- VEGFR, VEGF, etc. isolated, or their functional fragments and derived compounds, capable of inhibiting the proliferative and/or anti-apoptotic and/or angiogenic and/or inductive activity of metastatic dissemination promoted by said receptors.
- antiCD20 antibodies such as a rituximab, ibritumomab or tositumomab
- antiCD33 antibodies such as gemtuzumab or lintuzumab
- antiCD22 antibodies such as epratuzumab
- antiCD52 antibodies such as alemtuzumab
- antiEpCAM antibodies such as edrecolomab, Ch 17-1A or IGN-101
- antiCTP21 or 16 antibodies such as Xactin
- antiDNA-Ag antibodies such as 131 I-Cotara TNT-I
- antiMUCl antibodies such as pemtumomab or Rl 150
- antiMUC18 antibodies such as ABX-MAl
- antiGD3 antibodies such as mitumomab
- antiECA antibodies such as CeaVac or labetuzumab
- antiCA125 antibodies such as OvaRex
- antiHLA-DR antibodies such as apolizumab
- Another embodiment complementary to the invention consists of a composition as described above comprised of, in addition, as a combination or conjugaison product for simultaneous, separated or extended use, a cytotoxic/cytostatic agent.
- “Simultaneous use” means the administration of both compounds of the composition comprised in a single dosage form.
- “Separated use” means administration, at the same time, of both compounds of the composition, comprised in distinct dosage forms.
- Extended use means the successive administration of both compounds of the composition, each comprised in a distinct dosage form.
- the composition according to the invention considerably increases cancer treatment effectiveness.
- the therapeutic effect of the antibody of the invention is enhanced in an unexpected way by the administration of a cytotoxic agent.
- Another major subsequent advantage produced by a composition of the invention relates to the possibility of using lower effective doses of the active ingredient, thus making it possible to avoid or reduce the risks of the appearance of side effects, in particular the effect of the cytotoxic agent.
- this composition makes it possible to achieve the expected therapeutic effect more quickly.
- Therapeutic anticancer agent or "cytotoxic agent” means a substance which, when it is administered to a patient, treats or prevents the development of cancer in the patient.
- Non-limiting examples of such agents include “alkylating” agents, antimetabolites, antitumor antibiotics, mitotic inhibitors, inhibitors of chromatin functioning, antiangiogenics, antiestrogens, antiandrogens and immunomodulators.
- Such agents for example, are cited in VIDAL, on the page devoted to compounds related to oncology and hematology under the heading "Cytotoxic"; the cytotoxic compounds cited by reference to this document are cited herein as preferred cytotoxic agents.
- Alkylating agent refers to any substance that can bind covalently with or can alkylate any molecule, preferentially a nucleic acid (e.g., DNA), within a cell.
- alkylating agents include nitrogen mustards such as mechlorethamine, chlorambucil, melphalan, chlorhydrate, pipobroman, prednimustine, disodium phosphate or estramustine; oxazaphosphorines such as cyclophosphamide, altretamine, trofosfamide, sulfofosfamide or ifosfamide; aziridines or ethylene-imines such as thiotepa, triethyleneamine or altetramine; nitrosoureas such as carmustine, streptozocine, fotemustine or lomustine; alkyl sulfonates such as busulfan, treosulfan or improsulfan; triazenes such as dacarbazine;
- Antimetabolite refers to a substance that blocks growth and/or cellular metabolism by interfering with certain activities, generally DNA synthesis.
- antimetabolites include methotrexate, 5-fluorouracile, floxuridine, 5- fluorodeoxyuridine, capecitabine, cytarabine, fludarabine, cytosine arabinoside, 6- mercaptopurine (6-MP), 6-thioguanine (6-TG), chlorodesoxyadenosine, 5-azacytidine, gemcitabine, cladribine, deoxycoformycin and pentostatin.
- Antitumor antibiotic refers to a compound that can prevent or inhibit the synthesis of DNA, RNA and/or proteins.
- antitumor antibiotics include doxorubicin, daunorubicin, idarubicin valrubicin, mitoxantrone, dactinomycin, mithramycin, plicamycin, mitomycin C, bleomycin and procarbazine.
- Mitotic inhibiters prevent the normal progression of the cell cycle and mitosis.
- microtubule inhibiters or “taxoids” such as paclitaxel and docetaxel are capable of inhibiting mitosis.
- the vinca alkaloids, such as vinblastine, vincristine, vindesine and vinorelbine, are also capable of inhibiting mitosis.
- Chromatin inhibiters or “topoisomerase inhibiters” are substances that inhibit the normal functioning of proteins that shape chromatin, such as topoisomerases I and II.
- examples of such inhibiters include, for topoisomerase I, camptothecine and its derivatives, such as irinotecan or topotecan; for topoisomerase II, etoposide, etiposide phosphate and teniposide.
- An “antiangiogenic” is any drug, compound, substance or agent that inhibits the growth of the blood vessels.
- antiangiogenics include, without being limiting, razoxin, marimastat, batimastat, prinomastat, tanomastat, ilomastat, CGS- 27023A, halofuginone, COL-3, neovastat, BMS-275291, thalidomide, CDC 501, DMXAA, L-651582, squalamine, endostatine, SU5416, SU6668, interferon-alpha, EMD 121974, interleukin-12, IM862, angiostatin and vitaxin.
- Antiestrogen or “estrogen antagonist” refers to any substance that decreases, antagonizes or inhibits estrogen action. Examples of such agents are tamoxifene, toremifene, raloxifene, droloxifene, iodoxyfene, anastrozole, letrozole and exemestane.
- Antiandrogen or “androgen antagonist” refers to any substance that reduces, antagonizes or inhibits androgen action. Examples of antiandrogens include flutamide, nilutamide, bicalutamide, sprirono lactone, cyproterone acetate, finasteride and cimitidine.
- Immunomodulators are substances that stimulate the immune system.
- immunomodulators include interferon, interleukins such as aldesleukin, OCT-43, denileukin diftitox or inter leukine-2, tumor necrosis factors such as tasonermine, or other types of immunomodulators such as lentinan, sizofiran, roquinimex, pidotimod, pegademase, thymopentine, poly I:C or levamisole in combination with 5-fluorouracil.
- composition of the invention as a combination product is characterized in that said cytotoxic agent is bound chemically to said antibody for use simultaneously.
- said composition is characterized in that said cytotoxic/cytostatic agent is selected among the spindle inhibitors or stabilizers, preferably vinorelbine and/or vinflunine and/or vincristine.
- spacer molecules can be introduced between the two compounds to bind, such as the poly(alkylene)glycol polyethyleneglycol or the amino acids; or, in another embodiment, said cytotoxic agents' active derivatives, into which have been introduced functions capable of reacting with said antibody, can be used.
- binding techniques are well-known to a person skilled in the art and will not be discussed in more detail in the present description.
- EGFR inhibiters include, without being limiting, monoclonal antibodies C225 and antiEGFR 22Mab (ImClone Systems Incorporated), ABX-EGF (Abgenix/Cell
- EMD-7200 Merck KgaA
- Another aspect of the invention relates to a composition characterized in that at least one of said antibodies, or of the derived compounds or functional fragments of same, is combined or conjugated with a cellular toxin and/or a radioisotope.
- said toxin or said radioisotope is capable of preventing the growth or proliferation of the tumor cell, notably of completely inactivating said tumor cell.
- said toxin is an enterobacteria toxin, notably Pseudomonas exotoxin A.
- the radioisotopes preferentially combined with therapeutic antibodies are radioisotopes that emit gamma rays, preferentially iodine 131 , yttrium 90 , gold 199 , palladium 100 , copper 67 , bismuth 217 and antimony 211 . Radioisotopes that emit alpha and beta rays can also be used in therapy.
- Toxin or radioisotope combined with at least one antibody of the invention, or a functional fragment of same refers to any means that makes it possible to bind said toxin or said radioisotope to that at least one antibody, notably by covalent binding between the two compounds, with or without the introduction of the binding molecule.
- agents that allow chemical (covalent), electrostatic, or non-covalent bonding of all or part of the conjugate's elements include, in particular, benzoquinone, carbodiimide and more particularly EDC (l-ethyl-3-[3-dimethyl-aminopropyl]- carbodiimide-hydrochloride), dimaleimide, dithiobis-nitrobenzoic (DTNB) acid, N- succinimidyl S-acetyl thio-acetate (SATA), bridging agents with one or more groups, with one or more phenylaside groups, reacting with ultraviolet (UV) rays, most preferentially N- [-4 (azidosalicylamino)butyl]-3 '-(2'-pyridyldithio)-propionamide (APDP), N-succinimid-yl 3(2-pyridyldithio) propionate (SPDP) and 6-hydrazino- nicotinamide (HY
- chelators examples include the chelators derived from EDTA (ethylenediaminetetraacetic acid) or DTPA (diethylenetriaminepentaacetic acid) which were developed to bind metals, particularly radioactive metals, with immunoglobulins.
- EDTA ethylenediaminetetraacetic acid
- DTPA diethylenetriaminepentaacetic acid
- DTPA and its derivatives can be substituted on the carbon chain by various groups in such a way as to increase the stability and the rigidity of the ligand-metal complex (Krejcarek et ah, 1977; Brechbiel et ah, 1991; Gansow, 1991; US patent 4,831,175).
- DTPA diethylenetriaminepentaacetic acid
- DTPA diethylenetriaminepentaacetic acid
- said at least one antibody of the invention forming said conjugate is selected among its functional fragments, notably fragments that have lost their Fc component, such as scFv fragments.
- the present invention also comprises the use of the composition for the preparation of a drug intended for the prevention or the treatment of cancer.
- the present invention also relates to the use of an antibody, or a derived compound or functional fragment of same, preferably humanized, and/or of a composition according to the invention for the preparation of a drug for inhibiting the growth of tumor cells.
- the present invention relates to the use of an antibody, or a derived compound or functional fragment of same, preferably humanized, and/or of a composition, for the preparation of a drug for cancer prevention or treatment.
- Preferred cancers that can be prevented and/or treated include prostate cancer, osteosarcoma, lung cancer, breast cancer, endometrial cancer, colon cancer, multiple myeloma, ovarian cancer, pancreatic cancer or any other cancer.
