WO2010009987A2 - Diagnostic antibody assay - Google Patents

Diagnostic antibody assay Download PDF

Info

Publication number
WO2010009987A2
WO2010009987A2 PCT/EP2009/058803 EP2009058803W WO2010009987A2 WO 2010009987 A2 WO2010009987 A2 WO 2010009987A2 EP 2009058803 W EP2009058803 W EP 2009058803W WO 2010009987 A2 WO2010009987 A2 WO 2010009987A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
disease
alzheimer
amyloid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2009/058803
Other languages
English (en)
French (fr)
Other versions
WO2010009987A3 (en
Inventor
Hans-Ulrich Demuth
Stephan Schilling
Martin Kleinschmidt
Kathrin Gans
Anita Reisenauer-Schaupp
Jens-Ulrich Rahfeld
Sonja Kampfer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Vivoryon Therapeutics AG
Original Assignee
Probiodrug AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP09780421.5A priority Critical patent/EP2320942B1/en
Priority to NZ590563A priority patent/NZ590563A/en
Priority to EA201100231A priority patent/EA028427B1/ru
Priority to JP2011519110A priority patent/JP5828762B2/ja
Priority to CN200980132674.4A priority patent/CN102131519B/zh
Priority to BRPI0916366-2A priority patent/BRPI0916366B1/pt
Priority to KR1020117003879A priority patent/KR101706789B1/ko
Priority to MX2011000875A priority patent/MX2011000875A/es
Priority to AU2009273387A priority patent/AU2009273387B9/en
Application filed by Probiodrug AG filed Critical Probiodrug AG
Priority to CA2731044A priority patent/CA2731044C/en
Priority to HK11113456.7A priority patent/HK1158946B/xx
Publication of WO2010009987A2 publication Critical patent/WO2010009987A2/en
Publication of WO2010009987A3 publication Critical patent/WO2010009987A3/en
Priority to IL210225A priority patent/IL210225A/en
Priority to ZA2011/00178A priority patent/ZA201100178B/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
    • G01N2333/47Assays involving proteins of known structure or function as defined in the subgroups
    • G01N2333/4701Details
    • G01N2333/4709Amyloid plaque core protein
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2814Dementia; Cognitive disorders
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2814Dementia; Cognitive disorders
    • G01N2800/2821Alzheimer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/38Pediatrics
    • G01N2800/385Congenital anomalies
    • G01N2800/387Down syndrome; Trisomy 18; Trisomy 13

