WO2009021708A2 - Ivig modulation of chemokines for treatment of multiple sclerosis, alzheimer's disease, and parkinson's disease - Google Patents

Ivig modulation of chemokines for treatment of multiple sclerosis, alzheimer's disease, and parkinson's disease Download PDF

Info

Publication number
WO2009021708A2
WO2009021708A2 PCT/EP2008/006608 EP2008006608W WO2009021708A2 WO 2009021708 A2 WO2009021708 A2 WO 2009021708A2 EP 2008006608 W EP2008006608 W EP 2008006608W WO 2009021708 A2 WO2009021708 A2 WO 2009021708A2
Authority
WO
WIPO (PCT)
Prior art keywords
disease
multiple sclerosis
parkinson
alzheimer
ivig
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2008/006608
Other languages
English (en)
French (fr)
Other versions
WO2009021708A3 (en
Inventor
Birgit Reipert
Hartmut Ehrlich
Hans-Peter Schwarz
Irina Elovaara
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Baxter Healthcare SA
Baxter International Inc
Original Assignee
Baxter Healthcare SA
Baxter International Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Baxter Healthcare SA, Baxter International Inc filed Critical Baxter Healthcare SA
Priority to EP08785488A priority Critical patent/EP2191014B1/en
Priority to ES08785488T priority patent/ES2416719T3/es
Priority to JP2010520478A priority patent/JP5555626B2/ja
Priority to AU2008286361A priority patent/AU2008286361B2/en
Priority to CA2695972A priority patent/CA2695972A1/en
Publication of WO2009021708A2 publication Critical patent/WO2009021708A2/en
Publication of WO2009021708A3 publication Critical patent/WO2009021708A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/118Prognosis of disease development
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/136Screening for pharmacological compounds
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers

Definitions

  • MS Multiple sclerosis
  • the pathogenesis of the disease is associated with the infiltration of immune cells, mainly activated T cells, into the brain (Sospedra M. and Martin R., Annu Rev Immunol, 23:683-747 (2005)). This infiltration is accompanied by a disruption of the blood-brain barrier (van Horssen J. et al , JNeuropathol Exp Neurol, 66:321-8 (2007)).
  • Intravenous immunoglobulins have been shown to be effective in the treatment of a number of autoimmune diseases including MS (Sospedra M. and Martin R., Immunology of Multiple Sclerosis. Annu Rev Immunol, 23:683-747 (2005)), but the exact mechanisms of action underlying the immunomodulatory activities of IVIG have not been fully explained.
  • MS Sospedra M. and Martin R., Immunology of Multiple Sclerosis. Annu Rev Immunol, 23:683-747 (2005)
  • There are several models that try to explain the immunomodulatory efficacy of ⁇ VIG in patients suffering from autoimmune and inflammatory diseases Kerazatchkine M.D. et al, Mult Scler, 2:24-6; 33:24-26 (2000); Trebst C. and Stangel M., Curr. Pharm. Design, 12:241-2493 (2006)).
  • IVIG decreased the relapse rate in MS patients and the number of gadolinium-enhancing lesions seen on brain magnetic resonance imaging (MRI) (Dudesek A. and Zettl U.K., J. Neurol, 253; V/50-V/58)). Furthermore, IVIG was shown to suppress proliferation of activated peripheral T cells (Bayry J. et al , Neurol Sci, 4:217-221 (2003); Stangel M. and Gold R., Nervenstoff, (2005)). Auto-reactive peripheral T cells can cross the blood-brain barrier and are believed to be the main effector cells responsible for brain inflammation (Sospedra M. and Martin R., Annu Rev Immunol, 23:683-747 (2005); Helling N. et al., Immunol Res., 1:27-51 (2002)). Therefore, a modulation of T cell function by IVIG could explain the beneficial therapeutic effect of IVIG seen in MS patients.
  • MRI brain magnetic resonance imaging
  • IVIG is an effective alternative treatment for patients with acute exacerbations in relapsing-remitting multiple sclerosis (RRMS)
  • RRMS relapsing-remitting multiple sclerosis
  • microglia the resident innate immune cells, play a major role in inflammatory processes of the brain and are known to be associated not only with MS but also with Alzheimers' disease and in Parkinsons' disease (see, e.g, Yamamoto et al, Am. J. Pathology 166:1475 (2006); Huang et al., FASEB 19:761 (2005); Kim et al, Exp. And MoI. Med. 38:333 (2006)).
  • the present invention provides new prognostic markers to predict treatment success associated with the administration of intravenous immunoglobulin treatment as well as new therapeutic targets that may be exploited in the treatment of MS, e.g., relapsing-remitting multiple sclerosis (RRMS), Parkinsons' disease or Alzheimers disease.'