- the invention also concerns the use of an antibody, or a derived compound or functional fragment of same, and/or of a composition as above described for the preparation of a drug for modulating CXCR4 activity in a cell.
- Another aspect of the present invention relates to the use of the antibody as described in a diagnostic method, preferably in vitro, of diseases related to CXCR4 expression level.
- said CXCR4 protein related diseases in said diagnostic method will be cancers.
- the antibodies of the invention can be employed in a method for the detection and/or quantification of CXCR4 protein in a biological sample in vitro, notably for the diagnosis of diseases associated with an abnormal expression with this protein, such as cancers, wherein said method comprises the following steps: a) placing the biological sample in contact with an antibody according to the invention, or a derived compound or functional fragment of same; b) demonstrating the antigen-antibody complex possibly formed.
- kits or accessories for the implementation of a method as described comprising the following elements: a) a polyclonal or monoclonal antibody of the invention; b) optionally, reagents for constituting the medium favorable to immunological reactions; c) optionally, reagents that reveal the antigen- antibodies complexes produced by the immunological reaction.
- the antibodies or functional fragments of same can be immobilized on a support, notably a protein chip.
- a support notably a protein chip.
- a protein chip is an object of the invention.
- the protein chips can be used in the kits or accessories required for detecting and/or quantifying CXCR4 protein in a biological sample.
- biological sample relates herein to samples taken from a living organism (notably blood, tissue, organ or other samples taken from a mammal, notably man) or any sample likely to contain one such CXCR4 protein (such as a sample of cells, transformed if needed).
- Said antibody, or a functional fragment of same can be in the form of an immunoconjugate or of a labeled antibody in order to obtain a detectable and/or quantifiable signal.
- the labeled antibodies of the invention, or the functional or fragments of same include, for example, antibody conjugates (immunoconjugates), which can be combined, for example, with enzymes such as peroxidase, alkaline phosphatase, ⁇ -D- galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate dehydrogenase or by a molecule such as biotin, digoxigenin or 5-bromo-desoxyuridine.
- enzymes such as peroxidase, alkaline phosphatase, ⁇ -D- galactosidase, glucose oxidase, glucose amylase
- Fluorescent labels can be also combined with the antibodies of the invention or functional fragments of same, including notably fluorescein and its derivatives, fluorochrome, rhodamine and its derivatives, green fluorescent protein (GFP), dansyl, umbelliferone, etc.
- the antibodies of the invention or functional fragments of same can be prepared by methods known to a person skilled in the art. They can be bound with enzymes or fluorescent labels directly; via a spacer group or a linkage group such as polyaldehyde, glutaraldehyde, ethylenediaminetetraacetic acid (EDTA) or diethylenetriaminepentaacetic acid (DPTA); or in the presence of binding agents such as those mentioned above for therapeutic conjugates.
- Conjugates carrying fluorescein labels can be prepared by reaction with an isothiocyanate.
- Others conjugates can also include chemiluminescent labels such as luminol and dioxetane, bio luminescent labels such as luciferase and luciferin, or radioactive labels such as iodine 123 , iodine 125 , iodine 126 , iodine 133 , bromine 77 , technetium 99 “ 1 , indium 111 , indium 113 " 1 , gallium 67 , gallium 68 , ruthenium 95 , ruthenium 97 , ruthenium 103 , ruthenium 105 , mercury 107 , mercury 203 , rhenium 99 “ 1 , rhenium 101 , rhenium 105 , scandium 47 , tellurium 121 “ 1 , tellurium 122 “ 1 , tellurium 125 “ 1 , thulium 165 , thulium 167 , thulium 168 , fluorine 18
- the invention also relates to the use of an antibody according to the invention for the preparation of a drug for the specific targeting of a compound that is biologically active toward cells expressing or overexpressing CXCR4.
- a "biologically active compound” is any compound capable of modulating, notably inhibiting, cellular activity, notably growth, proliferation, transcription and gene translation.
- the invention also relates to an in vivo diagnostic reagent composed of an antibody according to the invention, or a functional fragment of same, preferably labeled, notably radiolabeled, and its use in medical imaging, notably for the detection of cancer related to the cellular expression or overexpression of CXCR4.
- the invention also relates to a composition as a combination product or to an anti-CXCR4/toxin conjugate or radioisotope, according to the invention, used as drug.
- composition as a combination product or said conjugate will be supplemented by an excipient and/or a pharmaceutical vehicle.
- pharmaceutical vehicle means a compound, or a combination of compounds, entering a pharmaceutical composition that does not cause secondary reactions and that, for example, facilitates administration of the active compounds, increases its lifespan and/or effectiveness in the organism, increases its solubility in solution or improves its storage.
- pharmaceutical carriers are well- known and will be adapted by a person skilled in the art according to the nature and the administration route of the active compounds selected.
- such compounds will be administered by systemic route, notably by intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous or oral route. More preferably, the composition composed of the antibody according to the invention will be administered in several doses spaced equally over time.
- Their administration routes, dosing schedules and optimal galenic forms can be determined according to the criteria generally taken into account when establishing a treatment suited to a patient such as, for example, the patient's age or body weight, the seriousness of his general state, his tolerance for the treatment and the side effects experienced.
- the invention relates to the use of an antibody, or one of its functional fragments, for the preparation of a drug for the specific targeting of a compound that is biologically active toward cells expressing or overexpressing CXCR4.
- Figures IA and IB show CXCR4 and CXCR2 expression in cancer cells by qPCR analysis, respectively.
- FIG. 1 shows CXCR4 and CXCR2 protein expression in cancer cells by FACS analysis.
- Figures 3 A and 3B show the competition of specific [ 125 I]SDFl binding by unlabeled SDF-I ( Figure 3A) and 414H5 and 515H7 Mabs ( Figure 3B) on cellular membranes of CHO-Kl cells stably expressing wild-type human CXCR4 (T: total binding ; NS: non-specific binding).
- Figures 4 A and 4B show the modulation of G protein activation by 414H5 Mab ( Figure 4A) and 515H7 Mab (Figure 4B) by monitoring [ 35 S]GTP ⁇ S binding responses at wild-type CXCR4 receptor stably expressed in NIH-3T3 cells.
- Figure 5 shows the modulation of G protein activation by anti-CXCR4 Mabs
- Figures 6A-6F show the modulation of CXCR4 receptor association with different interaction partners by SDF-I and by 414H5 and 515H7 Mabs via a bio luminescence resonance energy transfer (BRET) approach in HEK293 cells.
- BRET bio luminescence resonance energy transfer
- FIGS. 6A and 6B CXCR4:CXCR4 homo-dimerization
- Figures 6C and 6D CXCR2:CXCR4 hetero-dimerization
- Figures 6E and 6F CXCR4-mediated recruitment of ⁇ - arrestin).
- Figures 7 A and 7B show the inhibition of forskolin- stimulated cAMP production by SDF-I and 414H5 and 515H7 Mabs in NIH3T3 cells stably expressing CXCR4 receptor.
- Figure 8 shows the modulation of G protein activation by anti-CXCR4 Mabs 414H5 and 515H7 by monitoring [ 35 S]GTPyS binding responses at constitutively active mutant Asn 119 Ser CXCR4 receptor stably expressed in CHO-Kl cells.
- Figure 9 illustrates the inhibition of SDF-I induced HeIa cell proliferation by the Mab 414H5 in vitro.
- Figures 1OA and 1OB show the inhibition of SDF-I -induced U937 cells migration by CXCR4 Mab 414H5 ( Figure 10A) and Mab 515H7 ( Figure 10B) in vitro.
- Figure 11 shows inhibition of MDA-MB-231 xenograft tumor growth by anti- CXCR4 Mab 414H5 (A) and Mab 515H7 (B) in Nod/Scid mice.
- Figure 12 shows the anti-CXCR4 Mab 414H5 activity in U937 Nod/Scid mice survival model.
- Figures 13A-13C show the SDF-I -induced calcium release inhibition by anti- CXCR4 Mab 515H7 in CHO-CXCR4 cells ( Figure 13A) and MDA-MB-231 (Figure 13B), U937 (Figure 13C) cancer cells.
- Figure 14 shows the inhibition of T-cell KARPAS 299 xenograft tumor in
- Figure 15 shows the activity of murine anti-CXCR4 Mab m515H7 in U937 Nod/Scid mice survival model.
- Figure 16 shows the activity of murine anti-CXCR4 Mab m515H7 in inhibition of T-cell KARPAS 299 xenograft tumor growth in Nod/Scid mice
- Figure 17 shows the competition of specific [ 125 I]SDFl binding by murine m414H5 and m515H7 Mabs and chimeric Mabs c414H5 and c515H7 on cellular membranes of CHO-Kl cells stably expressing wild-type human CXCR4 (T: total binding ; NS: non-specific binding).
- Figure 18 shows the modulation of G protein activation by murine m414H5 and m515H7 Mabs and by chimeric Mabs c414H5 and c515H7 by monitoring [ 35 S]GTP ⁇ S binding responses at wild-type CXCR4 receptor stably expressed in NIH-3T3 cells stimulated with SDF-I (10 nM).
- Figure 19 shows the modulation of G protein activation by anti-CXCR4 murine m414H5 and m515H7 Mabs and chimeric Mabs c414H5 and c515H7 by monitoring [ 35 S]GTPyS binding responses at HeLa human tumor cells stimulated with SDF-I (1O nM).
- Figures 20A-20C show the modulation of CXCR4 receptor association with different interaction partners by SDF-I and by m414H5, c414H5, m515H7 and c515H7
- Figures 21 A and 2 IB show the inhibition of SDF-I -induced calcium release in CHO-CXCR4 cells (figure 21A) and in U937 cells (figure 21B)
- Figures 22A and 22B show the inhibition of SDF-I -induced U937 cells migration by CXCR4 Mabs m414H5 and c414H5 ( Figure 22A) and Mabs m515H7 and c515H7 ( Figure 22B) in vitro.
- Figure 23 shows the anti-CXCR4 chimeric Mabs c414H5 and c515H7 activity in U937 Nod/Scid mice survival model.
- RNA samples were extracted from different cell lines using RNeasy Mini or
- RNA samples were then controlled using the Experion automated electrophoresis system (BIO-RAD Corporation, France) and showed a good quality/integrity.