Definitions

  • the present invention pertains to novel diagnostic assays for the diagnosis of amyloidosis, a group of disorders and abnormalities associated with amyloid protein such as Alzheimer's disease and related aspects.
  • an antibody assay is provided.
  • Amyloidosis is not a single disease entity but rather a diverse group of progressive disease processes characterized by extracellular tissue deposits of a waxy, starch-like protein called amyloid, which accumulates in one or more organs or body systems. As the amyloid deposits accumulate, they begin to interfere with the normal function of the organ or body system. There are at least 15 different types of amyloidosis. The major forms are primary amyloidosis without known antecedent, secondary amyloidosis following some other condition, and hereditary amyloidosis.
  • Secondary amyloidosis occurs during chronic infection or inflammatory disease, such as tuberculosis, a bacterial infection called familial Mediterranean fever, bone infections (osteomyelitis) , rheumatoid arthritis, inflammation of the small intestine (granulomatous ileitis), Hodgkin's disease and leprosy.
  • inflammatory disease such as tuberculosis, a bacterial infection called familial Mediterranean fever, bone infections (osteomyelitis) , rheumatoid arthritis, inflammation of the small intestine (granulomatous ileitis), Hodgkin's disease and leprosy.
  • Amyloid deposits include amyloid P (pentagonal) component (AP) , a glycoprotein related to normal serum amyloid P (SAP) , and sulphated glycosaminoglycans (GAG) , complex carbohydrates of connective tissue.
  • Amyloid protein fibrils which account for about 90% of the amyloid material, comprise one of several different types of proteins. These proteins are capable of folding into so-called “beta-pleated” sheet fibrils, a unique protein configuration which exhibits binding sites for Congo red resulting in the unique staining properties of the amyloid protein .
  • diseases of aging are based on or associated with amyloid- like proteins and are characterized, in part, by the buildup of extracellular deposits of amyloid or amyloid-like material that contribute to the pathogenesis, as well as the progression of the disease.
  • diseases include, but are not limited to, neurological disorders such as mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia
  • FDD Alzheimer's disease
  • Lewy body dementia Lewy body dementia
  • hereditary cerebral hemorrhage with amyloidosis Dutch type
  • Other diseases which are based on or associated with amyloid-like proteins are progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotropic lateral sclerosis), Adult Onset Diabetes; senile cardiac amyloidosis; endocrine tumors, and others, including macular degeneration.
  • pathogenesis of these diseases may be diverse, their characteristic deposits often contain many shared molecular constituents. To a significant degree, this may be attributable to the local activation of pro-inflammatory pathways thereby leading to the concurrent deposition of activated complement components, acute phase reactants, immune modulators, and other inflammatory mediators (McGeer et al . , Tohoku J Exp Med. 174(3) : 269-277 (1994) ) .
  • Aiming biopsies display a presence of A ⁇ 1-40 and A ⁇ 1-42 not only in the brain of Alzheimer's patients but also in senile plaques of unaffected individuals.
  • N-terminal truncated and pyroGlu modified A ⁇ N3pE-40/A ⁇ N3pE-42 is almost exclusively engrained within plaques of Alzheimer's disease patients, making this A ⁇ variant an eligible diagnostic marker and a potential target for drug development.
  • several commercial manufacturers offer ELISA kits which allow a detection of A ⁇ 1-40 / 1-42 and A ⁇ N3pE-40/A ⁇ N3pE- 42 in the low picogramm (pg) range.
  • AD Alzheimer's disease
  • a ⁇ peptides are liberated from the amyloid precursor protein (APP) after sequential cleavage by ⁇ - and ⁇ -secretase.
  • the ⁇ -secretase cleavage results in the generation of A ⁇ 1-40 and A ⁇ 1-42 peptides, which differ in their C-termini and exhibit different potencies of aggregation, fibril formation and neurotoxicity (Shin, R. W. et al .
  • Amyloid beta-protein (Abeta) 1-40 but not Abeta 1-42 contributes to the experimental formation of Alzheimer disease amyloid fibrils in rat brain. J. Neurosci.
  • Alzheimer's disease the amyloid cascade hypothesis. Science 256, 184-185 (1992); Ro ⁇ ner, S., Ueberham, U., Sch Kunststoffs, R., Perez-Polo, J. R. & Bigl, V. The regulation of amyloid precursor protein metabolism by cholinergic mechanisms and neurotrophin receptor signaling. Prog. Neurobiol. 56, 541-569 (1998)) .
  • N-terminally modified A ⁇ peptides are abundant (Saido, T. C. et al . Dominant and differential deposition of distinct beta-amyloid peptide species, A beta N3 (pE) , in senile plaques. Neuron 14, 457-466
  • a ⁇ 3(pE)-42 peptides (Saido, T. C. et al. Dominant and differential deposition of distinct beta-amyloid peptide species, A beta N3(pE), in senile plaques. Neuron 14, 457-466 (1995) ; Saido, T. C, Yamao, H., Iwatsubo, T. & Kawashima, S. Amino- and carboxyl-terminal heterogeneity of beta-amyloid peptides deposited in human brain. Neurosci. Lett. 215, 173-176 (1996)) .
  • pE may be formed following ⁇ ' -cleavage by BACEl, resulting in A ⁇ Nll(pE)-42 (Naslund, J. et al . Relative abundance of Alzheimer A beta amyloid peptide variants in Alzheimer disease and normal aging. Proc. Natl. Acad. Sci. U. S. A. 91, 8378-8382 (1994); Liu, K. et al . Characterization of Abetall- 40/42 peptide deposition in Alzheimer's disease and young Down's syndrome brains: implication of N-terminally truncated Abeta species in the pathogenesis of Alzheimer's disease. Acta Neuropathol. 112, 163-174 (2006)) .
  • a ⁇ N3 (pE) -42 has been shown to be a major constituent of A ⁇ deposits in sporadic and familial Alzheimer's disease (FAD) (Saido, T. C. et al . Dominant and differential deposition of distinct beta-amyloid peptide species, A beta N3 (pE) , in senile plaques. Neuron 14, 457-466 (1995) ; Miravalle, L. et al . Amino-terminally truncated Abeta peptide species are the main component of cotton wool plaques. Biochemistry 44, 10810-10821 (2005)) .
  • the A ⁇ N3pE-42 peptides coexist with A ⁇ 1-40/1-42 peptides (Saido, T. C. et al . Dominant and differential deposition of distinct beta-amyloid peptide species, Abeta N3pE, in senile plaques. Neuron 14, 457-466 (1995) ; Saido, T. C, Yamao, H., Iwatsubo, T. & Kawashima, S. Amino- and carboxyl-terminal heterogeneity of beta-amyloid peptides deposited in human brain. Neurosci. Lett.
  • a ⁇ N3pE-42 peptides has been outlined (Russo, C. et al . Pyroglutamate- modified amyloid beta-peptides--AbetaN3 (pE) --strongly affect cultured neuron and astrocyte survival. J. Neurochem. 82, 1480- 1489 (2002) and the pE-modification of N-truncated A ⁇ peptides confers resistance to degradation by most aminopeptidases as well as A ⁇ -degrading endopeptidases (Russo, C. et al.
  • glutaminyl cyclase is capable to catalyze A ⁇ N3pE-42 formation under mildly acidic conditions and that specific QC inhibitors prevent A ⁇ N3pE-42 generation in vitro (Schilling, S., Hoffmann, T., Manhart, S., Hoffmann, M. & Demuth, H. -U. Glutaminyl cyclases unfold glutamyl cyclase activity under mild acid conditions. FEBS Lett. 563, 191-196 (2004) ; Cynis, H. et al . Inhibition of glutaminyl cyclase alters pyroglutamate formation in mammalian cells. Biochim. Biophys . Acta 1764, 1618- 1625 (2006) ) .
  • Lewy body dementia is a neurodegenerative disorder that can occur in persons older than 65 years of age, and typically causes symptoms of cognitive (thinking) impairment and abnormal behavioral changes. Symptoms can include cognitive impairment, neurological signs, sleep disorder, and autonomic failure. Cognitive impairment is the presenting feature of LBD in most cases. Patients have recurrent episodes of confusion that progressively worsen. The fluctuation in cognitive ability is often associated with shifting degrees of attention and alertness. Cognitive impairment and fluctuations of thinking may vary over minutes, hours, or days. Lewy bodies are formed from phosphorylated and nonphosphorylated neurofilament proteins; they contain the synaptic protein alpha-synuclein as well as ubiquitin, which is involved in the elimination of damaged or abnormal proteins.
  • Lewy neurites which are inclusion bodies in the cell processes of the nerve cells, may also be present.
  • Amyloid plaques may form in the brains of patients afflicted with DLB, however they tend to be fewer in number than seen in patients with Alzheimer's disease.
  • Neurofibrillary tangles the other micropathological hallmark of AD, are not a main characteristic of LBD but are frequently present in addition to amyloid plaques.
  • Amyotrophic lateral sclerosis (ALS) is characterized by degeneration of upper and lower motor neurons. In some ALS patients, dementia or aphasia may be present (ALS-D) . The dementia is most commonly a frontotemporal dementia (FTD) , and many of these cases have ubiquitin- positive, tau-negative inclusions in neurons of the dentate gyrus and superficial layers of the frontal and temporal lobes.
  • FTD frontotemporal dementia
  • IBM Inclusion-body myositis
  • Macular degeneration is a common eye disease that causes deterioration of the macula, which is the central area of the retina (the paper-thin tissue at the back of the eye where light-sensitive cells send visual signals to the brain) . Sharp, clear, "straight ahead " vision is processed by the macula. Damage to the macula results in the development of blind spots and blurred or distorted vision.
  • Age-related macular degeneration (AMD) is a major cause of visual impairment in the United States and for people over age 65 it is the leading cause of legal blindness among Caucasians.
  • macular degeneration There are two forms of macular degeneration: dry macular degeneration and wet macular degeneration.
  • dry form in which the cells of the macula slowly begin to break down, is diagnosed in 85 percent of macular degeneration cases. Both eyes are usually affected by dry AMD, although one eye can lose vision while the other eye remains unaffected. Drusen, which are yellow deposits under the retina, are common early signs of dry AMD.
  • Drusen which are yellow deposits under the retina, are common early signs of dry AMD.
  • the risk of developing advanced dry AMD or wet AMD increases as the number or size of the drusen increases. It is possible for dry AMD to advance and cause loss of vision without turning into the wet form of the disease; however, it is also possible for early-stage dry AMD to suddenly change into the wet form.
  • the wet form although it only accounts for 15 percent of the cases, results in 90 percent of the blindness, and is considered advanced AMD (there is no early or intermediate stage of wet AMD) .
  • Wet AMD is always preceded by the dry form of the disease. As the dry form worsens, some people begin to have abnormal blood vessels growing behind the macula. These vessels are very fragile and will leak fluid and blood (hence 'wet' macular degeneration), causing rapid damage to the macula.
  • the dry form of AMD will initially often cause slightly blurred vision. The center of vision in particular may then become blurred and this region grows larger as the disease progresses. No symptoms may be noticed if only one eye is affected. In wet AMD, straight lines may appear wavy and central vision loss can occur rapidly.
  • Diagnosis of macular degeneration typically involves a dilated eye exam, visual acuity test, and a viewing of the back of the eye using a procedure called fundoscopy to help diagnose AMD, and — if wet AMD is suspected — fluorescein angiography may also be performed. If dry AMD reaches the advanced stages, there is no current treatment to prevent vision loss. However, a specific high dose formula of antioxidants and zinc may delay or prevent intermediate AMD from progressing to the advanced stage.
  • Macugen® pegaptanib sodium injection
  • laser photocoagulation and photodynamic therapy can control the abnormal blood vessel growth and bleeding in the macula, which is helpful for some people who have wet AMD; however, vision that is already lost will not be restored by these techniques. If vision is already lost, low vision aids exist that can help improve the quality of life.
  • ATD age-related macular degeneration
  • RPE retinal pigmented epithelium
  • BM Bruch's membrane
  • the aim of the present invention is to establish a highly sensitive and concomitantly robust detection technique that allows quantitative determination of A ⁇ variants, in particular pGlu-A ⁇ peptides, in biological samples, e.g. liquor or serum samples, preferably serum samples. This is a tremendous challenge, taking the low abundance of A ⁇ peptides in blood into account. Having such a detection technique available is, however, a prerequisite for studying efficacy of small molecule inhibitors in drug screening programs.
  • the present invention provides novel methods and compositions comprising highly specific and highly effective antibodies, including chimeric antibodies and fragments thereof, including partially or fully humanized antibodies and fragments thereof, having the ability to specifically recognize and bind to specific epitopes from a range of ⁇ -amyloid antigens, in particular pGlu-A ⁇ peptides, which may be presented to the antibody in a monomeric, dimeric, trimeric, etc, or a polymeric form, in form of an aggregate, fibers, filaments or in the condensed form of a plaque.
  • highly specific and highly effective antibodies including chimeric antibodies and fragments thereof, including partially or fully humanized antibodies and fragments thereof, having the ability to specifically recognize and bind to specific epitopes from a range of ⁇ -amyloid antigens, in particular pGlu-A ⁇ peptides, which may be presented to the antibody in a monomeric, dimeric, trimeric, etc, or a polymeric form, in form of an aggregate, fibers, filaments or in the condensed form of
  • the antibodies enabled by the teaching of the present invention are particularly useful for diagnosis of amyloidosis, a group of diseases and disorders associated with amyloid plaque formation including secondary amyloidosis and age-related amyloidosis including, but not limited to, neurological disorders such as Alzheimer's Disease (AD), Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type); the Guam Parkinson- Dementia complex; as well as other diseases which are based on or associated with amyloid-like proteins such as progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, hereditary cerebral hemorrhage with amyloidosis Dutch type, Parkinson's disease, HIV-related dementia, ALS (amyotropic lateral sclerosis), Adult Onset Diabetes; senile cardiac amyloidosis; endocrine tumors, and others, including macular degeneration, to name just a few.
  • AD Alzheimer's Disease
  • a ⁇ N3pE ELISA Human Amyloid ⁇ (N3pE) Assay Kit -IBL, Code No. 27716), which is to be used as reference and internal quality control.
  • Capturing of the A ⁇ N3pE-40 peptide was done with the hA ⁇ (x-40) ELISA (HS) from TGC (The Genetics Company, Inc . , Wagistrasse 23, 8952 Schlieren, Zurich area Switzerland) , which should facilitate and expedite the process of development.
  • the present invention pertains in particular to antibodies or variants thereof, which are characterized in that they bind to A ⁇ -peptide with a high affinity.
  • Said high affinity means in the context of the present invention an affinity of a Kp value of 10 ⁇ 7 M or better, preferably a K D value of 10 ⁇ 8 M or better, and even more preferably a K ⁇ value of 10 ⁇ ⁇ M - 10 " - ⁇ M.
  • the antibody is preferably a monoclonal antibody and is selected from the following group
  • the antibody according to the present invention is especially useful in a diagnostic method to detect amyloidosis, in particular Alzheimer's disease.
  • Biacore analysis of hybridoma cell culture supernatants An overlay of monitored binding courses is illustrated graphically.
  • Figure 6 Sensograms of interaction of anti-A ⁇ N3pE antibody clone 6-1-6 with A ⁇ pE3-40.
  • N3pE-ELISA for clone 6-1-6 standard curve of A ⁇ pE3-40.
  • AD Alzheimer's disease
  • A Brain of a sporadic AD (SAD) patient stained with anti-A ⁇ antibody 6E10, recognizing total A ⁇
  • B Brain of a sporadic AD (SAD) patient stained with N3pE antibody clone 24-2-3, recognizing A ⁇ pE3-x
  • antibody is used in the broadest sense and specifically covers intact monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies) formed from at least two intact antibodies, and antibody fragments so long as they exhibit the desired biological activity.
  • the antibody may be an IgM, IgG (e.g. IgG]_, IgG2, IgG3 or IgG4), IgD, IgA or IgE, for example.
  • the antibody is not an IgM antibody.
  • Antibody fragments comprise a portion of an intact antibody, generally the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments: diabodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments .
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to “polyclonal antibody” preparations which typically include different antibodies directed against different determinants (epitopes) , each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies can frequently be advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins.
  • the "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by K ⁇ hler et al . , Nature, 256:495 (1975), or may be made by generally well known recombinant DNA methods.
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al . , Nature, 352:624-628 (1991) and Marks et al . , J. MoI. Biol., 222:581-597 (1991), for example.
  • the monoclonal antibodies herein specifically include chimeric antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain (s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
  • chimeric antibodies immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain (s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain a minimal sequence derived from a non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementarity-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • CDR complementarity-determining region
  • humanized antibodies may comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
  • the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • the humanized antibody includes a PrimatizedTM antibody wherein the antigen-binding region of the antibody is derived from an antibody produced by immunizing macaque monkeys with the antigen of interest.
  • Single-chain Fv or “sFv” antibody fragments comprise the V ⁇ and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V ⁇ and V ⁇ domains which enables the sFv to form the desired structure for antigen binding.
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V ⁇ ) connected to a light-chain variable domain (Vp) in the same polypeptide chain (V ⁇ - V ⁇ ) .
  • V ⁇ heavy-chain variable domain
  • Vp light-chain variable domain
  • Diabodies are described more fully in Hollinger et al., Proc. Natl. Acad. Sol. USA, 90:6444-6448 (1993) .