  • RRMS relapsing-remitting multiple sclerosis
  • the present invention provides methods for providing a prognosis of treatment of multiple sclerosis, Parkinson's disease and Alzheimer's disease using molecular markers that are overexpressed or underexpressed in patients treated with intravenous immunoglobulins (IVIG). Also provided are methods to identify compounds that are useful for the treatment or prevention of multiple sclerosis.
  • the subtype of multiple sclerosis is relapsing-remitting multiple sclerosis (RRMS).
  • the present invention provides method of providing a prognosis of multiple sclerosis, Parkinson's disease and Alzheimer's disease in a subject treated with intravenous immunoglobulin (IVIG) by contacting a biological sample from the subject treated with IVIG with a reagent that specifically binds to at least one marker selected from any of the nucleic acids and corresponding protein sequences shown in Table 3 a, Table 3 b, and Table 4, and then determining whether or not the marker is overexpressed or underexpressed in the sample, thus providing a prognosis for MS, Parkinson's disease and Alzheimer's disease in a subject treated with IVIG.
  • IVIG intravenous immunoglobulin
  • the multiple sclerosis is of the relapsing-remitting multiple sclerosis (RRMS) subtype.
  • the reagent is an antibody, such as a monoclonal antibody.
  • the reagent can be a nucleic acid, including an oligonucleotide or an RT PCR primer set.
  • the sample is a blood sample, which can contain T cells.
  • the sample can also be cerebrospinal fluid.
  • one of the markers is a chemokine. Examples of chemokines include: CXCL3, CXCL5, CCLl 3, and XCL2.
  • Another embodiment of the invention provides a method of identifying a compound that prevents or treats multiple sclerosis, Parkinson's disease and Alzheimer's disease by contacting a compound with a sample comprising a cell that expresses a marker selected from any of the nucleic acid and corresponding protein sequences shown in Table 3a, Table 3b, Table 3c, Table 3d, and Table 4, and then determining the functional effect of the compound on the marker, thus identifying a compound that prevents or treats MS, Parkinson's disease and Alzheimer's disease.
  • the multiple sclerosis is of the relapsing-remitting multiple sclerosis (RRMS) subtype.
  • the functional effect is an increase or decrease in expression of the marker. In other aspects, the functional effect is an increase or decrease in activity of the marker.
  • compounds used in various aspects of this embodiment include: a small molecule, a siRNA, a ribozyme, an antibody, which can be a monoclonal antibody.
  • a further embodiment of the invention provides a method of treating or preventing multiple sclerosis, Parkinson's disease and Alzheimer's disease in a subject by administering to the subject an effective amount of an antibody which binds a chemokine, including CXCL5, CXCL3, and CCLl 3, in which the effective amount is sufficient to inactivate the chemokine or chemokine cell signaling, thus treating or preventing multiple sclerosis, Parkinson's disease and Alzheimer's disease.
  • the multiple sclerosis is of the relapsing-remitting multiple sclerosis (RRMS) subtype.
  • a yet further embodiment of the invention provides a method of treating or preventing multiple sclerosis, Parkinson's disease and Alzheimer's disease in a subject by administering to the subject an effective amount of an antibody which binds a chemokine receptor, including receptors for CXCL5, CXCL3, and CCLl 3, in which the effective amount is sufficient to inactivate the function of the chemokine receptor, thus treating or preventing multiple sclerosis, Parkinson's disease and Alzheimer's disease.
  • the multiple sclerosis is of the relapsing-remitting multiple sclerosis (RRMS) subtype.
  • Another embodiment of this invention provides a method of treating or preventing multiple sclerosis, Parkinson's disease and Alzheimer's disease in a subject by administering to the subject an effective amount of an antibody which binds to a XCL2 chemokine receptor, in which the effective amount is sufficient to activate the XCL2 chemokine receptor, thus treating or preventing multiple sclerosis, Parkinson's disease and Alzheimer's disease.
  • the multiple sclerosis is of the relapsing-remitting multiple sclerosis (RRMS) subtype.
  • Figure 1 shows development of EDSS scores in 10 RRMS patients during treatment with rVIG.
  • BOX plots containing the median, 25% and 75% percentile, minimum and maximum, demonstrate the EDSS scores of patients during remission, as well as before and after treatment with FVIG during relapse.
  • Figure 2 shows that treatment with FVIG does not alter the cellular composition of cells obtained for isolation of RNA.
  • Relative gene expression data obtained from microarray analysis are presented for CD3, CD4, CD8 and CD14.
  • Gene expression on day 0 was set as 1 and compared with gene expression on day 6 (A) and day 26 (B). Each point represents an individual patient.