- One ⁇ g of each RNA sample was converted into cDNA template using the iScript cDNA Synthesis kit (BIO-RAD Corporation, France).
- cDNA levels were quantified using qPCR with either a TaqMan probe for CXCR2 or
- TaqMan probes (used for CXCR2) carried a 5' FAM reporter label and a 3' TAMRA quencher group.
- the PCR enzyme was activated by heating for 2 min at 50 0 C and 10 min at 95°C.
- a two step procedure was used, 15 sec at 95°C and 1 min at 62°C for 40 or 45 cycles in a PCR mix containing 5 ⁇ l of cDNA template (dilution 1/20), 1 x qPCR Mastermix (TaqMan Universal PCR Master Mix, Applied Biosystems corporation, Branchburg New Jersey, USA), 50 to 900 nM of each primers and 50 to 100 nM probe in a total volume of 50 ⁇ l. All reactions were performed using iCycler instrument (BIO-RAD Corporation). Q-PCR allowed to determine Cycle threshold (Ct). The more the Ct value is small, the more the gene tested is expressed.
- Cycle threshold Cycle threshold
- Primers and probe for Human Ribosomal protein, large, PO were: forward primer, 5 '-GAAACTCTGCATTCTCGCTTCCTG-3 ' (SEQ ID No.32); reverse primer, 5'-AGGACTCGTTTGTACCCGTTGA-3'(SEQ ID No.33); probe, 5 -(FAM)- TGCAGATTGGCTACCCAACTGTTGCA-(TAMRA)-3' (SEQ ID No. 34).
- Primers for Human CXCR4 were: forward primer, 5 ' -CTCCTTC ATCCTCCTGGAAATC-3 ' (SEQ ID No. 35); reverse primer, 5 '-CCAAGGAAAGCATAGAGGATGG-S ' (SEQ ID NO. 36).
- Primers and probe for Human CXCR2 were: forward primer, 5 '-GTGGTCATTATCTATGCCCTGG-S ' (SEQ ID NO. 37); reverse primer, 5 '-CGACCCTGCTGTATAAGATGAC-S ' (SEQ ID NO.38); probe, 5 -(FAM)- TATTCCTGCTGAGCCTGCTGGGAAA-(T AMRA)-3'
- MDA-MB-231 , PC3 and U937 cancer cell lines were permebilized and then incubated with either 10 ⁇ g/mL of anti-CXCR4 monoclonal antibodies [44717 (R&D Systems) versus its isotype control IgG2b (SIGMA] or 10 ⁇ g/mL of anti-CXCR2 monoclonal antibodies (anti h-CXCR2, clone 48311, R&D Systems, Mab 331 versus its isotype control IgG2a).
- the cells were then washed with 1%BSA/PBS/O.O1% NaN3. Next, Alexa-labeled secondary antibodies were added to the cells and were allowed to incubate at 4°C for 20 min.
- tumor cells such as MDA-MB-231 , PC3 and U937 expressed both CXCR4 and CXCR2 proteins.
- Example 2 Generation of monoclonal antibodies (Mabs) against human CXCR4
- mice producing anti-CXCR4 antibodies sera from immunized mice was tested by ELISA. Briefly, microtiter plates were coated with purified [1-41] N-terminal peptide conjugated to BSA at 5 ⁇ g equivalent peptide/mL, lOO ⁇ L/well incubated at 4°C overnight, then blocked with 250 ⁇ L/well of 0.5% gelatine in PBS. Dilutions of plasma from CXCR4-immunized mice were added to each well and incubated 2 hours at 37°C. The plates were washed with PBS and then incubated with a goat anti-mouse IgG antibody conjugated to HRP (Jackson Laboratories) for 1 hour at 37°C. After washing, plates were developed with TMB substrate, the reaction was stopped 5 min later by addition of 100 ⁇ L/well IM H 2 SO 4 . Mice that developed the highest titers of anti-CXCR4 antibodies were used for antibody generation.
- mice isolated from a Balb/c mice that developed the highest titers of anti-CXCR4 antibodies were fused with PEG to a mouse myeloma cell line Sp2/0.
- Cells were plated at approximately Ix 10 5 /well in microtiter plates followed by two weeks incubation in selective medium containing ultra culture medium + 2 mM L- glutamine + 1 mM sodium pyruvate + Ix HAT.
- Wells were then screened by ELISA for anti-CXCR4 monoclonal IgG antibodies.
- the antibody secreting hybridomas were then subcloned at least twice by limiting dilution, cultured in vitro to generate antibody for further analysis.
- Example 3 Characterization by FACS analysis of anti-CXCR4 Mabs 414H5 and 515H7 binding specificity and cancer cell lines recognition In this experiment, specific binding to human CXCR4 of anti-CXCR4 Mabs
- NIH3T3, NIH3T3-hCXCR4 transfected cells, MDA-MB-231, HeIa and U937 cancer cell lines were incubated with 10 ⁇ g/mL of monoclonal antibody 414H5 and 515H7. The cells were then washed with 1%BSA/PBS/O.O1% NaN3. Next, Alexa- labeled secondary antibodies were added to the cells and were allowed to incubate at
- Anti-CXCR4 Mabs 414H5 and 515H7 recognized NIH3T3-hCXCR4 transfectant while there was no recognition of the parent NIH3T3 wild type cells. Mabs 414H5 and 515H7 were also able to recognize cancer cell lines.
- Example 4 Competition binding of anti-CXCR4 Mabs 414H5 and 515H7 for [ 125 I]SDF-I at CHO-Kl membranes stably expressing human CXCR4 receptor
- This assay allows to evaluate the ability of 414H5 and 515H7 Mabs to compete for binding of radio labeled [ 125 I]SDF-I to human CXCR4 receptor, at either orthosteric or allosteric binding sites.
- CHO-Kl cells stably and constitutively expressing human CXCR4 receptor were obtained upon transfection of na ⁇ ve CHO-Kl cells (ATCC CCL-61) with a mammalian expression vector carrying the whole coding sequence of human CXCR4 receptor (RefSeq NM 003467).
- Cells were propagated in complete culture medium [DMEM-Ham's F12 supplemented with 5 % fetal calf serum (FCS) and 500 ⁇ g/ml of geneticin].
- Radioligand binding experiments were conducted on cell membranes obtained upon mechanical scrapping of CHO/CXCR4 cells in lysis buffer [Hepes 2OmM, pH 7.4, NaCl 15OmM] followed by centrifugation (1000Og, 15 min).
- [ 125 I]SDF- 1 binding (specific activity: 1500 Ci/mmol) was performed using the SPA technology (scintillation proximity assay - GE Healthcare).
- cell membranes (30 ⁇ g/well) were incubated in binding buffer [Hepes 2OmM, pH 7.4, CaCl 2 ImM, MgCl 2 5mM, NaCl 15OmM, BSA 1%] together with compound to evaluate (SDF-I or mAb), radioligand (1 nM) and finally SPA-WGA-PVT beads (7.3 mg/well). Binding equilibrium was reach after IH at 25 0 C. Upon centrifugation [1000 g for 10 min.] radioactive counts were measured in a scintillation counter (TopCount, Perkin Elmer). Non-specific binding was estimated in the presence of 10 ⁇ M of unlabelled SDF-I.
- binding buffer [Hepes 2OmM, pH 7.4, CaCl 2 ImM, MgCl 2 5mM, NaCl 15OmM, BSA 1%] together with compound to evaluate (SDF-I or mAb), radioligand (1 nM) and finally SPA-WGA-PVT beads (7.3
- Example 5 Modulation of [ 35 S] GTP ⁇ S binding at cellular membranes expressing wild type CXCR4 receptor by anti-CXCR4 Mabs 414H5 and 515H7
- This functional assay allows to monitor G protein activation via wild type human CXCR4 receptor and its modulation by CXCR4 ligands and 414H5 and 515H7 mAbs.
- NIH-3T3 cells stably and constitutively expressing wild-type CXCR4 receptor were obtained as described in the example above for CHO-Kl cells.
- HeLa (human cervix carcinoma) cells were propagated in complete culture medium [EMEM supplemented with 10% FCS, 1% L-glutamine, 2 ⁇ sodium bicarbonate].
- [ 35 S]GTP ⁇ S binding was performed on cellular membranes obtained upon mechanical scrapping in lysis buffer [Hepes 2OmM, pH 7.4, NaCl 15OmM] and further centrifugation (10000 g, 15 min).
- Example 6 Association of CXCR4 with different interaction partners: homo and heterodimerization, recruitment of ⁇ -arrestin via a bioluminescence resonance energy transfer (BRET) approach and effect of 414H5 and 515H7 Mabs on these dimers
- This functional assay allows to evaluate the conformational changes induced upon SDF-I and/or 414H5 and 515H7 Mabs binding to CXCR4 receptor at the level of CXCR4 homo-dimer and CXCR2/CXCR4 hetero-dimer formation as well as the recruitment of the ⁇ -arrestin-2 signaling protein.
- Expression vectors for each of the investigated interaction partners were constructed as fusion proteins with the corresponding dye (Renilla reniformis luciferase, Rluc and Yellow fluorescent protein, YFP) by applying conventional molecular biology techniques.
- HEK293 cells were transiently transfected with expression vectors coding for the corresponding BRET partners: [CXCR4/Rluc + CXCR4 /YFP] to study CXCR4 homo dimerization, [CXCR4/Rluc + CXCR2:YFP] to study CXCR4 and CXCR2 hetero-dimerization and [CXCR4/Rluc + ⁇ -arr2:YFP] to study CXCR4-mediated recruitment of ⁇ -arrestin-2.
- SDFl (300 nM) increased by about 20 % the BRET signal resulting from the spatial proximity of the adaptor and acceptor proteins fused to CXCR4 receptor, it is likely to indicate CXCR4/CXCR4 homo-dimers formation or conformational changes of pre-existing dimers ( Figures 6A and 6B).
- SDFl (300 nM) decreased by about 24 % the BRET signal resulting from the spatial proximity of the adaptor and acceptor proteins fused to CXCR2 and CXCR4, likely indicating as well CXCR2/CXCR4 hetero-dimers formation or conformational changes of pre-existing dimers ( Figures 6C and 6D).
- This functional assay was designed to monitor CXCR4 receptor signaling at the level of adenylate cyclases via inhibitory Gi/o proteins.