  • an “isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
  • the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N- terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • transformed cells include the primary subject cell and culture derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, this will be clear from the context.
  • polypeptide As used herein, are interchangeable and are defined to mean a biomolecule composed of amino acids linked by a peptide bond.
  • amyloid or amyloid-like proteins includes, but is not limited to, diseases and disorders caused by the presence or activity of amyloid-like proteins in monomeric, fibril, or polymeric state, or any combination of the three. Such diseases and disorders include, but are not limited to, amyloidosis, endocrine tumors, and macular degeneration.
  • amyloidosis refers to a group of diseases and disorders associated with amyloid plaque formation including, but not limited to, secondary amyloidosis and age-related amyloidosis such as diseases including, but not limited to, neurological disorders such as Alzheimer's Disease (AD), including diseases or conditions characterized by a loss of cognitive memory capacity such as, for example, mild cognitive impairment (MCI), sporadic Alzheimer's disease, Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type) ; the Guam Parkinson-Dementia complex, familial forms of Alzheimer's disease like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) ; as well as other diseases which are based on or associated with amyloid- like proteins such as progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, Parkinson's disease, HIV- related dementia, ALS (amyotropic lateral sclerosis)
  • Amyloid ⁇ , A ⁇ or / ⁇ -amyloid is an art recognized term and refers to amyloid ⁇ proteins and peptides, amyloid ⁇ precursor protein (APP), as well as modifications, fragments and any functional equivalents thereof.
  • amyloid ⁇ as used herein is meant any fragment produced by proteolytic cleavage of APP but especially those fragments which are involved in or associated with the amyloid pathologies including, but not limited to, A ⁇ i_ 38 , A ⁇ i_ 40 , A ⁇ i_ 42 .
  • the amino acid sequences of these A ⁇ peptides are as follows: A ⁇ 1-42 (SEQ ID NO. 1) :
  • a ⁇ 1-40 (SEQ ID NO. 2) :
  • a ⁇ 1-38 (SEQ ID NO. 3) :
  • pGlu-A ⁇ or "A ⁇ N3pE” refers to N-terminally truncated forms of A ⁇ , that start at the glutamic acid residue at position 3 in the amino acid sequence of A ⁇ , and wherein said glutamic acid residue is cyclized to form a pyroglutamic acid residue.
  • pGlu-A ⁇ as used herein are meant those fragments which are involved in or associated with the amyloid pathologies including, but not limited to, pGlu-A ⁇ 3 _3 8 , pGlu-A ⁇ 3 - 4 o, p-Glu-A ⁇ 3 _
  • sequences of the N-terminally truncated forms of A ⁇ , A ⁇ 3 _3 8 , A ⁇ 3 _4o, A ⁇ 3 _ 42 are as follows:
  • a ⁇ 3-42 (SEQ ID NO. 4) : GIu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-VaI-His-His-GIn-Lys-Leu-VaI- Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu- Met-Val-Gly-Gly-Val-Val-Ile-Ala
  • a ⁇ 3-40 (SEQ ID NO. 5) : GIu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val- Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu- Met-Val-Gly-Gly-Val-Val A ⁇ 3-38 (SEQ ID NO. 6) :
  • Antibody characterised in that it binds to A ⁇ peptides or variants thereof, preferably with high affinity.
  • Antibody according to item 1 or 2 wherein said antibody is a monoclonal antibody.
  • variable part of the light chain of said antibody has a nucleotide sequence selected from SEQ ID NOs: 49, 53, 57 and 61, or an amino acid sequence selected from SEQ ID NOs: 50, 54, 58, and 62.
  • variable part of the heavy chain of said antibody has a nucleotide sequence selected from SEQ ID NOs: 51, 55, 59 and 63, or an amino acid sequence selected from SEQ ID NOs: 52, 56, 60 and 64.
  • variable part of the light chain of said antibody has the nucleotide sequence of SEQ ID NO: 49 or the amino acid sequence of SEQ ID NO: 50, and wherein the variable part of the heavy chain of said antibody has the nucleotide sequence of SEQ ID NO: 51, or the amino acid sequence of SEQ ID NO: 52.
  • variable part of the light chain of said antibody has the nucleotide sequence of SEQ ID NO: 53 or the amino acid sequence of SEQ ID NO: 54, and wherein the variable part of the heavy chain of said antibody has the nucleotide sequence of SEQ ID NO: 55, or the amino acid sequence of SEQ ID NO: 56.
  • variable part of the light chain of said antibody has the nucleotide sequence of SEQ ID NO: 57 or the amino acid sequence of SEQ ID NO: 58
  • variable part of the heavy chain of said antibody has the nucleotide sequence of SEQ ID NO: 59, or the amino acid sequence of SEQ ID NO: 60.
  • variable part of the light chain of said antibody has the nucleotide sequence of SEQ ID NO: 61 or the amino acid sequence of SEQ ID NO: 62
  • variable part of the heavy chain of said antibody has the nucleotide sequence of SEQ ID NO: 63, or the amino acid sequence of SEQ ID NO: 64.
  • Antibody according to any of the preceding items, wherein said antibody is selected from the following group:
  • Antibody according to any of the preceding items, wherein said antibody is A ⁇ 6-1-6 (Deposit No. DSM ACC 2924) .
  • Antibody according to any of the preceding items, wherein said antibody is A ⁇ 24-2-3 (Deposit No. DSM ACC 2926) .
  • Antibody according to any of the preceding items wherein said antibody is a humanized or chimeric antibody, or an antibody fragment which retains the high affinity.
  • Antibody according to item 14 wherein said variants are selected from the following group:
  • x is an integer between 10 and 42; preferably 18 and 42, more preferably 30 and 42.
  • Antibody according to any of the preceding items which is human .
  • Antibody according to any of the preceding items which is a diabody or a single chain antibody which retains the high affinity.
  • Antibody according to any of the preceding items which has the complementarity determining regions of the antibodies as defined in item 15.
  • Antibody obtainable from any one of hybridoma cell lines DSM ACC 2923, DSM ACC 2924, DSM ACC 2925, DSM ACC 2926.
  • composition comprising the antibody as defined in any of the preceding items.
  • composition according to item 23 for the treatment, prevention or delay of amyloidosis.
  • Composition according to item 26 wherein said Familial Alzheimer's dementia is Familial British Dementia or Familial Danish Dementia.
  • Hybridoma cell line DSM ACC 2925 Hybridoma cell line DSM ACC 2925.
  • Hybridoma cell line DSM ACC 2926 Hybridoma cell line DSM ACC 2926.
  • amyloidosis is a neurodegenerative disease selected from the group consisting of mild cognitive impairment, Alzheimer's disease and neurodegeneration in Down Syndrome.
  • amyloidosis is sporadic Alzheimer's disease or a Familial Alzheimer's dementia .
  • In vitro diagnostic method for the diagnosis of an amyloid- associated disease or condition, in particular Alzheimer's disease comprising the following steps: contacting an antibody according to any one of items 1 to 22 with a sample from a subject suspected to be afflicted with said disease or condition, and detecting binding of the antibody to a pGlu-amyloid protein, preferably pGlu-A ⁇ peptide from the sample.
  • Diagnostic kit comprising the antibody as defined in any one of items 1 to 22, and instructions for use, and - optionally - (a) further biologically active substance (s) .
  • the antibodies of the invention may be useful for the diagnosis of amyloidosis.
  • the antibodies of the invention may be used as affinity purification agents.
  • the antibodies are immobilised on a solid phase such a Sephadex resin or filter paper, using methods well known in the art.
  • the immobilized antibody is contacted with a sample containing the A ⁇ -peptide (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the A ⁇ -peptide, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent, such as glycine buffer, pH 5.0 that will release the A ⁇ -peptide from the antibody.
  • Anti-A ⁇ -peptide antibodies may also be useful in diagnostic assays for A ⁇ -peptide, e.g. detecting its occurrence in specific cells, tissues, or serum.
  • the antibodies may be used in the diagnosis of amyloidosis, in particular a neurodegenerative disease selected from the group consisting of mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) such as Familial British Dementia (FBD) and Familial Danish Dementia (FDD) and neurodegeneration in Down Syndrome; preferably Alzheimer's disease.
  • MCI mild cognitive impairment
  • AD Alzheimer's disease
  • SAD sporadic Alzheimer's disease
  • FDD Familial Alzheimer's dementias
  • BBD Familial British Dementia
  • FDD Familial Danish Dementia
  • neurodegeneration in Down Syndrome preferably Alzheimer's disease.
  • the antibody typically will be labelled with a detectable moiety.
  • a detectable moiety For diagnostic applications, the antibody typically will be labelled with a detectable moiety.
  • Numerous labels are available which can be generally grouped into the following categories :
  • Radioisotopes such as 35 S, 14 C, 125 I, 3 H, and 131 I.
  • the antibody can be labeled with the radioisotope using the techniques described in Current Protocols in Immunology, Volumes 1 and 2, Glois et al . , Ed., Wiley-Interscience . New York, New York. Pubs., (1991) for example and radioactivity can be measured using scintillation counting.
  • Fluorescent labels such as rare earth chelates (europium chelates) or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, Lissamine, phycoerythrin and Texas Red are available.
  • the fluorescent labels can be conjugated to the antibody using the techniques disclosed in Current Protocols in Immunology, supra for example. Fluorescence can be quantified using a fluorimeter.
  • the enzyme generally catalyses a chemical alteration of the chromogenic substrate which can be measured using various techniques. For example, the enzyme may catalyze a color change in a substrate, which can be measured spectrophotometrically . Alternatively, the enzyme may alter the fluorescence or chemiluminescence of the substrate. Techniques for quantifying a change in fluorescence are described above.
  • the chemiluminescent substrate becomes electronically excited by a chemical reaction and may then emit light which can be measured (using a chemiluminometer, for example) or donates energy to a fluorescent acceptor.
  • enzymatic labels include luciferases (e.g, firefly luciferase and bacterial luciferase; U.S. Patent No, 4,737,456), luciferin, 2, 3-dihydrophthalazinediones, malate dehydrogenase, urease, peroxidase such as horseradish peroxidase (HRPO), alkaline phosphatase.
  • luciferases e.g, firefly luciferase and bacterial luciferase; U.S. Patent No, 4,737,456
  • luciferin 2, 3-dihydrophthalazinediones
  • malate dehydrogenase urease
  • peroxidase such as horseradish peroxidase (HRPO), alkaline phosphatase.
  • HRPO horseradish peroxidase
  • O-galactosidase O-galactosidase, glucoamylase, lysozyme, saccharide oxidases (e.g., glucose oxidase, galactose oxidase, and glucose- 6-phosphate dehydrogenase) , heterocyclic oxidases (such as uricase and xanthine oxidase) , lactoperoxidase, microperoxidase, and the like.
  • saccharide oxidases e.g., glucose oxidase, galactose oxidase, and glucose- 6-phosphate dehydrogenase
  • heterocyclic oxidases such as uricase and xanthine oxidase
  • lactoperoxidase lactoperoxidase
  • microperoxidase and the like.
  • enzyme-substrate combinations include, for example:
  • HRPO Horseradish peroxidase
  • HPO horseradish peroxidase
  • OPD orthophenylene diamine
  • TMB 3, 3', 5,5'- tetramethyl benzidine hydrochloride
  • alkaline phosphatase AP
  • para-Nitrophenyl phosphate as chromogenic substrate
  • ⁇ -D-galactosidase ⁇ -D-GaI
  • a chromogenic substrate e.g. p-nitrophenyl- ⁇ -D-galactosidase
  • fluorogenic substrate 4-methylumbelliferyl- ⁇ -D-galactosidase
  • the label is indirectly conjugated with the antibody.
  • the antibody can be conjugated with biotin and any of the three broad categories of labels mentioned above can be conjugated with avidin, or vice versa. Biotin binds selectively to avidin and thus, the label can be conjugated with the antibody in this indirect manner.
  • the antibody is conjugated with a small hapten (e.g. digoxin) and one of the different types of labels mentioned above is conjugated with an anti-hapten antibody (e.g. anti-digoxin antibody) .
  • a small hapten e.g. digoxin
  • an anti-hapten antibody e.g. anti-digoxin antibody
  • the A ⁇ -antibody needs not be labeled, and the presence thereof can be detected using a labeled antibody, which binds to the A ⁇ - antibody.
  • the antibodies of the present invention may be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays. Zola, Monoclonal Antibodies A Manual of Techniques, pp.147-158 (CRC Press. Inc., 1987)
  • a ⁇ peptide in the test sample is inversely proportional to the amount of standard that becomes bound to the antibodies.
  • the antibodies generally are insolubilized before or after the competition, so that the standard and analyte that are bound to the antibodies may conveniently be separated from the standard and analyte which remain unbound.
  • Sandwich assays involve the use of two antibodies, each capable of binding to a different immunogenic portion, or epitope, of the protein to be detected.
  • the test sample analyte is bound by a first antibody which is immobilized on a solid support, and thereafter a second antibody binds to the analyte, thus forming an insoluble three-part complex.
  • the second antibody may itself be labeled with a detectable moiety (direct sandwich assays) or may be measured using an antiimmunoglobulin antibody that is labeled with a detectable moiety (indirect sandwich assay) .
  • sandwich assay is an ELISA assay, in which case the detectable moiety is an enzyme.
  • the tissue sample may be fresh or frozen or may be embedded in paraffin and fixed with a preservative such as formalin, for example.
  • the antibody of the present invention can be provided in a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic assay.
  • the kit will include substrates and cofactors required by the enzyme (e.g. a substrate precursor which provides the detectable chromophore or fluorophore) .
  • substrates and cofactors required by the enzyme e.g. a substrate precursor which provides the detectable chromophore or fluorophore
  • other additives may be included such as stabilizers, buffers (e.g. a block buffer or lysis buffer) and the like.
  • the relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay.
  • the reagents may be provided as dry powders, usually lyophilized, including excipients which on dissolution will provide a reagent solution having the appropriate concentration.
  • the diagnostic kit according to the invention may contain a further biologically active substance as described below.
  • a further biologically active substance as described below.
  • inhibtors of glutaminyl cyclase are especially preferred for the use in the diagnostic kit.
  • the diagnostic kit of the invention is especially useful for the detection and diagnosis of amyloid- associated diseases and conditions, in particular neurodegenerative diseases selected from the group consisting of mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD), neurodegeneration in Down Syndrome; preferably Alzheimer's disease.
  • MCI mild cognitive impairment
  • AD Alzheimer's disease
  • AD sporadic Alzheimer's disease
  • FAD Familial Alzheimer's dementias
  • BFD Familial British Dementia
  • FDD Familial Danish Dementia
  • the present invention pertains in particular to antibodies which are characterized in that they bind to A ⁇ -peptide with a high affinity.
  • the present invention also pertains to antibodies which are characterised in that they bind to A ⁇ -peptides or variants thereof with a high affinity.
  • Said high affinity means in the context of the present invention an affinity of a Kp value of 10 ⁇ ⁇ M or better, preferably a Kp value of 10 ⁇ ⁇ M or better, and even more preferably a Kp value of 10 ⁇ " M - 10 " - ⁇ M.
  • the antibody is preferably a monoclonal antibody and is selected from the following group
  • a ⁇ 24-2-3 (DSM ACC 2926)
  • the antibody according to the present invention is especially useful in a diagnostic method to detect amyloidosis, in particular a neurodegenerative disease selected from the group consisting of mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) , neurodegeneration in Down Syndrome; preferably Alzheimer's disease .
  • MCI mild cognitive impairment
  • AD Alzheimer's disease
  • FAD Familial Alzheimer's dementias
  • BFD Familial British Dementia
  • FDD Familial Danish Dementia
  • the antibody can be humanised or is a chimeric antibody or is a human antibody.
  • the antibody as selected from the above-mentioned group can also be a functional variant of said group.
  • a variant of an p-Glu-A ⁇ peptide is in particular
  • a ⁇ peptides are all pGlu-A ⁇ 3 _ x variants, which have been shown to accumulate in the brain as a consequence of Alzheimer's disease or preceding Alzheimer's disease.
  • X is defined as an integer between 10 and 42, e.g. in the above pGlu- A ⁇ 3 _42, "42" would be the integer for "x”.
  • a “functional variant” of the inventive antibody is an antibody which retains the binding capacities, in particular binding capacities with high affinity to a pGlu-A ⁇ 3 _ x peptide or functional variant thereof.
  • the provision of such functional variants is known in the art and encompasses the above-mentioned possibilities, which were indicated under the definition of antibodies and fragments thereof .
  • the antibody is an antibody fragment, as defined above.
  • the inventive antibody is an antibody which binds to the epitope which is bound by the antibodies as defined above, in particular antibody 5-5-6, antibody 6-1-6, antibody 17-4-3 and antibody 24-2-3.
  • the antibody of the invention is an antibody which has the complementarity-determining regions (CDRs) of the above-defined antibodies.
  • the antibody can be labeled; possible labels are those as mentioned above and all those known to a person skilled in the art of diagnostic uses of antibodies in particular.
  • the antibody is immobilized on a solid phase.
  • the present invention also concerns an antibody which is obtainable from hybridoma cell line 6-1-6 (DSM ACC 2924) .
  • the present invention also relates to a composition which comprises the antibody as defined above.
  • said composition is a composition for a diagnostic use, especially for the diagnosis of a neurodegenerative disease selected from the group consisting of mild cognitive impairment (MCI),
  • AD Alzheimer's disease
  • SAD sporadic Alzheimer's disease
  • FDD Familial Alzheimer's dementias
  • BFD Familial British Dementia
  • FDD Familial Danish Dementia