  • Figure 3 shows real-time PCR demonstrating the expression of representative genes. Box plots containing the median, 25% and 75% percentile, minimum and maximum, demonstrate the relative expression of the indicated genes. Expression of genes was normalized to an endogenous control (glyceraldhyde-3 -phosphate dehydrogenase). Real-time PCR experiments were done in triplets and confirmed at least two times on different days.
  • MS Multiple sclerosis
  • CNS central nervous system
  • the leaks in the blood-brain barrier cause a number of other damaging effects such as brain swelling, activation of macrophages, and further secretion of cytokines and other proteolytic proteins such as matrix metalloproteinases.
  • the final outcome of these pathological processes is neuronal demyelination. See, e.g., Calabresi, P. A., American Family Physician, 70: 1935-1944 (2004), for review.
  • multiple sclerosis refers to the multiple scars (or scleroses) found on myelin sheaths in affected individuals. This scarring causes symptoms which may vary widely depending upon the extent of scarring and which neuronal pathways are disrupted.
  • MS Among the symptoms and manifestations of MS include changes in sensation (hypoesthesia), muscle weakness, abnormal muscle spasms, difficulties in movement; difficulties with coordination and balance (ataxia); problems in speech (dysarthria) or swallowing (dysphagia), visual problems (nystagmus, optic neuritis, or diplopia), fatigue and acute or chronic pain syndromes, bladder and bowel difficulties, cognitive impairment, or emotional symptomatology (e.g., depression).
  • a number of diagnostic tests are currently in use for the diagnosis of MS. These include the clinical presentation of two separate episodes of neurologic symptoms characteristic of MS, along with the finding of consistent abnormalities on physical examination.
  • magnetic resonance imaging (MRI) of the brain and spine is often used to evaluate individuals with suspected MS. MRI reveals areas of demyelination as bright lesions on T2-weighted images or FLAIR (fluid attenuated inversion recovery) sequences. Gadolinium contrast can be used to demonstrate active plaques on Tl -weighted images.
  • CSF cerebrospinal fluid
  • oligoclonal bands which are immunoglobulins found in 85% to 95% of people with definite MS.
  • oligoclonal bands When combined with MRI and clinical data, the presence of oligoclonal bands can help make a definite diagnosis of MS.
  • the measurement of such brain responses can also be used as a diagnostic tool.
  • These brain responses can be examined using visual evoked potentials (VEPs) and somatosensory evoked potentials (SEPs). Decreased activity on either test can reveal demyelination which may be otherwise asymptomatic. Along with other data, these exams can help uncover the widespread nerve involvement required for a definite diagnosis of MS.
  • VEPs visual evoked potentials
  • SEPs somatosensory evoked potentials
  • Relapsing-remitting MS refers to a subtype characterized by unpredictable attacks (relapses) followed by periods of months to years of relative quiet (remission) with no new signs of disease activity. Deficits suffered during the attacks may either resolve or may be permanent. Relapsing-remitting describes the initial course of 85% to 90% of individuals with MS.
  • Secondary progressive describes around 80% of those with initial relapsing- remitting MS, who then begin to have neurologic decline between their acute attacks without any definite periods of remission. This decline may include new neurologic symptoms, worsening cognitive function, or other deficits. Secondary progressive is the most common type of MS and causes the greatest amount of disability.
  • Primary progressive describes the approximately 10% of individuals who never have remission after their initial MS symptoms. Decline occurs continuously without clear attacks. The primary progressive subtype tends to affect people who are older at disease onset. [0031] Progressive relapsing describes those individuals who, from the onset of their MS, have a steady neurologic decline but also suffer superimposed attacks; and is the least common of all subtypes.
  • the phamacological agents currently in use for MS include interferons, which have been approved for use in relapsing forms of secondary progressive MS; glatiramer acetate, a synthetic medication made of four amino acids that are found in myelin, which stimulates T cells to secrete anti-inflammatory agents that reduce inflammation at lesion sites; mitoxantrone, an agent used to treat progressive, progressive-relapsing, and worsening relapsing-remitting MS; and Natalizumab, a monoclonal antibody that recognizes ⁇ 4-integrin.
  • intravenous corticosteroids such as methylprednisolone
  • RRMS relapsing-remitting symptomatic attacks
  • intravenous IgG immunoglobulins have also been used to treat MS.
  • chemokine CCLl 3 activates the chemokine receptor CCR2, which is expressed in microglia and astrocytes. Both of these cell types are associated with Parkinson's disease and Alzheimer's disease.
  • This and other markers described herein are therefore useful for drug assays, diagnostic and prognostic assays, and for therapeutic siRNA and antibody treatment for Alzheimer's disease and Parkinson's disesase.
  • Intravenous immunoglobulins have been successfully used to treat a number of autoimmune diseases of the central nervous system, including multiple sclerosis (MS).