- the cAMP LANCE procedure (Perkin Elmer) was applied as detailed by the supplier. Briefly, NIH3T3 cells stably and constitutively expressing wild type CXCR4 receptor were obtained and propagated as described above. Cells were collected using the trypsin- free agent Versene and resuspended at a concentration of 10 6 cells/ml in a solution containing the AlexaFluor-bound anti cAMP Mab (l/100 th dilution) and compound (forskolin, SDF-I and/or 414H5 and 515H7 Mabs).
- the detection mix containing the Europium- Streptavidin (1/125 th dilution) and Biotin-cAMP (1/125 th dilution) complexes was added.
- the resulting FRET signal was measured in a Mithras LB940 (Berthold) multilabel reader. Data are expressed either as arbitrary fluorescent values or as a relative stimulation versus SDF-I response upon substraction of the FK effect.
- intracellular cAMP levels decreased as a result of inhibitory Gi/o protein activation by CXCR4 receptor.
- the potency of SDF-I was 5.0 ⁇ 3.1 nM ( Figure 7A).
- 414H5 and 515H7 Mabs efficiently inhibited the forskolin- stimulated effect of SDF-I (100 nM) by more than 60 % for 414H5 and by more than 80 % for 515H7 ( Figure 7B).
- Example 8 Modulation of [ 35 S]GTPyS binding at cellular membranes expressing constitutively active mutant Asn 119 Ser CXCR4 receptor by Mabs 414H5 and 515H7
- This functional assay allows to monitor G protein activation via a constitutively active mutant (CAM) Asn 119 Ser CXCR4 receptor (see Zhang et al, 2002).
- This sensitive assay allows to discriminate CXCR4 ligands based on their intrinsic activity (partial agonist, silent antagonist or inverse agonist).
- CXCR4 ligands such as AMD3100 or T140 behaved respectively as partial agonist and inverse agonist at CAM CXCR4 receptor. Identification of silent antagonist may be difficult since this class of molecule must display similar affinities for both active and inactive states of CXCR4 (Wurch et al., 1999).
- HeLa cells from ATCC were routinely cultured in EMEM medium (Lonza Corporation. Venders. Belgium), 10% FCS (SIGMA Corporation. St Louis. USA), 1% L-Glutamine (Invitrogen Corporation. Scotland. UK), 2% Sodium bicarbonate 7.5% solution (Invitrogen Corporation. Scotland. UK). Cells were split 3 days before proliferation assays so that they were confluent.
- HeLa cells were plated in 96-well tissue culture plates at a density of 1 x 10 4 cells/well in 200 ⁇ l of serum free medium (EMEM medium plus 1% L-Glutamine. 2% sodium bicarbonate 7.5% solution). Twenty four hours after plating, appropriate dilutions of SDF-I were added to HeLa cells. After a total of 76 hours of culture, cells were pulsed with 0.25 ⁇ Ci of [ 3 H]thymidine (Amersham Biosciences AB. Uppsala. Sweden) for 16 hours. The magnitude of [ HJthymidine incorporated in DNA was quantified by liquid scintillation counting.
- HeLa cells were incubated with SDF-I (0 to 1000ng/ml).
- SDF-I stimulated in vitro HeLa cells proliferation 1.5 to 2 folds.
- the concentration of SDF-I to obtain the highest and reproducible proliferation index was 200 ng/ml (25 nM).
- HeLa cells were plated in 96-well tissue culture plates at a density of 1 x 10 4 cells/well in 200 ⁇ l of serum free medium (EMEM medium plus 1% L-Glutamine. 2% sodium bicarbonate 7.5% solution). Twenty four hours after plating, appropriate dilutions of anti-CXCR4 Mab 414H5, diluting media were added in triplicate to HeLa cells either in presence or in absence of SDF-I at a final concentration of 200 ng/ml (25 nM). After a total of 76 hours of culture, cells were pulsed with 0.25 ⁇ Ci of [ 3 H]thymidine (Amersham Biosciences AB. Uppsala. Sweden) for 16 hours. The magnitude of [ HJthymidine incorporated in DNA was quantified by liquid scintillation counting.
- Fa [1- [mean cpm of cells incubated with Mab + SDF-I / mean cpm of cells incubated with diluting media + SDF- 1 )] x 100.
- Example 10 Effect of anti-CXCR4 Mabs 414H5 and 515H7 on SDF-I- induced U937 cells migration
- Example 11 Anti-CXCR4 Mab 414H5 inhibition of MDA-MB-231 xenograft tumor growth in Nod/Scid mice
- mice were injected twice a week at 1 mg/dose/mouse of Mab 414H5 twice a week or 0.5 mg/dose/mouse of Mab 515H7 three time a week.
- a PBS group was introduced as a control group in this experiment.
- Tumor volume was measured twice a week and calculated by the formula: ⁇ /6 X length X width X height.
- Statistical analysis were performed at each measure using a Mann- Whitney test.
- U937 cells from ATCC were cultured in RPMI 1640 medium, 10% FCS, 1% L- Glutamine. Cells were split two days before engraftment so that they were in exponential phase of growth.
- Control mice received PBS injections as it has been shown in previous studies that no difference in survival was observed between mice injected with PBS and mice administered with a mouse IgG isotype control. Mice survival was monitored every day.
- mice treated with the 414H5 Mab had a dramatic and significant increase in life span with T/C% about 343.
- Example 13 CXCR4 receptor-mediated mobilization of intracellular calcium stores This functional assay was designed to monitor CXCR4 receptor signaling via stimulation of the phospho lipase C pathway, inducing calcium liberation from intracellular stores from the endoplasmic reticulum.
- CHO-Kl cells stably and constitutively expressing wild-type CXCR4 receptor were obtained as described in the example above.
- MDA-MB-231 (human breast adenocarcinoma) and U937 (human lymphoma) cells were propagated in complete culture medium, respectively [DMEM supplemented with 10% FCS] and [RPMI 1640 supplemented with 10% FCS, 20 mM HEPES, 1% non-essential amino acid solution, 1% sodium pyruvate, 1% L-glutamine, 4.5 g/1 glucose]. All cell types were plated in black 96MW plates at a density of 100,000 cells/well in appropriate culture medium. Cells were starved overnight before conducting the experiments.
- Fluorescence in each well is recorded during 0,1 second every second and for a time period of 20 sec prior SDF-I injection (basal signal). Then 20 ⁇ l of SDF- 1 are injected and data recording follows for a time period of 2 min. Each experimental condition is performed in duplicate. Values for each well are first corrected by substracting the basal fluorescence and the fluorescence emitted by a control well without cells. Relative data are expressed as a percentage of the maximal stimulation obtained by SDF- 1 (100 nM) .
- SDFl (100 nM) induced a rapid and strong release of intracellular calcium in recombinant CHO/CXCR4, whereas no fluorescence signal was detected in na ⁇ ve CHO- Kl cells.
- the maximal intensity reached > 160 % over basal fluorescence and was observed at about 30 sec. upon stimulation by SDF-I; similar kinetic curves were observed with both MDA-MB-231 and U-937 ( Figures 13 A, 13B, 13C), although the maximal fluorescence intensity by SDF-I (100 nM) was lower (130-140 % over basal).
- 515H7 antibody (133 nM) yielded a strong and almost complete inhibition of the SDF-I (100 nM)-induced calcium signal in all three investigated cell lines.
- Example 14 Anti-CXCR4 Mab 414H5 inhibition of T-cell KARPAS 299 xenograft tumor growth in Nod/Scid mice
- the goal of this experiment was to evaluate the ability of anti-CXCR4 Mab 414H5 to inhibit the growth of KARPAS 299 xenograft in Nod/Scid mice.
- KARPAS 299 cells from ECACC were routinely cultured in RPMI medium, 1% L-GIu and 10% FCS (Sigma, St Louis MD, USA). Cells were split 48 hours before engraftment so that they were in exponential phase of growth. Five million KARPAS 299 cells were engrafted in PBS to 7 weeks old Nod/Scid mice (Charles River, France). Five days after implantation, tumors were measurable (32 mm 3 ⁇ V 3 ⁇ 49 mm 3 ) and animals were divided into groups of 6 mice with comparable tumor size. Mice were treated i.p. with a 2 mg/mouse loading dose of Mab 414H5. Then, mice were injected twice a week at 1 mg/dose/mouse of Mab 414H5. A
- PBS group was introduced as a control group in this experiment. Tumor volume was measured twice a week and calculated by the formula: ⁇ /6 X length X width X height. Statistical analysis were performed at each measure using a Mann- Whitney test.
- Example 15 Anti-CXCR4 Mab 515H7 activity in U937 mice survival model U937 cells from ATCC were cultured in RPMI 1640 medium, 10% FCS, 1% L-
- mice were split two days before engraftment so that they were in exponential phase of growth.
- mice were treated s.c. with a loading dose of 2 mg of 515H7 Mab/mouse and then twice a week with 1 mg of antibody/mouse.
- Control mice received PBS injections as it has been shown in previous studies that no difference in survival was observed between mice injected with PBS and mice administered with a mouse IgG isotype control. Mice survival was monitored every day.
- Results described in figure 15 showed that mice treated with 515H7 Mab had a dramatic and significant increase in life span with T/C% about 280 for 515H7 Mab (Figure 15).
- Example 16 Anti-CXCR4 Mab 515H7 inhibition of T-cell KARPAS 299 xenograft tumor growth in Nod/Scid mice
- the goal of this experiment was to evaluate the ability of anti-CXCR4 Mab 515H7 to inhibit the growth of KARPAS 299 xenograft in Nod/Scid mice.
- KARPAS 299 cells from ECACC were routinely cultured in RPMI medium, 1% L-GIu and 10% FCS (Sigma, St Louis MD, USA). Cells were split 48 hours before engraftment so that they were in exponential phase of growth. Five million KARPAS 299 cells were engrafted in PBS to 7 weeks old Nod/Scid mice (Charles River, France). Five days after implantation, tumors were measurable (32 mm 3 ⁇ V 3 ⁇ 49 mm 3 ) and animals were divided into groups of 6 mice with comparable tumor size. Mice were treated i.p. with a 2 mg/mouse loading dose of Mab 515H7.