  • the antibody according to the invention and as described herein before or a fragment thereof exhibits an binding affinity to an A ⁇ oligomer, fiber, fibril or filament which is at least 2 times, particularly at least 4 times, particularly at least 10 times, particularly at least 15 times, more particularly at least 20 times, but especially at least 25 times higher than the binding affinity to an A ⁇ monomer.
  • an antibody or a fragment thereof or a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof is provided as described herein before, which antibody substantially binds to aggregated A ⁇ , including A ⁇ plaques, in the mammalian, particularly the human brain but, preferably, does not show any significant cross- reactivity with amyloid precursor protein (APP) .
  • APP amyloid precursor protein
  • the antibody or a fragment thereof or the chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof is provided as described herein before, which antibody substantially binds to soluble polymeric amyloid, particularly amyloid ⁇ (A ⁇ ) , including A ⁇ monomers, in the mammalian, particularly the human brain but, preferably, does not show any significant cross-reactivity with amyloid precursor protein (APP) .
  • a ⁇ amyloid ⁇
  • APP amyloid precursor protein
  • the present invention relates also to humanized forms of the antibodies as defined above, compositions comprising said humanized antibodies and the use of said compositions for the treatment of amyloidosis, especially for the treatment of neurodegenerative disease in a mammal, in particular in a human.
  • Said neurodegenerative disease is in particular selected from the group consisting of mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD), neurodegeneration in Down Syndrome.
  • MCI mild cognitive impairment
  • AD Alzheimer's disease
  • AD sporadic Alzheimer's disease
  • FAD Familial Alzheimer's dementias
  • BBD Familial British Dementia
  • FDD Familial Danish Dementia
  • neurodegeneration in Down Syndrome Preferably, said neurodegenerative disease is Alzheimer's disease.
  • the present invention is also directed to the following hybridoma cell lines 5-5-6, 6-1-6, 17-4-3 and 24-2-3.
  • the present invention also pertains to the use of the antibody or the composition comprising the antibody, both as defined above, for use in an in vitro diagnostic method.
  • this diagnostic method is directed to diagnosis of a neurodegenerative disease selected from the group consisting of mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial
  • Alzheimer's dementias like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) , neurodegeneration in Down Syndrome; preferably Alzheimer's disease; especially by detecting an A ⁇ peptide or variants thereof in a biological sample.
  • said sample is a serum sample.
  • said sample is a liquor or cerebrospinal fluid (CSF) sample.
  • CSF cerebrospinal fluid
  • the present invention pertains to the following method:
  • In vitro or in situ diagnostic method for the diagnosis of an amyloid-associated disease or condition comprising the following steps: contacting an antibody according to the invention with a sample, preferably selected from a serum, liquor or CSF sample, most preferably a serum sample; or a specific body part or body area of a subject suspected to be afflicted with said condition or disease, and detecting binding of the antibody to a pGlu-amyloid protein, preferably pGlu-A ⁇ peptide, from the sample.
  • the invention relates to a method of diagnosis of an amyloid-associated disease or condition, preferably Alzheimer's disease, comprising detecting the immunospecific binding of an antibody or an active fragment thereof to a pGlu-amyloid protein, preferably pGlu-A ⁇ peptide, in a sample or in situ which includes the steps of (a) bringing the sample or a specific body part or body area suspected to contain the amyloid protein into contact with an antibody, particularly a monoclonal antibody according to the invention, or a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein before, and/or a functional part thereof, which antibody binds a pGlu-A ⁇ peptide;
  • Also comprised is a method of determining the extent of amyloidogenic plaque burden in a tissue and/or body fluids comprising
  • the invention relates to a method of determining the extent of amyloidogenic plaque burden in a tissue and/or body fluids, wherein the formation of the immunological complex in step c) is determined such that presence or absence of the immunological complex correlates with presence or absence of amyloid protein, in particular pGlu-A ⁇ peptides.
  • the invention relates to a composition
  • a composition comprising the antibody according to the invention, or a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein before including any functionally equivalent antibody or any derivative or functional parts thereof, in a therapeutically effective amount, in particular a composition which is a pharmaceutical composition optionally further comprising a pharmaceutically acceptable carrier.
  • said composition comprises the antibody in a therapeutically effective amount.
  • a mixture comprising an antibody, particularly a monoclonal antibody according to the invention, or a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein before including any functionally equivalent antibody or any derivative or functional parts thereof, in a therapeutically effective amount and, optionally, a further biologically active substance and/or a pharmaceutically acceptable carrier and/or a diluent and/or an excipient .
  • the invention relates to a mixture, wherein the further biologically active substance is a compound used in the medication of amyloidosis, a group of diseases and disorders associated with amyloid or amyloid-like protein such as the A ⁇ protein involved in neurodegenerative diseases selected from the group consisting of mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) , neurodegeneration in Down Syndrome; preferably Alzheimer's disease.
  • MCI mild cognitive impairment
  • AD Alzheimer's disease
  • SAD sporadic Alzheimer's disease
  • FDD Familial Alzheimer's dementias
  • FDD Familial British Dementia
  • FDD Familial Danish Dementia
  • the other biologically active substance or compound may also be a therapeutic agent that may be used in the treatment of amyloidosis caused by amyloid ⁇ or may be used in the medication of other neurological disorders.
  • the other biologically active substance or compound may exert its biological effect by the same or a similar mechanism as the antibody according to the invention or by an unrelated mechanism of action or by a multiplicity of related and/or unrelated mechanisms of action.
  • the other biologically active compound may include neutron-transmission enhancers, psychotherapeutic drugs, acetylcholine esterase inhibitors, calcium-channel blockers, biogenic amines, benzodiazepine tranquillizers, acetylcholine synthesis, storage or release enhancers, acetylcholine postsynaptic receptor agonists, monoamine oxidase-A or -B inhibitors, N-methyl- D-aspartate glutamate receptor antagonists, non-steroidal anti-inflammatory drugs, antioxidants, and serotonergic receptor antagonists.
  • neutron-transmission enhancers may include neutron-transmission enhancers, psychotherapeutic drugs, acetylcholine esterase inhibitors, calcium-channel blockers, biogenic amines, benzodiazepine tranquillizers, acetylcholine synthesis, storage or release enhancers, acetylcholine postsynaptic receptor agonists, monoamine oxidase-A or -B inhibitors,
  • the invention relates to a mixture comprising at least one compound selected from the group consisting of compounds effective against oxidative stress, anti-apoptotic compounds, metal chelators, inhibitors of DNA repair such as pirenzepin and metabolites, 3- amino-1-propanesulfonic acid (3 APS), 1, 3-propanedisulfonate (1,3PDS), ⁇ -secretase activators, ⁇ - and ⁇ -secretase inhibitors, tau proteins, neurotransmitter, 7 3- sheet breakers, attractants for amyloid beta clearing / depleting cellular components, inhibitors of N-terminal truncated amyloid beta including pyroglutamated amyloid beta 3- 42, such as inhibitors of glutaminyl cyclase, anti-inflammatory molecules, or cholinesterase inhibitors (ChEIs) such as tacrine, rivastigmine, donepezil, and/or galantamine, Ml agonists and other drugs including any amyloid or tau
  • the invention further relates to a mixture, wherein the compound is a cholinesterase inhibitor (ChEIs) , particularly a mixture, wherein the compound is one selected from the group consisting of tacrine, rivastigmine, donepezil, galantamine, niacin and memantine .
  • ChEIs cholinesterase inhibitor
  • the mixtures according to the invention may comprise niacin or memantine together with an antibody according to the present invention and, optionally, a pharmaceutically acceptable carrier and/or a diluent and/or an excipient.
  • the mixtures according to the invention may comprise a glutaminyl cyclase inhibitor together with an antibody according to the present invention and, optionally, a pharmaceutically acceptable carrier and/or a diluent and/or an excipient .
  • Preferred inhibitors of glutaminyl cyclase are described in WO 2005/075436, in particular examples 1-141 as shown on pp. 31-40.
  • the synthesis of examples 1-141 is shown on pp. 40-48 of WO
  • WO 2008/055945 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/055945, in particular examples 1-473 as shown on pp. 46-155. The synthesis of examples 1-473 is shown on pp. 156-192 of WO 2008/055945. The disclosure of WO 2008/055945 regarding examples 1-473, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO 2008/055947 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/055947, in particular examples 1-345 as shown on pp. 53-118.
  • the synthesis of examples 1-345 is shown on pp. 119-133 of WO 2008/055947.
  • the disclosure of WO 2008/055947 regarding examples 1-345, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO 2008/055950 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/055950, in particular examples 1-212 as shown on pp. 57-120.
  • the synthesis of examples 1-212 is shown on pp. 121-128 of WO 2008/055950.
  • the disclosure of WO 2008/055950 regarding examples 1-212, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO2008/065141 Further preferred inhibitors of glutaminyl cyclase are described in WO2008/065141, in particular examples 1-25 as shown on pp. 56-59. The synthesis of examples 1-25 is shown on pp. 60-67 of WO2008/065141. The disclosure of WO2008/065141 regarding examples 1-25, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO 2008/110523 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/110523, in particular examples 1-27 as shown on pp. 55-59. The synthesis of examples 1-27 is shown on pp. 59-71 of WO 2008/110523. The disclosure of WO 2008/110523 regarding examples 1-27, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO 2008/128981 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/128981, in particular examples 1-18 as shown on pp. 62-65. The synthesis of examples 1-18 is shown on pp. 65-74 of WO 2008/128981. The disclosure of WO 2008/128981 regarding examples 1-18, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO 2008/128983 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/128983, in particular examples 1-30 as shown on pp. 64-68. The synthesis of examples 1-30 is shown on pp. 68-80 of WO 2008/128983. The disclosure of WO 2008/128983 regarding examples 1-30, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference. Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/128984, in particular examples 1-36 as shown on pp. 63-69. The synthesis of examples 1-36 is shown on pp. 69-81 of WO 2008/128984. The disclosure of WO 2008/128984 regarding examples 1-36, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • WO 2008/128986 Further preferred inhibitors of glutaminyl cyclase are described in WO 2008/128986, in particular examples 1-7 as shown on pp. 65-66. The synthesis of examples 1-7 is shown on pp. 66-73 of WO 2008/128986. The disclosure of WO 2008/128986 regarding examples 1-7, their synthesis and their use as glutaminyl cyclase inhibitors is incorporated herein by reference.
  • mixtures are provided that comprise "atypical antipsychotics" such as, for example clozapine, ziprasidone, risperidone, aripiprazole or olanzapine for the treatment of positive and negative psychotic symptoms including hallucinations, delusions, thought disorders (manifested by marked incoherence, derailment, tangentiality) , and playful or disorganized behavior, as well as anhedonia, flattened affect, apathy, and social withdrawal, together with an antibody, particularly a monoclonal antibody according to the invention, but particularly a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein and, optionally, a pharmaceutically acceptable carrier and/or a diluent and/or an excipient.
  • atypical antipsychotics such as, for example clozapine, ziprasidone, risperidone, aripiprazole or olanzapine for the treatment
  • compositions and mixtures according to the invention and as described herein before comprise the antibody and the biologically active substance, respectively, in a therapeutically effective amount.
  • WO2008/065141 see especially pages 37/38
  • PEP-inhibitors pp. 43/44
  • LiCl inhibitors of dipeptidyl aminopeptidases, preferably inhibitors of DP IV or DP IV-like enzymes
  • ACE acetylcholinesterase
  • PIMT enhancers inhibitors of beta secretases
  • inhibitors of gamma secretases see pp. 41/42
  • PDE-4 phosphodiesterase-4
  • TNFalpha inhibitors TNFalpha inhibitors
  • muscarinic Ml receptor antagonists see p. 46
  • NMDA receptor antagonists see pp. 47/48
  • sigma-1 receptor inhibitors histamine H3 antagonists
  • immunomodulatory agents immunosuppressive agents or an agent selected from the group consisting of antegren (natalizumab) , Neurelan (fampridine-SR) , campath (alemtuzumab) , IR 208, NBI 5788/MSP 771 (tiplimotide) , paclitaxel, Anergix.MS (AG 284),
  • SH636 Differin (CD 271, adapalene) , BAY 361677 (interleukin-4) , matrix-metalloproteinase-inhibitors (e.g. BB 76163), interferon- tau (trophoblastin) and SAIK-MS; beta-amyloid antibodies (see p.44), cysteine protease inhibitors (see p. 44); MCP-I antagonists (see pp. 44/45), amyloid protein deposition inhibitors (see 42) and beta amyloid synthesis inhibitors (see p. 42), which document is incorporated herein by reference.
  • Differin CD 271, adapalene
  • BAY 361677 interleukin-4
  • matrix-metalloproteinase-inhibitors e.g. BB 76163
  • interferon- tau trophoblastin
  • SAIK-MS SAIK-MS
  • beta-amyloid antibodies see p.44
  • cysteine protease inhibitors
  • the invention relates to a mixture comprising the antibody, particularly a monoclonal antibody according to the invention, or a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein before and/or the biologically active substance in a therapeutically effective amount.
  • the invention further relates to the use of an antibody, particularly a monoclonal antibody according to the invention, but particularly a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein before and/or a functional part thereof and/or a pharmaceutical composition, or a mixture comprising said antibody, for the preparation of a medicament for treating or alleviating the effects of amyloidosis, a group of diseases and disorders associated with amyloid plaque formation including secondary amyloidosis and age-related amyloidosis such as diseases including, but not limited to, neurological disorders such as Alzheimer's Disease (AD), Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type) ; the Guam Parkinson-Dementia complex; as well as other diseases which are based on or associated with amyloid-like proteins such as progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, Parkinson's disease, HIV
  • Also comprised by the present invention is a method for the preparation of an antibody, particularly a monoclonal antibody according to the invention, but particularly a chimeric antibody or a fragment thereof, or a humanized antibody or a fragment thereof according to the invention and as described herein before and/or a functional part thereof and/or a pharmaceutical composition, or a mixture comprising said antibody and/or a functional part thereof, particularly in a therapeutically effective amount, for use in a method of preventing, treating or alleviating the effects of amyloidosis, a group of diseases and disorders associated with amyloid plaque formation including secondary amyloidosis and age-related amyloidosis such as diseases including, but not limited toneurodegenerative diseases such as mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) , neurodegeneration in
  • a method for preventing, treating or alleviating the effects of amyloidosis a group of diseases and disorders associated with amyloid plaque formation including secondary amyloidosis and age-related amyloidosis
  • diseases including, but not limited to, neurological disorders such as mild cognitive impairment (MCI), Alzheimer's disease (AD), like for instance sporadic Alzheimer's disease (SAD) or Familial Alzheimer's dementias (FAD) like Familial British Dementia (FBD) and Familial Danish Dementia (FDD) , neurodegeneration in Down Syndrome; Lewy body dementia, hereditary cerebral hemorrhage with amyloidosis (Dutch type) ; the Guam Parkinson-Dementia complex; as well as other diseases which are based on or associated with amyloid-like proteins such as progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotropic lateral lateral amyloid lateral a
  • MCI mild cognitive impairment
  • AD Alzheimer's disease
  • FDD Familial Alzheimer's dementias
  • FDD Familial British Dementia
  • FDD Familial Danish Dementia
  • the invention provides a method for retaining or increasing cognitive memory capacity but, particularly, for restoring the cognitive memory capacity of an animal, particularly a mammal or a human, suffering from memory impairment by administering to an animal, particularly a mammal or a human, an antibody, particularly a pharmaceutical composition according to the invention and as described herein before .
  • the invention relates to the treatment of an animal, particularly a mammal or a human, suffering from an amyloid-associated condition characterized by a loss of cognitive memory capacity that leads to the retention of cognitive memory capacity.
  • mice Female BALB/C mice (Charles River) of 8 weeks age were used.
  • the myeloma cell line SP2/0-Agl4 from Deutsche Stammsammlung von Mikoorganismen und Zellkulturen was used.
  • the peptide pGlu-6166 (sequence pGlu-FRHDSGC, SEQ ID NO: 65) was used.
  • the peptide was coupled to bovine thyroglubulin
  • LCSMCC LCSMCC
  • BMPS N- [b-maleimidopropyloxy] succinimide ester
  • bovine serum albumine BSA, SIGMA
  • maleimid groups from succinimidyl-6- [ (b-maleimido- propionamido) hexanoate] (SMPH) .
  • Conjugation of the peptide for immunization Conjugation was performed in two steps via SH-groups from the cystein residue of the peptide.
  • 250 ⁇ l of the peptide solution (10 mg/ml in Aqua bidest) were mixed with 2 ml of a solution containing the maleoylated carrier proteins (2.5 mg/ml) in 50 mM sodium phosphate, 250 ml NaCl, pH 6.8 and incubated for 2 h at 4 0 C and further 4 h at RT .