- mice were injected twice a week at 1 mg/dose/mouse of Mab 515H7.
- a PBS group was introduced as a control group in this experiment.
- Tumor volume was measured twice a week and calculated by the formula: ⁇ /6 X length X width X height.
- Statistical analysis were performed at each measure using a Mann- Whitney test. In these experiments, no mortality was observed during treatment. Compared to
- HEK293/EBNA system with a pCEP4 expression vector (InVitrogen, US).
- the entire nucleotide sequences corresponding to the variable domains of 414H5 and 515H7 Mabs light and heavy chains were synthesized by global gene synthesis (Genecust, Germany). They were subcloned into a pCEP4 vector (InVitrogen, US) carrying the entire coding sequence of the constant domain of either the light [Ckappa] or the heavy [CHl-Hinge-CF ⁇ -CF ⁇ ] chain of a human IgGl immunoglobulin.
- Suspension-adapted HEK293 EBNA cells were routinely grown in 250 ml flasks in 50 ml of serum- free medium Excell 293 (SAFC Biosciences) supplemented with 6 mM glutamine on an orbital shaker (110 rpm rotation speed). Transient transfection was performed with 2.106 cells/ml using linear 25 kDa polyethyleneimine (PEI) (Polysciences) prepared in water at a final concentration of 1 mg/ml mixed and plasmid DNA (final concentration of 1.25 ⁇ g/ml for heavy to light chain plasmid ratio of 1 :1).
- PEI polyethyleneimine
- the culture was diluted with one volume of fresh culture medium to achieve a final cell density of 106 cells/ml. Cultivation process was monitored on the basis of cell viability and Mab production. Typically, cultures were maintained for 4 to 5 days. Mabs were purified using a conventional chromatography approach on a Protein A resin (GE Healthcare, US). All different Mabs were produced at levels suitable with functional evaluations. Productivity levels are typically ranging between 6 and 15 mg/1 of purified Mabs.
- NIH3T3, NIH3T3-hCXCR4 transfected cells and MDA-MB-231 cancer cell line were incubated with 10 ⁇ g/mL of monoclonal antibody c414H5 and c515H7.
- the cells were then washed with l%BSA/PBS/0.01% NaN3.
- Alexa- labeled secondary antibodies were added to the cells and were allowed to incubate at 4°C for 20 min. The cells were then washed again two times. Following the second wash, FACS analysis was performed.
- Example 19 Competition binding of anti-CXCR4 murine Mabs m414H5 and m515H7 and chimeric Mabs c414H5 and c515H7 for [ 125 I]SDF-I at CHO-Kl membranes stably expressing human CXCR4 receptor
- This assay allows to evaluate the ability of murine Mabs m414H5, m515H7 and chimeric Mabs c414H5, c515H7 to compete for binding of radio labeled [ 125 I]SDF-I to human CXCR4 receptor, at either orthosteric or allosteric binding sites.
- CHO-Kl cells, stably and constitutively expressing human CXCR4 receptor were obtained upon transfection of na ⁇ ve CHO-Kl cells (ATCC CCL-61) with a mammalian expression vector carrying the whole coding sequence of human CXCR4 receptor (RefSeq NM 003467).
- binding buffer [Hepes 2OmM, pH 7.4, CaCl 2 ImM, MgCl 2 5mM, NaCl 15OmM, BSA 1%] together with compound to evaluate (SDF-I or mAb), radioligand (1 nM) and finally SPA-WGA-PVT beads (7.3 mg/well). Binding equilibrium was reach after IH at 25°C. Upon centrifugation [1000 g for 10 min.] radioactive counts were measured in a scintillation counter (TopCount, Perkin Elmer). Non-specific (NS) binding was estimated in the presence of 10 ⁇ M of unlabelled SDF- 1.
- Anti-CXCR4 Mabs (100 nM) efficiently competed for [ 125 I]SDF-I binding with the following rank order of competition efficacy (% inhibition of [ 125 I]SDF-I): m515H7 (62 ⁇ 10%), C515H7 (55 ⁇ 4%), m414H5 (30 ⁇ 5%) and c414H5 (21 ⁇ 10 %) (Figure 17).
- Example 20 Modulation of [ 35 S]GTPyS binding at cellular membranes expressing wild type CXCR4 receptor by anti-CXCR4 murine Mabs m414H5 and m515H7 and chimeric Mabs c414H5 and c515H7
- This functional assay allows to monitor G protein activation via wild type human CXCR4 receptor and its modulation by anti-CXCR4 murine Mabs m414H5, m515H7 and chimeric Mabs c414H5, c515H7.
- NIH-3T3 cells stably and constitutively expressing wild-type CXCR4 receptor were obtained as described in the example above for CHO-Kl cells.
- HeLa (human cervix carcinoma) cells were propagated in complete culture medium [EMEM supplemented with 10% FCS, 1% L-glutamine, 2 ⁇ M sodium bicarbonate].
- EMEM complete culture medium
- FCS fetal bovine serum
- 1% L-glutamine 1% L-glutamine
- 2 ⁇ M sodium bicarbonate ⁇ M sodium bicarbonate
- [ 35 S]GTPyS binding was performed on cellular membranes obtained upon mechanical scrapping in lysis buffer [Hepes 2OmM, pH 7.4, NaCl 15OmM] and further centrifugation (10000 g, 15 min).
- IC50 of m414H5, c414H5, m515H7 and C515H7 Mabs, as determined in NIH3T3/CXCR4 cells were 1.6 nM, 1.1 nM, 1.9 nM and 1.5 nM, respectively ( Figure 18).
- the IC 50 of m414H5, c414H5, m515H7 and c515H7 Mabs determined using HeIa cells in the same experimental conditions were 0.5 nM, 0.3 nM, 0.2 nM and 0.6 nM, respectively ( Figure 19).
- Example 21 Association of CXCR4 with different interaction partners: homo and heterodimerization, recruitment of ⁇ -arrestin via a bioluminescence resonance energy transfer (BRET) approach and effect of murine Mabs m414H5, m515H7 and chimeric Mabs c414H5 and c515H7 on these dimmers
- BRET bioluminescence resonance energy transfer
- This functional assay allows to evaluate the conformational changes induced upon SDF-I and/or m414H5, m515H7 murine Mabs and c414H5, and c515H7 chimeric Mabs binding to CXCR4 receptor at the level of CXCR4 homo-dimer and CXCR2/CXCR4 hetero-dimer formation as well as the recruitment of the ⁇ -arrestin-2 signaling protein.
- Expression vectors for each of the investigated interaction partners were constructed as fusion proteins with the corresponding dye (Renilla reniformis luciferase, Rluc and Yellow fluorescent protein, YFP) by applying conventional molecular biology techniques.
- HEK293 cells were transiently transfected with expression vectors coding for the corresponding BRET partners: [CXCR4/Rluc + CXCR4/YFP] to study CXCR4 homo dimerization, [CXCR4- Rluc + CXCR2-YFP] to study CXCR4 and CXCR2 hetero-dimerization and [CXCR4- Rluc + ⁇ -arr2-YFP] to study CXCR4-mediated recruitment of ⁇ -arrestin-2.
- mBU milliBRET units
- SDFl 100 nM
- SDFl 100 nM
- SDFl increased by about 10 % the BRET signal resulting from the spatial proximity of the donor and acceptor proteins fused to CXCR4 receptor, it is likely to indicate CXCR4/CXCR4 homo-dimers formation or conformational changes of pre-existing dimers ( Figure 20A).
- m414H5, c414H5 and m515H7, c515H7 Mabs were able to modulate SDF-I -induced conformational changes for CXCR4 homo-dimers (75 % inhibition of SDF-1-induced BRET increase for c414H5 and 96% inhibition of SDF-1-induced BRET increase for c515H7, Figure 20A) as well as for CXCR2/CXCR4 hetero-dimer formation (77 % inhibition of SDF-1-induced BRET decrease for c414H5 and 98 % inhibition of SDF-1-induced BRET decrease for C515H7, Figure 20B).
- This functional assay was designed to monitor CXCR4 receptor signaling via stimulation of the phospholipase C pathway, inducing calcium liberation from intracellular stores from the endoplasmic reticulum.
- CHO-Kl cells stably and constitutively expressing wild-type CXCR4 receptor were obtained as described in the example above.
- U937 (human lymphoma) cells were propagated in complete culture medium, respectively [DMEM supplemented with 10% FCS] and [RPMI 1640 supplemented with 10% FCS, 20 mM HEPES, 1% non-essential amino acid solution, 1% sodium pyruvate, 1% L-glutamine, 4.5 g/1 glucose]. All cell types were plated in black 96MW plates at a density of 100,000 cells/well in appropriate culture medium. Cells were starved overnight before conducting the experiments.
- Fluorescence in each well is recorded during 0.1 second every second and for a time period of 20 sec prior SDF-I injection (basal signal). Then 20 ⁇ l of SDF-I are injected and data recording follows for a time period of 2 min. Each experimental condition is performed in duplicate. Values for each well are first corrected by substracting the basal fluorescence and the fluorescence emitted by a control well without cells. Relative data are expressed as a percentage of the maximal stimulation obtained by SDF-I (100 nM).
- Example 23 Effect of anti-CXCR4 murine Mabs m414H5, m515H7 and chimeric Mabs c414H5, c515H7 on SDF-1-induced U937 cells migration
- Example 24 Anti-CXCR4 chimeric Mabs c414H5 and c515H7 activity in U937 mice survival model
- U937 cells from ATCC were cultured in RPMI 1640 medium, 10% FCS, 1% L- Glutamine. Cells were split two days before engraftment so that they were in exponential phase of growth.