  • Unreacted maleimid groups were blocked by addition of 2- mercaptoethanole up to a concentration of 10 mM and over night incubation at 4 0 C.
  • the resulting conjugate was dialysed against 10 mM sodium phosphate, 150 mM NaCl, pH 7.5 at 4 0 C (3 times buffer exchange, MW cut-off 10.000) .
  • Conjugation was performed in two steps via SH-groups from the cystein residue of the peptide.
  • mice Five mice were immunized intraperitoneally for 39 days.
  • a water-in-oil emulsion consisting of equal parts of the antigen solution (consisting of equal parts of the three different peptide-BTG-conjugates) and complete or incomplete Freundt's adjuvants was used.
  • Spleens were taken and homogenized under sterile conditions. Spleen cells and myeloma SP2/0 cells were washed several times in Dulbecco's Modified Eagle Medium (DMEM, SIGMA) and fused in the ratio of 2,3 spleen cells : 1 SP2/0 cell using polyethylenglycole 3350 (1 ml 50 % (w/v) ) . Further handling of the fused hybridomas was performed according to standard methodologies .
  • DMEM Dulbecco's Modified Eagle Medium
  • IgG directed ELISA was used to screen the cell culture supernatant.
  • the test was performed in 96-well polystyrol microtiter plates (Greiner, Cat. No. 655061) .
  • the plates were coated with the BSA-pGlu-6166 peptide.
  • 100 ⁇ l undiluted cell culture supernatant was added to each well and incubated for 1 h at RT.
  • Supernatant from SP2/0 cells was used as negative control.
  • Supernatant from the spleen cells was used as positive control .
  • Two consecutive cloning steps were performed in order to separate antibody producing cells from non-producing cells and to assure that the selected cells are monoclonal. Both cloning steps were performed according to the method of limited dilution.
  • Selected hybridomas were cryo-conserved using DMSO and standard methods .
  • a ⁇ N3pE-40 was performed using hA ⁇ (x-40) ELISA (HS) from TGC (The GENETICS Company; Switzerland) , basically according to the manufacturer's instructions.
  • Biotinylated detection antibodies for A ⁇ N3pE were generated. Where indicated, IBL HRP-conjugated A ⁇ N3pE antibody was used as positive control (available only in combination with the IBL ELISA Human Amyloid ⁇ (N3pE) Assay Kit) . Corresponding A ⁇ N3pE-40 peptides (50 ⁇ g aliquots in
  • Hexafluoroisopropanol stored at -80 0 C
  • HFIP Hexafluoroisopropanol
  • DotBlot Analysis A simple DotBlot protocol was accomplished to obtain information about the sensitivity of A ⁇ N3pE antibody and cell culture supernatants towards the respective native peptide. To that end, A ⁇ N3pE-40 peptide in descending concentrations (1000 ng - E ng) was spotted onto small pieces of nitrocellulose membrane, and subsequent experimental procedure was performed as for the PepSpotTM membranes.
  • a ⁇ N3pE-40 peptide (positive control) and A ⁇ N3E-40 peptide (negative control) were coupled on a Biacore CM5 Chip. Unmodified chips are used to determine blank values.
  • the purified antibody clone 6-1-6 was diluted in HBS-EP buffer (Biacore) down to 100, 50, 30, 20, 15, 10, 7, 4, 2, 1 nM.
  • the affinity was determined using a Biacore 3000 with CM5-Chip, on which A ⁇ pE3-40 was immobilized.
  • the system was run with 30 ⁇ l/min. Measured bulk effects and unspecific binding to the chip surface were corrected by subtraction of the signal of flow cell 4, at which A ⁇ pE3-40 was immobilized, and the empty flow cell 3.
  • the association (10 min) was obtained by injection of 300 ⁇ l of each concentration.
  • the dissociation was observed over 10 min.
  • Remaining antibody molecules were removed by injection of 5 ⁇ l 0.1 M HCL. For every antibody concentration the association and dissociation was recorded.
  • the determination of the association and dissociation rate and the dissociation constant was performed by a global simultaneously fit of association and dissociation phase for all recorded antibody concentrations using the "Bivalent analyte" model
  • Hybridoma cells were grown in D-MEM (+ L-Glutamin, + Na-Pyruvat, 4,5g/l Glucose, Gibco) with the addition of 15% FBS, 1% MEM-NEA (non essential amino acids, Gibco) , 50 ⁇ g/ml Gentamycin (Gibco) and 50 ⁇ M ⁇ -mercaptoethanol at 37°C and 5% CO 2 . Subcultivation occurred after 3-4 days depending on cell density. Cells were seeded in a concentration of 0.5 x 10 6 cells/ml, splitting occurred at a cell density of 2-5 x 10 6 cells/ml.
  • Heavy chain variable regions were amplified from the template cDNA by using PhusionTM High-Fidelity DNA Polymerase (NEW ENGLAND BioLabs) with the primer MHCGl (in case of clone 5-5-6 and 6-1- 6) and MHCG2b (clone 17-4-3 and 24-2-3) in combination with primers MHV1-12.
  • MHCGl in case of clone 5-5-6 and 6-1- 6
  • MHCG2b clone 17-4-3 and 24-2-3
  • primers MHV1-12 for amplification of light chain variable regions the primer MKC in combination with the primers MKVl- MKVIl were used. Primer sequences are shown in table 1.
  • Heavy and light chain variable regions amplified by PCR, were cloned into pJETl .2/blunt vector according to the protocol of CloneJETTM PCR Cloning Kit (Fermentas) . Sequencing occurred with pJET1.2 sequencing primers.
  • a 96-well maxisorb plate (Nunc) was coated with capture antibody by incubation of 100 ⁇ l per well of 2 ⁇ g/ml anti-A ⁇ antibody 4G8, diluted in D-PBS, overnight at 4°C. The plated was sealed. The coating solution was removed and the surface of the plate was blocked with 200 ⁇ l per well PIERCE Protein-free ELISA-Blocker (without Tween-20) for 2 hours at room temperature. Afterwards the plate was washed with 6-times with TBS+0.05 % (v/v) Tween- 20. Remaining washing solution was removed by tapping of the plate.
  • the A ⁇ pE3-40 standard peptide was diluted in PIERCE Protein-free ELISA-Blocker (with Tween-20) down to 200, 100, 50, 25, 12.5, 6.25, 3.125 pg/ml . 100 ⁇ l of every concentration and 100 ⁇ l of dilution buffer (Blank) were pipetted on the plate. The plate was sealed and incubated at 4°C for 2 hours. Afterwards the plate was washed 6-times with TBS + 0.05 % (v/v) Tween-20. Remaining washing solution was removed by tapping of the plate.
  • a 96-well maxisorb plate (Nunc) was coated with capture antibody by incubation of 100 ⁇ l per well of 2 ⁇ g/ml anti-A ⁇ antibody 4G8, diluted in D-PBS, overnight at 4°C. The plated was sealed. The coating solution was removed and the surface of the plate was blocked with 200 ⁇ l per well PIERCE Protein-free ELISA-Blocker (without Tween-20) for 2 hours at room temperature. Afterwards the plate was washed with 6-times with TBS+0.05 % (v/v) Tween- 20. Remaining washing solution was removed by tapping of the plate. The A ⁇ pE3-40 standard peptide and other A ⁇ -Peptides (2-40, 3-40, 4-40, 1-42, 3-42 and pEll-40) were diluted in PIERCE
  • Protein-free ELISA-Blocker (with Tween-20) down to 800, 400, 200, 100, 50, 25, 12.5. 100 ⁇ l of every concentration and 100 ⁇ l of dilution buffer (Blank) were pipetted on the plate. The plate was sealed and incubated at 4 0 C for 2 hours. Afterwards the plate was washed 6-times with TBS + 0.05 % (v/v) Tween-20. Remaining washing solution was removed by tapping of the plate.
  • CM5-Chips MCPl, MCP2, big gastrin, gonadoliberin, neurotensin, orexin A, fibronectin, collagen 1 and TRH.
  • a ⁇ pE3-40 As positive control also the binding to A ⁇ pE3-40 was analyzed.
  • the N3pE antibody clones 6-1-6 and 24-2-3 were diluted in HBS-EP (Biacore) down to 25 ⁇ g/ml. The binding was observed using a Biacore 3000 with several CM5- Chips, on which the respective peptides (on flow cell 2, 3 and 4 was immobilized. The system was run with 20 ⁇ l/min.
  • the N3pE ELISA was performed by following protocol: A 96-well maxisorb plate (Nunc) was coated with capture antibody by incubation of 100 ⁇ l per well of 2 ⁇ g/ml anti-A ⁇ antibody 4G8, diluted in D-PBS, overnight at 4°C. The plated was sealed. The coating solution was removed and the surface of the plate was blocked with 200 ⁇ l per well PIERCE Protein-free ELISA-Blocker (without Tween-20) for 2 hours at room temperature. Afterwards the plate was washed with 6-times with TBS+0.05 % (v/v) Tween- 20. Remaining washing solution was removed by tapping of the plate.
  • the A ⁇ pE3-42 standard peptide was diluted in PIERCE Protein-free ELISA-Blocker (with Tween-20) (old method) or EIA buffer (new method) down to 1029.2, 514.6, 257.3, 128.65, 64.32, 31.16, 16.08 pg/ml . 100 ⁇ l of every concentration and 100 ⁇ l of dilution buffer (Blank) were pipetted on the plate. The SDS samples were thawed, diluted 1:25 and 1:100, respectively, in PIERCE Protein-free ELISA-Blocker (with Tween-20) (old method) or EIA buffer (new method) and pipetted on ELISA plate.
  • the formic acid samples (old method: formic acid / Tris; new method: formic acid / EIA buffer / Tris) were thawed and undiluted pipetted on ELISA plate. The plate was sealed and incubated at 4°C for 2 hours. Afterwards the plate was washed 6-times with TBS + 0.05 % (v/v) Tween-20. Remaining washing solution was removed by tapping of the plate. 100 ⁇ l of the detection antibody-enzyme conjugate solution, which contains 1 ⁇ g/ml A ⁇ N3pE specific antibody clone 6-1-6 and 2 ⁇ g/ml Streptavidin-HRP conjugate (Sigma) solved in PIERCE Protein-free ELISA-Blocker
  • biotinylated secondary antibody (goat anti-mouse from Vector Laboratories) : 9 ml TBS, 1 ml goat serum, 45 ⁇ l 2 nd antibody) . Incubate 30 minutes at room temperature.
  • Step 1 Dehydrating and clearing: Follow step 1 in reverse order (e.g. water, ethanols to 100 % histoclean)
  • the intensity of signals in the ELISA assays correlates not only with the concentration of analyte/A ⁇ variant but is also strongly dependent on the concentration of deployed antibody. Since A ⁇ variants are only present in low concentration in serum samples it is necessary to determine antibody concentrations that are able to detect low concentrations of the corresponding A ⁇ variants.
  • Commercially available A ⁇ ELISA kits have a specified detection limit towards A ⁇ in the low pg range. In standard curves the highest concentration is usually 500 pg/ml .
  • General information about deployed antibody concentration is typically lacking in data sheets / instruction manuals, however, due to further information as derivable from the general literature 1 ⁇ g / ml of antibody is used as default.
  • the A ⁇ N3pE-x antibody pGlu-6166 was chosen in the screening process because the original cell clone (designated 12-1-8) exhibited strong binding towards the peptide taken for immunization and very low cross reactivity (see table 2) .
  • Table 2 Screening results demonstrating signals in ELISA assays obtained with several hybridoma cell clone supernatants .
  • cell clones could be identified which indeed exhibit higher sensitivity towards the native full length A ⁇ N3pE-40 peptide.
  • the pGlu-6166 antibody clone 12-1 could only detect 1 ⁇ g peptide
  • clones 6-1-6 and 24-2-3 also gave signals with as little as 8 ng peptide.
  • clones 6-1- 6 and 24-2-3 are 125 times more sensitive. With these clones, a detection limit of 8 pg/ml A ⁇ N3pE-40 peptide in a corresponding ELISA could be attainable.
  • Table 3 Sequences of A ⁇ peptides spotted onto PepSpotTM Membranes (JPT Peptide Technologies GmbH ) and detection by pGlu-6166 hybridoma cell clones
  • pE in table 3 means pGlu, pyroglutamate .
  • iD in table 3 means isoAsp, isoaspartate .
  • Biacore analysis allows timewise resolution of the binding course of a given antibody. In order to check whether the poor binding of the pGlu-6166 12-1 antibody was a result of a low association to the A ⁇ N3pE-40 peptide, a Biacore analysis was performed as described in Materials and Methods, supra.
  • the association rate was calculated with 1.67e5 M -1 S -1 , the dissociation rate with 2.63e-4 s "1 and the dissociation constant with 1.57 nM.
  • association rate was calculated by a global fit of all sensograms shown in figure 7.
  • the association rate was calculated with 3.25e3 M 1 S 1 , the dissociation rate with 3.29e-4 s '1 and the dissociation constant with 101 nM.
  • nucleotide sequence ATGGTGTCCTCAGCTCAGTTCCTGTTTCTGTTAGTGCTCTGGATTCAGGAAACCAACGGT GATGTTGTGATGACCCAGACTCCACTCACTTTGTCGGTTACCATTGGACAACCAGCCTCT ATCTCTTGCAAGTCAAGTCAGAGCCTCTTATATAGTGATGGAAAAACCTATTTGAATTGG TTATTACAGAGGCCAGGCCAGTCTCCAATGCGCCTAATCTATCTGGTGTCTAAACTGGAC TCTGGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGAACAGATTTTACACTGAAAATC AGCAGAGTGGAGGCTGAGGATTTGGGAGTTTATTACTGCGTGCAAGGTACACATTTTCCA TTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAACGGGCTGATGCTGCACCAACTGTA TCCATCTTCCCACCAT
  • Variable part light chain, protein sequence (SEQ ID NO: 50) MVSSAQFLFLLVLWIQETNGDVVMTQTPLTLSVTIGQPAS I SCKSSQSLLYSDGKTYLNW LLQRPGQSPMRLIYLVSKLDSGVPDRFTGSGSGTDFTLKI SRVEAEDLGVYYCVQGTHFP FTFGSGTKLEIKRADAAPTVSIFPP
  • Variable part heavy chain nucleotide sequence (SEQ ID NO. 51)
  • Variable part light chain nucleotide sequence (SEQ ID NO: 53) ATGGTGTCCACAGCTCAGTTCCTGTTTCTGTTAGTGCTCTGGATTCAGGAAACCAACGGT GATGTTGTGATGACCCAGACTCCACTCACTTTGTCGGTTACCATTGGACAACCAGCCTCT ATCTCTTGCAAGTCAAGTCAGAGCCTCTTATATAGTGACGGAAAAACCTATTTGAATTGG TTATTACAGAGGCCAGGCCAGTCTCCAATGCGCCTAATCTATCTGGTGTCTAAACTGGAC TCTGGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGAACAGATTTTACACTGAAAATC AGCAGAGTGGAGGCTGAGGATTTGGGAGTTTATTACTGCGTGCAAGGTACACATTTTCCA TTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAACGGGCTGATGCTGCACCAACTGTA TCCATCTTCCCACCATCCAG
  • Variable part light chain, protein sequence (SEQ ID NO: 54) MVSTAQFLFLLVLWIQETNGDVVMTQTPLTLSVTIGQPAS I SCKSSQSLLYSDGKTYLNW LLQRPGQSPMRLIYLVSKLDSGVPDRFTGSGSGTDFTLKI SRVEAEDLGVYYCVQGTHFP FTFGSGTKLEIKRADAAPTVSIFPPS
  • Variable part heavy chain nucleotide sequence (SEQ ID NO: 55) ATGGGATGGAGCGGGGTCTTTATCTTCCTCCTGTCAGGAACTGCAGGTGTCCACTCTGAGGTCC AGCTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGAGCTTCAATGAAGATATCCTGCAAGGC
  • Variable part heavy chain protein sequence (SEQ ID NO: 56) MGWSGVFIFLLSGTAGVHSEVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSH GKNLEWIGLINPYNGVTRYNQKFKGKATLIVDKSSSTAYMELLSLTSEDSAVYYCTREAK REWDETYWGQGTLVTVSAAKTTPPSVYPL 2 . 7 . 3 Clone 17 - 4 -3
  • nucleotide sequence (SEQ ID NO: 57) ATGAAGTTGCCTGTTAGGCTGTTGGTGCTGGTGTTCTGGATTCCTGTTTCCAGCAGTGATGTTG TGATGACCCAGACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCCATCTCTTGCAG ATCTAGTCAGAGCCTTGTACACAGTGATGGAAACACCTATTTACATTGGTACCTGCAGAAGCCA GGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGT TCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCTGAGGATCT GGGAGTTTATTTCTGCTCTCTCAAAGTACACATGTTCCTCCGACGTTCGGTGGAGGCACCAAGCTG GAAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGT
  • Variable part light chain protein sequence (SEQ ID NO: 58) MKLPVRLLVLVFWI PVSSSDVVMTQTPLSLPVSLGDQAS I SCRSSQSLVHSDGNTYLHWY LQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI SRVEAEDLGVYFCSQSTHVPP TFGGGTKLEIKRADAAPTVSIFPPSS
  • Variable part heavy chain nucleotide sequence (SEQ ID NO: 59) ATGGACTTTGGGCTCAGCTTACTTATTTTTGTCCTTATTTTAAAAGGTGTCCAGTGTGAG GTGAAGCTGGTGGAGTCTGGGGGAGGCTTAGTGCAGCCTGGAGGGTCCCGGAAACTCTCC TGTGCAGCCTCTGGATTCACTTTCAGTGACTACGGAATGGCGTGGGTTCGACAGGCTCCA GGGAAGGGGCCTGAGTGGGTAGCATTCATTAGTAATTTGGCATATAGTATCTACTATGCA GACACTGTGACGGGCCGATTCACCATCTCTAGAGAGAATGCCAAGAACACCCTGTACCTG GAAATGAGCAGTCTGAGGTCTGAGGACACAGCCATGTACTACTGTGCAAGGTATGACTAC GATAATATCTTGGACTATGTTATGGACTACTGGGGTCAAGGAACCTCAAGGAACCGTCTCC TCAGCCAAAACAACACCCCCATCAGTCTATCCACTG
  • Variable part heavy chain protein sequence (SEQ ID NO: 60) MDFGLSLLIFVLILKGVQCEVKLVESGGGLVQPGGSRKLSCAASGFTFSDYGMAWVRQAP GKGPEWVAFISNLAYSIYYADTVTGRFTISRENAKNTLYLEMSSLRSEDTAMYYCARYDY DNILDYVMDYWGQGTSVTVSSAKTTPPSVYPL
  • Variable part light chain nucleotide sequence ATGAAGTTGCCTGTTAGGCTGTTGGTGCTCTGGATTCAGGAAACCAAGGGTGATGTTGTGCTGA CCCAGACTCCACTCACTTTGTCGGTTACCATTGGACAACCAGCCTCTATCTCTTGCAAGTCAAG TCAGAGCCTCTTATATAGTAATGGAAAAACCTATTTGAATTGGTTATTACAGAGGCCAGGCCAG TCTCCAAAGCGCCTAATCTATGTGGTGTCTAAACTGGACTCTGGAGTCCCTGACAGGTTCACTG GCAGTGGATCAGGAACAGATTTTACACTGAAAATCAGCAGAGTGGAGGCTGAGGATTTGGGAGT TTATTATTGCGTGCAAGGTACACATTTTCCATTCACGTTCGGCTCGGGGACAAAGTTGGAAATA AAACGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGT
  • Variable part light chain protein sequence (SEQ ID NO : 62) MKLPVRLLVLWIQETKGDVVLTQTPLTLSVTIGQPAS I SCKSSQSLLYSNGKTYLNWLLQ RPGQSPKRLIYVVSKLDSGVPDRFTGSGSGTDFTLKI SRVEAEDLGVYYCVQGTHFPFTF GSGTKLEIKRADAAPTVSIFPPSS
  • Variable part heavy chain nucleotide sequence (SEQ ID NO: 63)
  • Variable part heavy chain protein sequence (SEQ ID NO : 64) MGWSGVFLFLLSVTEGVHSQVQLQQSGAELVRPGSSVKI SCKASGYIFNNYWINWVKQRP GQGLEWIGQIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCAREGY IVYWGQGTLVTVSAAKTTPPSVYPL
  • the final N3pE ELISA protocol was tested concerning limit of quantification (LOQ) and signal-to-noise ratio (S/N) .
  • N3pE antibody clone 6-1-6 and 24-2-3 are specific for the N-terminal epitope of A ⁇ pE3-x. Neither other pGlu N-termini were recognized nor other A ⁇ peptide variants, which do not bear an N-terminal pE residue.
  • a ⁇ pE3-42 concentration in mouse brainstem was analyzed dependent on the used method.
  • the samples were derived from from transgenic mice (tg) overexpressing human A ⁇ Q3-42 in the brain, which is cyclized by QC to A ⁇ pE3-42.
  • tg het heterozygous transgenic mice
  • tg horn homozygous transgenic mice
  • wt wildtype, non-transgenic mice
  • N3pE ELISA the neutralization method for analyzing formic acid fraction samples was optimized, i.e. the neutralization was N3pE ELISA.
  • the resulting and herein developed N3pE ELISA works well, it detected significant levels of human A ⁇ pE3-42 in brains of the tg horn mice, significantly lower levels of human A ⁇ pE3-42 in brains of the tg het mice and no human A ⁇ pE3-42 in brains of the wt mice (see figure 10) .
  • the ELISA according to the present invention delivers high signals and consequently a very acceptable LOQ and is thus suitable for analysis of formic acid samples, in particular of formic acid brain samples.
  • N3pE antibodies of the present invention A ⁇ pE3-x was stained in brain sections of patients in the late stage of sporadic Alzheimer's disease (SAD) and familial forms of Alzheimer's disease (FAD), i.e. patients which bear a mutation in the presenilin 1 (PSl) gene.
  • SAD sporadic Alzheimer's disease
  • FAD familial forms of Alzheimer's disease
  • the stained brain sections are shown in figue 11.
  • Figure 11 shows that the N3pE antibodies of the present invention are suitable for immunohistochemistry.
  • the antibodies specifically detect pGlu-A ⁇ in brain of SAD and FAD patients.
  • the N3pE antibodies show no background signals on the images, which proves the specific binding shown by ELISA and SPR analysis .
  • the main aim of the present invention was the establishment of a highly sensitive and robust detection technique that allows quantitative determination of A ⁇ variants in biological samples.
  • an ELISA based technique should be pursued.
  • the task was started with A ⁇ N3pE ELISA, because for this A ⁇ variant an appropriate ELISA system was already commercially available (IBL) . This system was used as reference and internal quality control .