- Control mice received PBS injections as it has been shown in previous studies that no difference in survival was observed between mice injected with PBS and mice administered with a mouse IgG isotype control. Mice survival was monitored every day. Results described in figure 23 showed that mice treated with the c414H5 and c515H7 Mabs had a dramatic and significant increase in life span with T/C% about 210 and 180 for c414H5 and c515H7, respectively.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Biotechnology (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Physics & Mathematics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Oncology (AREA)
- Food Science & Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Plant Pathology (AREA)
- Pathology (AREA)
- General Chemical & Material Sciences (AREA)
- General Physics & Mathematics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Analytical Chemistry (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (26)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2011529559A JP5723279B2 (ja) | 2008-10-01 | 2009-10-01 | 抗cxcr4抗体および癌治療のためのそれらの使用 |
| RU2011115559/10A RU2573897C2 (ru) | 2008-10-01 | 2009-10-01 | Антитела к cxcr4 и их применение для лечения рака |
| DK09744645.4T DK2342233T3 (da) | 2008-10-01 | 2009-10-01 | Anti-CXCR4-antistoffer og anvendelse deraf i behandling af cancer |
| NZ592363A NZ592363A (en) | 2008-10-01 | 2009-10-01 | Anti cxcr4 antibodies and their use for the treatment of cancer |
| HRP20140899AT HRP20140899T1 (hr) | 2008-10-01 | 2009-10-01 | Anti-cxcr4 antitijela i njihova upotreba za lijeäśenje karcinoma |
| KR1020117009556A KR101671039B1 (ko) | 2008-10-01 | 2009-10-01 | 항 cxcr4 항체 및 그들의 암의 치료를 위한 용도 |
| ES09744645.4T ES2503732T3 (es) | 2008-10-01 | 2009-10-01 | Anticuerpos anti-CXCR4 nuevos y su utilización para el tratamiento del cáncer |
| MA33784A MA32928B1 (fr) | 2008-10-01 | 2009-10-01 | Anticorps anti-cxcr4 et leur utilisation pour le traitement du cancer |
| CA2738782A CA2738782C (en) | 2008-10-01 | 2009-10-01 | Anti cxcr4 antibodies and their use for the treatment of cancer |
| MX2011003509A MX2011003509A (es) | 2008-10-01 | 2009-10-01 | Anticuerpos anti-cxcr4 nuevos y su utilizacion para el tratamiento del cancer. |
| HK12103380.8A HK1163119B (en) | 2008-10-01 | 2009-10-01 | Anti cxcr4 antibodies and their use for the treatment of cancer |
| SI200931016T SI2342233T1 (sl) | 2008-10-01 | 2009-10-01 | Protitelesa proti CXCR4 in uporaba le-teh pri zdravljenju raka |
| AU2009299787A AU2009299787B2 (en) | 2008-10-01 | 2009-10-01 | Anti CXCR4 antibodies and their use for the treatment of cancer |
| RSP20140515 RS53578B1 (sr) | 2008-10-01 | 2009-10-01 | Antitela na cxcr4 i njihova upotreba za lečenje kancera |
| CN200980144491.4A CN102209730B (zh) | 2008-10-01 | 2009-10-01 | 抗cxcr4抗体及其用于治疗癌症的用途 |
| UAA201105412A UA102867C2 (uk) | 2008-10-01 | 2009-10-01 | Антитіла до cxcr4 та їх застосування у лікуванні раку |
| BRPI0920531-4A BRPI0920531A2 (pt) | 2008-10-01 | 2009-10-01 | anticorpos anti-cxcr4 e o uso dos mesmos para o tratamento de câncer |
| PL09744645T PL2342233T3 (pl) | 2008-10-01 | 2009-10-01 | Przeciwciała anty-CXCR4 i ich zastosowania do leczenia raka |
| EP09744645.4A EP2342233B1 (en) | 2008-10-01 | 2009-10-01 | Anti cxcr4 antibodies and their use for the treatment of cancer |
| US12/749,891 US8557964B2 (en) | 2008-10-01 | 2010-03-30 | Anti CXCR4 antibodies and their use for the treatment of cancer |
| TN2011000150A TN2011000150A1 (en) | 2009-10-01 | 2011-03-28 | Anti cxcr4 antibodies and their use for the treatment of cancer |
| IL212066A IL212066A (en) | 2008-10-01 | 2011-03-31 | 4cxcr antibodies, preparations containing them, processes for their production and selection and use for cancer treatment |
| ZA2011/02969A ZA201102969B (en) | 2008-10-01 | 2011-04-20 | Anti cxcr4 antibodies and their use for the treatment of cancer |
| US13/167,321 US20110294156A1 (en) | 2008-10-01 | 2011-06-23 | Novel anti cxcr4 antibodies and their use for the treatment of cancer |
| US13/167,329 US20110287451A1 (en) | 2008-10-01 | 2011-06-23 | Novel anti cxcr4 antibodies and their use for the treatment of cancer |
| US14/025,875 US9388248B2 (en) | 2008-10-01 | 2013-09-13 | Anti-CXCR4 antibodies and their use for the treatment of cancer |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13677208P | 2008-10-01 | 2008-10-01 | |
| EP08305631A EP2172485A1 (en) | 2008-10-01 | 2008-10-01 | Novel anti CXCR4 antibodies and their use for the treatment of cancer |
| US61/136,772 | 2008-10-01 | ||
| EP08305631.7 | 2008-10-01 | ||
| US17374309P | 2009-04-29 | 2009-04-29 | |
| US61/173,743 | 2009-04-29 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/749,891 Continuation-In-Part US8557964B2 (en) | 2008-10-01 | 2010-03-30 | Anti CXCR4 antibodies and their use for the treatment of cancer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010037831A1 true WO2010037831A1 (en) | 2010-04-08 |
Family
ID=40361774
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2009/062787 Ceased WO2010037831A1 (en) | 2008-10-01 | 2009-10-01 | Anti cxcr4 antibodies and their use for the treatment of cancer |
Country Status (28)
| Country | Link |
|---|---|
| US (4) | US8557964B2 (https=) |
| EP (2) | EP2172485A1 (https=) |
| JP (1) | JP5723279B2 (https=) |
| KR (1) | KR101671039B1 (https=) |
| CN (1) | CN102209730B (https=) |
| AR (1) | AR073748A1 (https=) |
| AU (1) | AU2009299787B2 (https=) |
| BR (1) | BRPI0920531A2 (https=) |
| CA (1) | CA2738782C (https=) |
| CL (1) | CL2011000730A1 (https=) |
| CY (1) | CY1115572T1 (https=) |
| DK (1) | DK2342233T3 (https=) |
| ES (1) | ES2503732T3 (https=) |
| GE (1) | GEP20146084B (https=) |
| HR (1) | HRP20140899T1 (https=) |
| IL (1) | IL212066A (https=) |
| MA (1) | MA32928B1 (https=) |
| MX (1) | MX2011003509A (https=) |
| NZ (1) | NZ592363A (https=) |
| PL (1) | PL2342233T3 (https=) |
| PT (1) | PT2342233E (https=) |
| RS (1) | RS53578B1 (https=) |
| RU (1) | RU2573897C2 (https=) |
| SI (1) | SI2342233T1 (https=) |
| TW (1) | TWI469792B (https=) |
| UA (1) | UA102867C2 (https=) |
| WO (1) | WO2010037831A1 (https=) |
| ZA (1) | ZA201102969B (https=) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012175576A1 (en) | 2011-06-20 | 2012-12-27 | Pierre Fabre Medicament | Anti-cxcr4 antibody with effector functions and its use for the treatment of cancer. |
| WO2013017566A1 (en) | 2011-07-29 | 2013-02-07 | Pierre Fabre Medicament | Novel anti-cxcr4 antibody and its use for the detection and diagnosis of cancer |
| WO2013017562A1 (en) | 2011-07-29 | 2013-02-07 | Pierre Fabre Medicament | Use of the antibody i-3859 for the detection and diagnosis of cancer |
| US20130174288A1 (en) * | 2009-04-29 | 2013-07-04 | Christine Klinguer-Hamour | Antibodies for the treatment of hiv |
| JP2014504147A (ja) * | 2010-10-27 | 2014-02-20 | ピエール、ファーブル、メディカマン | Hivの治療用抗体 |
| AU2011234458B2 (en) * | 2010-03-30 | 2015-02-12 | Pierre Fabre Medicament | Humanized anti CXCR4 antibodies for the treatment of cancer |
| WO2015015401A3 (en) * | 2013-08-02 | 2015-05-14 | Pfizer Inc. | Anti-cxcr4 antibodies and antibody-drug conjugates |
| WO2016201425A1 (en) | 2015-06-12 | 2016-12-15 | Bristol-Myers Squibb Company | Treatment of cancer by combined blockade of the pd-1 and cxcr4 signaling pathways |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2019175802A1 (en) | 2018-03-13 | 2019-09-19 | Fundación Para La Investigación Biomédica Del Hospital Universitario La Paz | Anti-cxcr4 antibody combined with activated and expanded natural killer cells for cancer immunotherapy |
| US10584354B2 (en) | 2013-09-23 | 2020-03-10 | Wilson Wolf Manufacturing | Methods of genetically modifying animal cells |
| US11492383B2 (en) | 2011-06-24 | 2022-11-08 | Stephen D. Gillies | Light chain immunoglobulin fusion proteins and methods of use thereof |
| WO2025049591A1 (en) * | 2023-08-28 | 2025-03-06 | Regeneron Pharmaceuticals, Inc. | Anti-cxcr4 antibodies and uses thereof |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL2010658C2 (en) * | 2013-04-18 | 2014-10-21 | Bosch Gmbh Robert | Thermostat for a hvac. |
| AR104413A1 (es) * | 2015-04-27 | 2017-07-19 | Pf Medicament | Anticuerpo de igf-1r y su utilización para diagnosticar cáncer |
| AU2016353553B2 (en) | 2015-11-09 | 2022-01-20 | The University Of British Columbia | Amyloid beta epitopes and antibodies thereto |
| EP3374381A4 (en) | 2015-11-09 | 2019-05-15 | The University Of British Columbia | EPITOPES IN THE AMYLOID-BETA MEDIUM REGION AND CONFORMITY-SELECTIVE ANTIBODIES THEREOF |
| US10973852B2 (en) | 2016-01-25 | 2021-04-13 | Nantcell, Inc. | NK cells with altered CXCL12/CXCR4 signaling |