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/EP2009/058803 2008-07-21 2009-07-10 Diagnostic antibody assay Ceased WO2010009987A2 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
AU2009273387A AU2009273387B9 (en) 2008-07-21 2009-07-10 Diagnostic antibody assay
EA201100231A EA028427B1 (ru) 2008-07-21 2009-07-10 АНТИТЕЛО, СВЯЗЫВАЮЩЕЕСЯ С Aβ-ПЕПТИДАМИ ИЛИ ИХ ВАРИАНТАМИ, КОМПОЗИЦИЯ, СОДЕРЖАЩАЯ ЭТО АНТИТЕЛО, И ЕГО ПРИМЕНЕНИЕ
JP2011519110A JP5828762B2 (ja) 2008-07-21 2009-07-10 診断用抗体アッセイ
CN200980132674.4A CN102131519B (zh) 2008-07-21 2009-07-10 诊断抗体测定
BRPI0916366-2A BRPI0916366B1 (pt) 2008-07-21 2009-07-10 Anticorpo que se liga às variantes de peptídeos abeta, sua composição, seu uso, seu kit de diagnóstico, e linhagem celular de hibridoma
KR1020117003879A KR101706789B1 (ko) 2008-07-21 2009-07-10 진단용 항체 검사법
MX2011000875A MX2011000875A (es) 2008-07-21 2009-07-10 Ensayo de anticuerpo de diagnostico.
EP09780421.5A EP2320942B1 (en) 2008-07-21 2009-07-10 Diagnostic antibody assay
CA2731044A CA2731044C (en) 2008-07-21 2009-07-10 Diagnostic antibody assay
NZ590563A NZ590563A (en) 2008-07-21 2009-07-10 Diagnostic antibody assay
HK11113456.7A HK1158946B (en) 2008-07-21 2009-07-10 Diagnostic antibody assay
IL210225A IL210225A (en) 2008-07-21 2010-12-23 Antibodies that bind to a beta protein and diagnostic preparations and kits that contain them
ZA2011/00178A ZA201100178B (en) 2008-07-21 2011-01-06 Diagnostic antibody assay