| EP3467995A4 (en) * | 2016-05-25 | 2020-03-04 | Kabushiki Kaisha Toshiba | POWER MANAGEMENT DEVICE, MANAGEMENT SYSTEM, ELECTRICITY CONSUMPTION METHOD AND PROGRAM |
| US20180125920A1 (en) | 2016-11-09 | 2018-05-10 | The University Of British Columbia | Methods for preventing and treating A-beta oligomer-associated and/or -induced diseases and conditions |
| US20190389958A1 (en) * | 2017-01-31 | 2019-12-26 | Msm Protein Technologies, Inc. | Anti-cxcr4 antibodies |
| US12286469B2 (en) | 2017-07-18 | 2025-04-29 | The University Of British Columbia | Humanized antibodies binding to amyloid-beta (A-beta) |
| CN110804100A (zh) * | 2019-11-01 | 2020-02-18 | 中国人民解放军陆军特色医学中心 | 融合多肽及其在增强干细胞归巢能力和抗凋亡能力中的应用和药物组合物 |
| AR124414A1 (es) | 2020-12-18 | 2023-03-22 | Century Therapeutics Inc | Sistema de receptor de antígeno quimérico con especificidad de receptor adaptable |
| CN112661845B (zh) * | 2020-12-25 | 2022-06-21 | 暨南大学 | 与cxcr4结合的亲和力成熟结合蛋白及其应用 |
| CN112521500B (zh) * | 2020-12-25 | 2022-06-24 | 暨南大学 | 与cxcr4结合的亲和力成熟结合蛋白及应用 |
| CN117003876B (zh) * | 2023-08-31 | 2024-06-18 | 恺佧生物科技(上海)有限公司 | 一种Anti-CXCR4膜蛋白抗体及其制备方法和应用 |
Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4424200A (en) | 1979-05-14 | 1984-01-03 | Nuc Med Inc. | Method for radiolabeling proteins with technetium-99m |
| US4479930A (en) | 1982-07-26 | 1984-10-30 | Trustees Of The University Of Massachusetts | Amines coupled wth dicyclic dianhydrides capable of being radiolabeled product |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| EP0451261A1 (de) | 1989-11-01 | 1991-10-16 | Wella Ag | Mittel und verfahren zum bleichen von haaren unter lichteinwirkung. |
| EP0566647A1 (en) | 1990-12-19 | 1993-10-27 | Protein Design Labs, Inc. | Improved humanized immunoglobulins |
| EP0682040A1 (en) | 1988-12-28 | 1995-11-15 | Protein Design Labs, Inc. | Humanized immunoglobulins and their production and use |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
| US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| WO2004059285A2 (en) | 2002-12-23 | 2004-07-15 | Protein Design Labs, Inc. | Tumor killing/tumor regression using cxcr4 antagonists |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6949243B1 (en) * | 1999-11-24 | 2005-09-27 | Schering Corporation | Methods of inhibiting metastasis |
| WO2006086883A1 (en) * | 2005-02-16 | 2006-08-24 | Universite De Montreal | Biosensors for monitoring receptor-mediated g-protein activation |
| WO2006089141A2 (en) * | 2005-02-18 | 2006-08-24 | Dana-Farber Cancer Institute | Antibodies against cxcr4 and methods of use thereof |
| CN102027015A (zh) * | 2008-05-14 | 2011-04-20 | 伊莱利利公司 | 抗cxcr4抗体 |
-
2008
- 2008-10-01 EP EP08305631A patent/EP2172485A1/en not_active Withdrawn
-
2009
- 2009-09-30 TW TW98133164A patent/TWI469792B/zh not_active IP Right Cessation
- 2009-10-01 NZ NZ592363A patent/NZ592363A/xx not_active IP Right Cessation
- 2009-10-01 CN CN200980144491.4A patent/CN102209730B/zh not_active Expired - Fee Related
- 2009-10-01 HR HRP20140899AT patent/HRP20140899T1/hr unknown
- 2009-10-01 SI SI200931016T patent/SI2342233T1/sl unknown
- 2009-10-01 EP EP09744645.4A patent/EP2342233B1/en active Active
- 2009-10-01 BR BRPI0920531-4A patent/BRPI0920531A2/pt not_active IP Right Cessation
- 2009-10-01 AR ARP090103802A patent/AR073748A1/es unknown
- 2009-10-01 GE GEAP200912211A patent/GEP20146084B/en unknown
- 2009-10-01 ES ES09744645.4T patent/ES2503732T3/es active Active
- 2009-10-01 WO PCT/EP2009/062787 patent/WO2010037831A1/en not_active Ceased
- 2009-10-01 PL PL09744645T patent/PL2342233T3/pl unknown
- 2009-10-01 JP JP2011529559A patent/JP5723279B2/ja not_active Expired - Fee Related
- 2009-10-01 DK DK09744645.4T patent/DK2342233T3/da active
- 2009-10-01 MX MX2011003509A patent/MX2011003509A/es active IP Right Grant
- 2009-10-01 MA MA33784A patent/MA32928B1/fr unknown
- 2009-10-01 PT PT97446454T patent/PT2342233E/pt unknown
- 2009-10-01 CA CA2738782A patent/CA2738782C/en not_active Expired - Fee Related
- 2009-10-01 UA UAA201105412A patent/UA102867C2/uk unknown
- 2009-10-01 RU RU2011115559/10A patent/RU2573897C2/ru not_active IP Right Cessation
- 2009-10-01 AU AU2009299787A patent/AU2009299787B2/en not_active Ceased
- 2009-10-01 RS RSP20140515 patent/RS53578B1/sr unknown
- 2009-10-01 KR KR1020117009556A patent/KR101671039B1/ko not_active Expired - Fee Related
-
2010
- 2010-03-30 US US12/749,891 patent/US8557964B2/en not_active Expired - Fee Related
-
2011
- 2011-03-31 IL IL212066A patent/IL212066A/en not_active IP Right Cessation
- 2011-04-01 CL CL2011000730A patent/CL2011000730A1/es unknown
- 2011-04-20 ZA ZA2011/02969A patent/ZA201102969B/en unknown
- 2011-06-23 US US13/167,329 patent/US20110287451A1/en not_active Abandoned
- 2011-06-23 US US13/167,321 patent/US20110294156A1/en not_active Abandoned
-
2013
- 2013-09-13 US US14/025,875 patent/US9388248B2/en not_active Expired - Fee Related
-
2014
- 2014-09-24 CY CY20141100778T patent/CY1115572T1/el unknown
Patent Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4424200A (en) | 1979-05-14 | 1984-01-03 | Nuc Med Inc. | Method for radiolabeling proteins with technetium-99m |
| US4479930A (en) | 1982-07-26 | 1984-10-30 | Trustees Of The University Of Massachusetts | Amines coupled wth dicyclic dianhydrides capable of being radiolabeled product |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| EP0939127A2 (en) | 1988-12-28 | 1999-09-01 | Protein Design Labs, Inc. | Humanized immunoglobulins and their production and use |
| EP0682040A1 (en) | 1988-12-28 | 1995-11-15 | Protein Design Labs, Inc. | Humanized immunoglobulins and their production and use |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| EP0451261A1 (de) | 1989-11-01 | 1991-10-16 | Wella Ag | Mittel und verfahren zum bleichen von haaren unter lichteinwirkung. |
| US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
| EP0566647A1 (en) | 1990-12-19 | 1993-10-27 | Protein Design Labs, Inc. | Improved humanized immunoglobulins |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| WO2004059285A2 (en) | 2002-12-23 | 2004-07-15 | Protein Design Labs, Inc. | Tumor killing/tumor regression using cxcr4 antagonists |
Non-Patent Citations (48)
| Title |
|---|
| "Data sheet of monoclonal antibody MAB173- anti CXCR4", INTERNET CITATION, XP002458711, Retrieved from the Internet <URL:http://www.rndsystems.com/pdf/mab173.pdf> [retrieved on 20071113] * |
| "Therapeutic chemistry, vol. 6, Antitumor drugs and perspectives in the treatment of cancer", 2003, FRENCH ASSOCIATION OF THERAPEUTIC CHEMISTRY TEACHERS |
| ANGERS ET AL., PNAS, vol. 97, 2000, pages 3684 - 89 |
| BARIBAUD ET AL., J. VIROL., vol. 75, no. 19, 2001, pages 8957 - 8967 |
| BARIBAUD FREDERIC ET AL: "Antigenically distinct conformations of CXCR4", JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 75, no. 19, 1 October 2001 (2001-10-01), pages 8957 - 8967, XP002234668, ISSN: 0022-538X * |
| BEBBINGTON ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 169 - 175 |
| BES ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 343, no. 1, 2006, pages 334 - 344 |
| BES ET AL., FEBS LETTERS, vol. 508, 2001, pages 67 - 74 |
| CARNEC ET AL., J VIROL, vol. 79, no. 3, 2005, pages 1930 - 1933 |
| CARNEC XAVIER ET AL: "Anti-CXCR4 monoclonal antibodies recognizing overlapping epitopes differ significantly in their ability to inhibit entry of human immunodeficiency virus type 1.", JOURNAL OF VIROLOGY FEB 2005, vol. 79, no. 3, February 2005 (2005-02-01), pages 1930 - 1933, XP002518542, ISSN: 0022-538X * |
| GLENNIE MJ ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375 |
| HOLLINGER; BOHLEN, CANCER AND METASTASIS, REV., vol. 18, 1999, pages 411 - 419 |
| HUNTER W.M.; GREENWOOD F.C., NATURE, vol. 194, 1962, pages 495 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KAAS, Q.; LEFRANC, M.-P., CURRENT BIOINFORMATICS, vol. 2, 2007, pages 21 - 30 |
| KAAS, Q.; RUIZ, M.; LEFRANC, M.-P.: "T cell receptor and MHC structural data", NUCL. ACIDS. RES., vol. 32, 2004, pages D208 - D210 |
| KABAT ET AL.: "Sequences of proteins of immunological interest 5th Ed.,", 1991, NIH |
| KOHL ET AL., PNAS, vol. 100, no. 4, 2003, pages 1700 - 1705 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| LEFRANC M.-P., IMMUNOLOGY TODAY, vol. 18, 1997, pages 509 |
| LEFRANC M.-P., THE IMMUNOLOGIST, vol. 7, 1999, pages 132 - 136 |
| LEFRANC, M.-P.; POMMIE, C.; RUIZ, M.; GIUDICELLI, V.; FOULQUIER, E.; TRUONG, L.; THOUVENIN-CONTET, V.; LEFRANC, DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77 |
| MERCHAND ET AL., NATURE BIOTECH., vol. 16, 1998, pages 677 - 681 |