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US8230908P 2008-07-21 2008-07-21
US61/082,309 2008-07-21

Publications (2)

Publication Number Publication Date
WO2010009987A2 true WO2010009987A2 (en) 2010-01-28
WO2010009987A3 WO2010009987A3 (en) 2010-05-20

Family

ID=41059893

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2009/058803 Ceased WO2010009987A2 (en) 2008-07-21 2009-07-10 Diagnostic antibody assay

Country Status (15)

Country Link
US (3) US8058405B2 (enExample)
EP (4) EP3338796A1 (enExample)
JP (2) JP5828762B2 (enExample)
KR (1) KR101706789B1 (enExample)
CN (2) CN105481980A (enExample)
AU (1) AU2009273387B9 (enExample)
BR (1) BRPI0916366B1 (enExample)
CA (1) CA2731044C (enExample)
EA (1) EA028427B1 (enExample)
HK (1) HK1222397A1 (enExample)
IL (1) IL210225A (enExample)
MX (1) MX2011000875A (enExample)
NZ (1) NZ590563A (enExample)
WO (1) WO2010009987A2 (enExample)
ZA (1) ZA201100178B (enExample)

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012021469A1 (en) 2010-08-12 2012-02-16 Eli Lilly And Company ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF
WO2012136552A1 (en) 2011-04-08 2012-10-11 H. Lundbeck A/S ANTIBODIES SPECIFIC TO PYROGLUTAMATED Αβ
CN103459421A (zh) * 2011-03-16 2013-12-18 前体生物药物股份公司 诊断性抗体测定
WO2016097305A1 (en) 2014-12-19 2016-06-23 Probiodrug Ag Novel method for the detection of pglu-abeta peptides
WO2017009459A3 (en) * 2015-07-16 2017-03-16 Probiodrug Ag Anti-pyroglutamated amyloid beta humanized antibodies
WO2018005282A1 (en) 2016-07-01 2018-01-04 Eli Lilly And Company ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF
US9944696B2 (en) 2016-01-15 2018-04-17 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
WO2018083628A1 (en) * 2016-11-03 2018-05-11 Janssen Pharmaceutica Nv ANTIBODIES TO PYROGLUTAMATE AMYLOID-β AND USES THEREOF
EP3521308A1 (en) 2018-01-31 2019-08-07 Probiodrug AG Humanized and de-immunized antibodies
US10647759B2 (en) 2017-04-20 2020-05-12 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
WO2021180782A1 (en) 2020-03-10 2021-09-16 Lifearc Cyclic peptides
US11236155B2 (en) 2019-03-26 2022-02-01 Janssen Pharmaceutica Nv Antibodies to pyroglutamate amyloid-β and uses thereof
WO2022150735A1 (en) 2021-01-11 2022-07-14 Eli Lilly And Company Anti-n3pglu amyloid beta antibodies and uses thereof
WO2022192639A2 (en) 2021-03-12 2022-09-15 Eli Lilly And Company Anti-n3pglu amyloid beta antibodies and uses thereof
WO2022192636A1 (en) 2021-03-12 2022-09-15 Eli Lilly And Company Anti-amyloid beta antibodies and uses thereof
WO2023076970A1 (en) 2021-10-29 2023-05-04 Eli Lilly And Company Compounds and methods targeting interleukin-34
WO2023077042A1 (en) 2021-10-29 2023-05-04 Eli Lilly And Company Compounds and methods targeting interleukin-34
WO2023076971A1 (en) 2021-10-29 2023-05-04 Eli Lilly Company Compounds and methods targeting interleukin-34
WO2023076995A1 (en) 2021-10-29 2023-05-04 Eli Lilly And Company Compounds and methods targeting interleukin-34
WO2024133925A1 (en) 2022-12-22 2024-06-27 Bioarctic Ab Antibody which binds to abetape3
EP4185599A4 (en) * 2020-07-22 2024-08-28 Fog Pharmaceuticals, Inc. STAPLED PEPTIDES AND RELATED USES
WO2025262228A1 (en) 2024-06-20 2025-12-26 Bioarctic Ab Bispecific binding molecule

Families Citing this family (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011151076A2 (en) * 2010-06-04 2011-12-08 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts, Universitätsmedizin MONOCLONAL ANTIBODIES TARGETING Αβ OLIGOMERS
WO2012021475A2 (en) * 2010-08-12 2012-02-16 Eli Lilly And Company ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF
PL2888592T3 (pl) 2012-08-21 2018-03-30 Janssen Pharmaceutica Nv Przeciwciała względem kwetiapiny i ich zastosowania
JP6450314B2 (ja) 2012-08-21 2019-01-09 ヤンセン ファーマシューティカ エヌ.ベー. クエチアピンハプテンに対する抗体及びその使用
JP6389176B2 (ja) 2012-08-21 2018-09-12 ヤンセン ファーマシューティカ エヌ.ベー. アリピプラゾールハプテンに対する抗体及びその使用
JP2015529199A (ja) 2012-08-21 2015-10-05 オルソ−クリニカル ダイアグノスティクス,インコーポレイティド パリペリドンハプテンに対する抗体及びその使用
EP2888284B1 (en) 2012-08-21 2022-07-06 Janssen Pharmaceutica NV Antibodies to risperidone haptens and use thereof
ES2691092T3 (es) 2012-08-21 2018-11-23 Janssen Pharmaceutica Nv Anticuerpos contra la risperidona y uso de los mismos
CA2882596C (en) 2012-08-21 2019-05-14 Ortho-Clinical Diagnostics, Inc. Antibodies to olanzapine and use thereof
WO2014031656A1 (en) 2012-08-21 2014-02-27 Ortho-Clinical Diagnostics, Inc Antibodies to olanzapine haptens and use thereof
JP2015527365A (ja) 2012-08-21 2015-09-17 オルソ−クリニカル ダイアグノスティクス,インコーポレイティド パリペリドンに対する抗体及びその使用
CA2882562C (en) 2012-08-21 2019-08-27 Eric Hryhorenko Antibodies to aripiprazole and use thereof
JP6131414B2 (ja) 2012-08-21 2017-05-24 ヤンセン ファーマシューティカ エヌ.ベー. アリピプラゾールのハプテン及びイムノアッセイにおけるそれらの使用
KR20160144416A (ko) * 2014-04-04 2016-12-16 오토텔릭 엘엘씨 파클리탁셀의 약물동태-유도된 투여를 위해 혈장 중의 파클리탁셀 농도를 모니터링하는 방법, 장치 및 시약
US9714953B2 (en) 2014-04-04 2017-07-25 Autotelic Llc Methods, devices, and reagents for monitoring paclitaxel concentration in plasma for pharmacokinetic-guided dosing of paclitaxel
WO2015175769A1 (en) 2014-05-15 2015-11-19 Biogen Ma Inc. Methods for the detection of amyloid beta oligomers in biological samples
US10758612B2 (en) 2015-07-15 2020-09-01 Washington University Antibodies to tumor associated complex N-glycans with terminal GlcNAcβ residues and methods of use thereof
EP3390449A1 (en) 2015-12-17 2018-10-24 Janssen Pharmaceutica N.V. Antibodies to risperidone and use thereof
US10435478B2 (en) 2015-12-17 2019-10-08 Janssen Pharmaceutica Nv Antibodies to quetiapine and use thereof
CN121324641B (zh) * 2025-12-15 2026-04-21 中国农业科学院哈尔滨兽医研究所(中国动物卫生与流行病学中心哈尔滨分中心) 一种检测内罗毕羊病病毒的试剂盒

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US7179892B2 (en) * 2000-12-06 2007-02-20 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
PE20020574A1 (es) * 2000-12-06 2002-07-02 Wyeth Corp Anticuerpos humanizados que reconocen el peptido amiloideo beta
WO2003015691A2 (en) * 2001-08-17 2003-02-27 Eli Lilly And Company RAPID IMPROVEMENT OF COGNITION IN CONDITIONS RELATED TO A$g(b)
WO2003016467A2 (en) * 2001-08-17 2003-02-27 Eli Lilly And Company Use of antibodies having high affinity for soluble ass to treat conditions and diseases related to ass
JP2006500905A (ja) * 2002-02-13 2006-01-12 ルードヴィッヒ インスティテュート フォー キャンサー リサーチ ヒト化gm−csf抗体
AR038568A1 (es) * 2002-02-20 2005-01-19 Hoffmann La Roche Anticuerpos anti-a beta y su uso
US7122374B1 (en) * 2002-04-09 2006-10-17 Takaomi Saido Amyloid beta-protein 3(pE)-42 antibodies and uses thereof
WO2004013172A2 (en) 2002-07-24 2004-02-12 Innogenetics N.V. Fragments of beta-amyloid as targets for vaccination against alzheimer disease
US20040146512A1 (en) 2002-10-09 2004-07-29 Arnon Rosenthal Methods of treating Alzheimer's disease using antibodies directed against amyloid beta peptide and compositions thereof
WO2004098591A2 (en) * 2003-05-05 2004-11-18 Probiodrug Ag Inhibitors of glutaminyl cyclase and their use in the treatment of neurological diseases
EP1961416B1 (en) * 2003-05-05 2013-01-23 Probiodrug AG Use of inhibitors of glutaminyl cyclase for treating psoriasis, rheumatoid arthritis or atherosclerosis.
EP1480041A1 (en) * 2003-05-22 2004-11-24 Innogenetics N.V. Method for the prediction, diagnosis and differential diagnosis of Alzheimer's disease
CA2554809C (en) 2004-02-05 2014-04-29 Probiodrug Ag Novel n-alkyl thiourea- and thioamide-substituted imidazolyl inhibitors of glutaminyl cyclase
EP1959996A2 (en) 2005-12-12 2008-08-27 AC Immune S.A. Monoclonal antibody
SI2074145T1 (sl) 2006-10-02 2017-12-29 Ac Immune S.A. Humanizirano protitelo proti amiloid beta
ES2481442T3 (es) 2006-11-09 2014-07-30 Probiodrug Ag Inhibidores novedosos de glutaminil ciclasa
US8278345B2 (en) 2006-11-09 2012-10-02 Probiodrug Ag Inhibitors of glutaminyl cyclase
WO2008055947A1 (en) 2006-11-09 2008-05-15 Probiodrug Ag Novel inhibitors of glutaminyl cyclase
ATE554085T1 (de) 2006-11-30 2012-05-15 Probiodrug Ag Neue inhibitoren von glutaminylcyclase
JP5612860B2 (ja) 2007-03-09 2014-10-22 プロビオドルグ エージー グルタミニルシクラーゼ阻害剤としてのイミダゾ[1,5−a]ピリジン誘導体
EP2160380B1 (en) 2007-04-18 2014-04-02 Probiodrug AG Cyano-guanidine derivatives as glutaminyl cyclase inhibitors
ES2468551T3 (es) 2007-04-18 2014-06-16 Probiodrug Ag Derivados de nitrovinil-diamina como inhibidores de la glutaminil ciclasa
WO2008128986A1 (en) 2007-04-18 2008-10-30 Probiodrug Ag Urea derivatives as glutaminyl cyclase inhibitors
EP2142514B1 (en) 2007-04-18 2014-12-24 Probiodrug AG Thiourea derivatives as glutaminyl cyclase inhibitors
DK2160389T3 (da) 2007-04-18 2014-06-23 Probiodrug Ag Thioxoquinazolinonderivater som glutaminylcyclaseinhibitorer
WO2008128984A1 (en) 2007-04-20 2008-10-30 Probiodrug Ag Aminopyrimidine derivatives as glutaminyl cyclase inhibitors
AU2008297070A1 (en) 2007-09-12 2009-03-19 Probiodrug Ag Transgenic mice
EP2274746A1 (en) * 2008-04-29 2011-01-19 SanDisk IL Ltd. Non-volatile multilevel memory with adaptive setting of reference voltage levels for program, verify and read

Cited By (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3042917A1 (en) 2010-08-12 2016-07-13 Eli Lilly and Company Anti-n3pglu amyloid beta peptide antibodies and uses thereof
CN105111308B (zh) * 2010-08-12 2019-03-12 伊莱利利公司 抗N3pGlu淀粉样蛋白BETA肽抗体及其用途
CN103068848A (zh) * 2010-08-12 2013-04-24 伊莱利利公司 抗N3pGlu淀粉样蛋白BETA肽抗体及其用途
CN105111308A (zh) * 2010-08-12 2015-12-02 伊莱利利公司 抗N3pGlu淀粉样蛋白BETA肽抗体及其用途
US8679498B2 (en) 2010-08-12 2014-03-25 Eli Lilly And Company Anti-N3PGLU amyloid beta peptide antibodies and uses thereof
US8961972B2 (en) 2010-08-12 2015-02-24 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
WO2012021469A1 (en) 2010-08-12 2012-02-16 Eli Lilly And Company ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF
CN103068848B (zh) * 2010-08-12 2015-11-25 伊莱利利公司 抗N3pGlu淀粉样蛋白BETA肽抗体及其用途
CN103459421B (zh) * 2011-03-16 2017-07-14 前体生物药物股份公司 诊断性抗体测定
CN103459421A (zh) * 2011-03-16 2013-12-18 前体生物药物股份公司 诊断性抗体测定
WO2012136552A1 (en) 2011-04-08 2012-10-11 H. Lundbeck A/S ANTIBODIES SPECIFIC TO PYROGLUTAMATED Αβ
US9499610B2 (en) 2011-04-08 2016-11-22 H. Lundbeck A/S Antibodies specific to pyroglutamated Aβ
US10472414B2 (en) 2011-04-08 2019-11-12 H. Lundbeck A/S Antibodies specific to pyroglutamated Aβ
WO2016097305A1 (en) 2014-12-19 2016-06-23 Probiodrug Ag Novel method for the detection of pglu-abeta peptides
US10603367B2 (en) 2015-07-16 2020-03-31 Probiodrug Ag Humanized antibodies
WO2017009459A3 (en) * 2015-07-16 2017-03-16 Probiodrug Ag Anti-pyroglutamated amyloid beta humanized antibodies
IL256579B2 (en) * 2015-07-16 2023-03-01 Probiodrug Ag Human antibodies
IL256579B (en) * 2015-07-16 2022-11-01 Probiodrug Ag Human antibodies
AU2016293104B2 (en) * 2015-07-16 2022-08-11 Vivoryon Therapeutics N.V. Anti-pyroglutamated amyloid beta humanized antibodies
EA038120B1 (ru) * 2015-07-16 2021-07-08 Пробайодраг Аг Гуманизированные антитела к пироглутаматному варианту бета-амилоида
US9944696B2 (en) 2016-01-15 2018-04-17 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
US11312763B2 (en) 2016-07-01 2022-04-26 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
WO2018005282A1 (en) 2016-07-01 2018-01-04 Eli Lilly And Company ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF
EP4272828A2 (en) 2016-07-01 2023-11-08 Eli Lilly and Company Anti-n3pglu amyloid beta peptide antibodies and uses thereof
US11673943B2 (en) 2016-11-03 2023-06-13 Janssen Pharmaceutica Nv Methods of binding amyloid beta protein having pyroglutamate at the third amino acid residue (3pE abeta) in vivo using anti-3pE abeta antibodies or antigen-binding fragments thereof
US10851156B2 (en) 2016-11-03 2020-12-01 Janssen Pharmaceutica Nv Methods of detecting pyroglutamate amyloid beta protein (3pE Aβ) using anti-3pE Aβ antibodies
CN109922826A (zh) * 2016-11-03 2019-06-21 詹森药业有限公司 焦谷氨酸淀粉样蛋白-β的抗体及其用途
WO2018083628A1 (en) * 2016-11-03 2018-05-11 Janssen Pharmaceutica Nv ANTIBODIES TO PYROGLUTAMATE AMYLOID-β AND USES THEREOF
US10519223B2 (en) 2016-11-03 2019-12-31 Jannsen Pharmaceutica Nv Antibodies to pyroglutamate amyloid-β and uses thereof
US10647759B2 (en) 2017-04-20 2020-05-12 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
US11078261B2 (en) 2017-04-20 2021-08-03 Eli Lilly And Company Anti-N3pGlu amyloid beta peptide antibodies and uses thereof
WO2019149689A1 (en) 2018-01-31 2019-08-08 Probiodrug Ag Humanized and de-immunized antibodies
EP3521308A1 (en) 2018-01-31 2019-08-07 Probiodrug AG Humanized and de-immunized antibodies
US11236155B2 (en) 2019-03-26 2022-02-01 Janssen Pharmaceutica Nv Antibodies to pyroglutamate amyloid-β and uses thereof
WO2021180782A1 (en) 2020-03-10 2021-09-16 Lifearc Cyclic peptides
EP4185599A4 (en) * 2020-07-22 2024-08-28 Fog Pharmaceuticals, Inc. STAPLED PEPTIDES AND RELATED USES
WO2022150735A1 (en) 2021-01-11 2022-07-14 Eli Lilly And Company Anti-n3pglu amyloid beta antibodies and uses thereof
WO2022192639A2 (en) 2021-03-12 2022-09-15 Eli Lilly And Company Anti-n3pglu amyloid beta antibodies and uses thereof
WO2022192636A1 (en) 2021-03-12 2022-09-15 Eli Lilly And Company Anti-amyloid beta antibodies and uses thereof
WO2023076971A1 (en) 2021-10-29 2023-05-04 Eli Lilly Company Compounds and methods targeting interleukin-34
WO2023076995A1 (en) 2021-10-29 2023-05-04 Eli Lilly And Company Compounds and methods targeting interleukin-34
WO2023077042A1 (en) 2021-10-29 2023-05-04 Eli Lilly And Company Compounds and methods targeting interleukin-34
WO2023076970A1 (en) 2021-10-29 2023-05-04 Eli Lilly And Company Compounds and methods targeting interleukin-34
WO2024133925A1 (en) 2022-12-22 2024-06-27 Bioarctic Ab Antibody which binds to abetape3
WO2025262228A1 (en) 2024-06-20 2025-12-26 Bioarctic Ab Bispecific binding molecule

Also Published As

Publication number Publication date
EP3047854A1 (en) 2016-07-27
CN102131519A (zh) 2011-07-20
KR20110031989A (ko) 2011-03-29
JP6307483B2 (ja) 2018-04-04
AU2009273387B2 (en) 2014-12-04
MX2011000875A (es) 2011-04-05
US9676843B2 (en) 2017-06-13
EP2320942A2 (en) 2011-05-18
US20100021478A1 (en) 2010-01-28
US9156907B2 (en) 2015-10-13
US8058405B2 (en) 2011-11-15
WO2010009987A3 (en) 2010-05-20
BRPI0916366A2 (pt) 2018-05-29
US20120064547A1 (en) 2012-03-15
AU2009273387B9 (en) 2015-06-11
EA201100231A1 (ru) 2011-08-30
EP3338795A1 (en) 2018-06-27
CN105481980A (zh) 2016-04-13
EP3338796A1 (en) 2018-06-27
BRPI0916366B1 (pt) 2021-08-10
IL210225A0 (en) 2011-03-31
CA2731044C (en) 2020-07-14
EP2320942B1 (en) 2018-03-14
AU2009273387A1 (en) 2010-01-28
EA028427B1 (ru) 2017-11-30
JP5828762B2 (ja) 2015-12-09
CA2731044A1 (en) 2010-01-28
CN102131519B (zh) 2016-01-13
HK1222397A1 (zh) 2017-06-30
EP3047854B1 (en) 2018-03-21
ZA201100178B (en) 2012-02-29
IL210225A (en) 2015-09-24
US20160053001A1 (en) 2016-02-25
JP2016028064A (ja) 2016-02-25
HK1158946A1 (zh) 2012-07-27
JP2011528561A (ja) 2011-11-24
NZ590563A (en) 2012-06-29
KR101706789B1 (ko) 2017-02-14

Similar Documents

Publication Publication Date Title
US9676843B2 (en) Uses of antibodies directed against amyloid-β
US9657089B2 (en) Diagnostic antibody assay
HK1158946B (en) Diagnostic antibody assay
HK1192568A (en) Diagnostic antibody assay
HK1192568B (en) Diagnostic antibody assay

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980132674.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09780421

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 210225

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 5023/KOLNP/2010

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2731044

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 590563

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2009273387

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2011519110

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2011/000875

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2009273387

Country of ref document: AU

Date of ref document: 20090710

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201100231

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 20117003879

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2009780421

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0916366

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20110119

WWW Wipo information: withdrawn in national office

Ref document number: 590563

Country of ref document: NZ