| MOUNTAIN ET AL., BIOTECHNOL. GENET. ENG. REV., vol. 10, 1992, pages 1 - 142 |
| NEDDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NICAISE ET AL., PROTEIN SCIENCE, vol. 13, no. 7, 2004, pages 1882 - 1891 |
| OTTAIANO ALESSANDRO ET AL: "Inhibitory effects of anti-CXCR4 antibodies on human colon cancer cells", CANCER IMMUNOLOGY AND IMMUNOTHERAPY, SPRINGER-VERLAG, BERLIN, DE, vol. 54, no. 8, 11 December 2004 (2004-12-11), pages 781 - 791, XP002397864, ISSN: 0340-7004 * |
| OTTAIANO ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 54, no. 8, 2005, pages 781 - 791 |
| PARK ET AL., MOL. IMMUNOL., vol. 37, no. 18, 2000, pages 1123 - 30 |
| PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PERCHERANCIER YANN ET AL: "Bioluminescence resonance energy transfer reveals ligand-induced conformational changes in CXCR4 homo- and heterodimers", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY OF BIOLOCHEMICAL BIOLOGISTS, BIRMINGHAM,; US, vol. 280, no. 11, 1 March 2005 (2005-03-01), pages 9895 - 9903, XP002511383, ISSN: 0021-9258, [retrieved on 20050104] * |
| REEVES J D ET AL: "The second extracellular loop of CXCR4 is involved in CD4-independent entry of human immunodeficiency virus type 2", JOURNAL OF GENERAL VIROLOGY, SOCIETY FOR GENERAL MICROBIOLOGY, SPENCERS WOOD, GB, vol. 79, no. 7, 1 January 1998 (1998-01-01), pages 1793 - 1799, XP002290004, ISSN: 0022-1317 * |
| REEVS ET AL., J GEN VIROL., vol. 79, 1998, pages 1793 - 1799 |
| REPP R. ET AL., J. HEMAT., 1995, pages 377 - 382 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RUIZ, M.; LEFRANC, M.-P., IMMUNOGENETICS, vol. 53, 2002, pages 857 - 883 |
| SAMBROOK ET AL.: "Molecular cloning: a laboratory manual", 2001, COLD SPRING HARBOR LABORATORY |
| SAMBROOK; RUSSEL: "Laboratory manual", 2001 |
| SINGER ET AL., J. IMMUN., vol. 150, 1992, pages 2844 - 2857 |
| SKERRA A., J. BIOTECHNOL., vol. 74, no. 4, 2001, pages 257 - 75 |
| SKERRA A., J. MOL. RECOGN., vol. 13, 2000, pages 167 - 187 |
| SMITH; WATERMAN, AD. APP. MATH., vol. 2, 1981, pages 482 |
| STAERZ U.D.; BEVAN M.J., PNAS, vol. 83, 1986, pages 1453 - 1457 |
| STEWARD ET AL.: "Solid phase peptides synthesis", 1984, PIERCE CHEM. COMPANY |
| SURESH M.R. ET AL., METHOD ENZYMOL., vol. 121, 1986, pages 210 - 228 |
| TATUSOVA ET AL.: "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS MICROBIOL., 1999, LETT., vol. 174, 1999, pages 247 - 250, Retrieved from the Internet <URL:http://www.ncbi.nlm.nih.gov/gorf/bl2.html> |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VERHOEYN ET AL., BIOESSAYS, vol. 8, 1988, pages 74 |
Cited By (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130174288A1 (en) * | 2009-04-29 | 2013-07-04 | Christine Klinguer-Hamour | Antibodies for the treatment of hiv |
| AU2011234458B2 (en) * | 2010-03-30 | 2015-02-12 | Pierre Fabre Medicament | Humanized anti CXCR4 antibodies for the treatment of cancer |
| JP2014504147A (ja) * | 2010-10-27 | 2014-02-20 | ピエール、ファーブル、メディカマン | Hivの治療用抗体 |
| AU2012274104B2 (en) * | 2011-06-20 | 2017-06-15 | Pierre Fabre Medicament | Anti-CXCR4 antibody with effector functions and its use for the treatment of cancer. |
| CN103649120A (zh) * | 2011-06-20 | 2014-03-19 | 皮埃尔法布雷医药公司 | 具有效应功能的抗cxcr4抗体及其用于治疗癌症的用途 |
| JP2014525899A (ja) * | 2011-06-20 | 2014-10-02 | ピエール、ファーブル、メディカマン | エフェクター機能を有する抗cxcr4抗体および癌治療のためのその使用 |
| WO2012175576A1 (en) | 2011-06-20 | 2012-12-27 | Pierre Fabre Medicament | Anti-cxcr4 antibody with effector functions and its use for the treatment of cancer. |
| US11492383B2 (en) | 2011-06-24 | 2022-11-08 | Stephen D. Gillies | Light chain immunoglobulin fusion proteins and methods of use thereof |
| WO2013017566A1 (en) | 2011-07-29 | 2013-02-07 | Pierre Fabre Medicament | Novel anti-cxcr4 antibody and its use for the detection and diagnosis of cancer |
| WO2013017562A1 (en) | 2011-07-29 | 2013-02-07 | Pierre Fabre Medicament | Use of the antibody i-3859 for the detection and diagnosis of cancer |
| US9518120B2 (en) | 2011-07-29 | 2016-12-13 | Pierrre Fabre Medicament | Anti-CXCR4 antibody and its use for the detection and diagnosis of cancer |
| TWI671317B (zh) * | 2013-08-02 | 2019-09-11 | 輝瑞大藥廠 | 抗cxcr4抗體及抗體-藥物結合物 |
| AU2014298040B2 (en) * | 2013-08-02 | 2018-04-26 | Pfizer Inc. | Anti-CXCR4 antibodies and antibody-drug conjugates |
| US9708405B2 (en) | 2013-08-02 | 2017-07-18 | Pfizer Inc. | Anti-CXCR4 antibodies and antibody-drug conjugates |
| KR101809072B1 (ko) * | 2013-08-02 | 2017-12-14 | 화이자 인코포레이티드 | 항-cxcr4 항체 및 항체-약물 접합체 |
| WO2015015401A3 (en) * | 2013-08-02 | 2015-05-14 | Pfizer Inc. | Anti-cxcr4 antibodies and antibody-drug conjugates |
| EP4050033A1 (en) * | 2013-08-02 | 2022-08-31 | Pfizer Inc. | Anti-cxcr4 antibodies and antibody-drug conjugates |
| CN113683695A (zh) * | 2013-08-02 | 2021-11-23 | 辉瑞公司 | 抗cxcr4抗体及抗体-药物缀合物 |
| CN106211774B (zh) * | 2013-08-02 | 2020-11-06 | 辉瑞公司 | 抗cxcr4抗体及抗体-药物缀合物 |
| TWI623551B (zh) * | 2013-08-02 | 2018-05-11 | 輝瑞大藥廠 | 抗cxcr4抗體及抗體-藥物結合物 |
| KR20180118246A (ko) * | 2013-08-02 | 2018-10-30 | 화이자 인코포레이티드 | 항-cxcr4 항체 및 항체-약물 접합체 |
| US10144781B2 (en) | 2013-08-02 | 2018-12-04 | Pfizer Inc. | Anti-CXCR4 antibodies and antibody-drug conjugates |
| RU2675516C2 (ru) * | 2013-08-02 | 2018-12-19 | Пфайзер Инк. | Anti-cxcr4 антитела и конъюгаты антитело-лекарство |
| AU2017268595B2 (en) * | 2013-08-02 | 2019-08-22 | Pfizer Inc. | Anti-CXCR4 antibodies and antibody-drug conjugates |
| CN106211774A (zh) * | 2013-08-02 | 2016-12-07 | 辉瑞公司 | 抗cxcr4抗体及抗体‑药物缀合物 |
| IL243900B (en) * | 2013-08-02 | 2021-10-31 | Pfizer | Antibodies to cxcr4 and their conjugates with drugs |
| KR102048718B1 (ko) * | 2013-08-02 | 2019-11-26 | 화이자 인코포레이티드 | 항-cxcr4 항체 및 항체-약물 접합체 |
| US10584354B2 (en) | 2013-09-23 | 2020-03-10 | Wilson Wolf Manufacturing | Methods of genetically modifying animal cells |
| WO2016201425A1 (en) | 2015-06-12 | 2016-12-15 | Bristol-Myers Squibb Company | Treatment of cancer by combined blockade of the pd-1 and cxcr4 signaling pathways |
| WO2017220988A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Multispecific antibodies for immuno-oncology |
| WO2017220989A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 and il-2 cytokines |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2019175802A1 (en) | 2018-03-13 | 2019-09-19 | Fundación Para La Investigación Biomédica Del Hospital Universitario La Paz | Anti-cxcr4 antibody combined with activated and expanded natural killer cells for cancer immunotherapy |
| WO2025049591A1 (en) * | 2023-08-28 | 2025-03-06 | Regeneron Pharmaceuticals, Inc. | Anti-cxcr4 antibodies and uses thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2009299787B2 (en) | Anti CXCR4 antibodies and their use for the treatment of cancer | |
| EP2552963B1 (en) | Humanized anti cxcr4 antibodies for the treatment of cancer | |
| AU2007324509B2 (en) | Novel antiproliferation antibodies | |
| HK1163119B (en) | Anti cxcr4 antibodies and their use for the treatment of cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200980144491.4 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09744645 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2738782 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011529559 Country of ref document: JP Ref document number: 12011500665 Country of ref document: PH |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011000730 Country of ref document: CL Ref document number: MX/A/2011/003509 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11042011 Country of ref document: CO Ref document number: 11042011A Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009299787 Country of ref document: AU Ref document number: 592363 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009744645 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3042/DELNP/2011 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20117009556 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2011000300 Country of ref document: DZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12211/1 Country of ref document: GE |
|
| WWE | Wipo information: entry into national phase |
Country of ref document: UA Ref document number: a201105412 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011115559 Country of ref document: RU |
|
| ENP | Entry into the national phase |
Ref document number: 2009299787 Country of ref document: AU Date of ref document: 20091001 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2014/0515 Country of ref document: RS |
|
| ENP | Entry into the national phase |
Ref document number: PI0920531 Country of ref document: BR Kind code of ref document: A2 Effective date: 20110401 |