  • MS multiple sclerosis
  • RRMS relapsing-remitting MS
  • HU- 133 microarrays from Affymetrix were used to study gene expression profiles of peripheral T cells in 10 RRMS patients before and after treatment with FVIG.
  • Patients treated with intravenous methylprednisolone were included as controls.
  • the differential expression of representative genes was confirmed by real-time polymerase chain reaction. All patients were analyzed neurologically and by brain and spinal cord magnetic resonance imaging before and after IVIG therapy.
  • CXCL3 and CXCL5 encode chemokines that are known to bind to CXCR2, a receptor essential for the regulation of oligodendrocyte migration in the brain.
  • Others encode proteins that are involved in signal transduction, proliferation or apoptosis.
  • the studies disclosed herein indicate that among the differentially expressed genes the regulation of chemokine expression in peripheral T cells is an important new mechanism of action of IVIG in patients with acute exacerbations in MS. Thus, the genes disclosed herein may serve as diagnostic markers for predicting treatment success in IVIG therapy and provide new molecular targets for drug development.
  • IVIG treatment refers generally to a composition of IgG irnmunoglubulins administered intravenously to treat a number of conditions such as immune deficiencies, inflammatory diseases, and autoimmune diseases.
  • the IgG immunoglobulins are typically pooled and prepared from serum. Whole antibodies or fragments can be used.
  • chemokine refers generally to a family of small cytokines which are secreted by various cells that promote chemotaxis in responsive cells. Chemokines have also gone by the nomenclature of SIS family of cytokines, SIG family of cytokines, SCY family of cytokines, Platelet factor-4 superfamily or intercrines. Cells that are attracted by chemokines follow a signal of increasing chemokine concentration towards the source of the chemokine.
  • chemokine family control cells of the immune system during the process of immune surveillance, such as by directing lymphocytes to the lymph nodes to allow lymphocyte surveillance invasion of pathogens through interaction with antigen- presenting cells residing in these tissues.
  • chemokines are known as homeostatic chemokines and are produced and secreted without any need to stimulate their source cell(s).
  • Some chemokines have roles in development by, e.g., promoting angiogenesis or guiding cells to tissues that provide specific signals critical for cellular maturation.
  • Other chemokines are inflammatory and are released from a wide variety of cells in response to bacterial infection, viruses and agents that cause physical damage.
  • inflammatory chemokines are often stimulated by pro-inflammatory cytokines such as interleukin 1.
  • Inflammatory chemokines function mainly as chemoattractants for leukocytes, recruiting monocytes, neutrophils and other effector cells from the blood to sites of infection or tissue damage.
  • Certain inflammatory chemokines activate cells to initiate an immune response or promote wound healing. They are released by many different cell types and serve to guide cells of both innate immune system and adaptive immune system.
  • chemokines are small proteins, with molecular masses of between 8 and 10 kDa. Chemokines also possess conserved amino acids that are important for creating their 3-dimensional or tertiary structure, such as (in most cases) four cysteines that interact with each other in pairs to create a greek key shape that is a characteristic of this class of proteins; intramolecular disulphide bonds typically join the first to third, and the second to fourth cysteine residues, numbered as they appear in the protein sequence of the chemokine.
  • CC chemokines Members of the chemokine family are categorized into four groups depending on the spacing of their first two cysteine residues.
  • the CC chemokines (or ⁇ -chemokines) have two adjacent cysteines near their amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called CC chemokine ligands (CCL)-I to - 28.
  • the first two cysteine residues in CXC chemokines (or ⁇ -chemokines) are separated by one amino acid, represented by "X".
  • CXC chemokines There have been 17 different CXC chemokines described in mammals, that are subdivided into two categories, those with a specific amino acid sequence (or motif) of Glutamic acid-Leucine-Arginine (ELR) immediately before the first cysteine of the CXC motif (ELR-positive), and those without an ELR motif (ELR- negative).
  • the third group of chemokines is known as the C chemokines (or ⁇ chemokines), and is unlike all other chemokines in that it has only two cysteines; one N-terminal cysteine and one cysteine downstream.
  • a fourth group has three amino acids between the two cysteines and is termed CX 3 C chemokine (or ⁇ -chemokines).
  • Chemokine receptors are G protein-coupled receptors containing 7 transmembrane domains that are found on the surface of leukocytes. Approximately 19 different chemokine receptors have been characterized to date, which are divided into four families depending on the type of chemokine they bind; CXCR that bind CXC chemokines, CCR that bind CC chemokines, CX3CR1 that binds the sole CX3C chemokine (CX3CL1), and XCRl that binds the two XC chemokines (XCLl and XCL2).
  • Chemokine cell signaling refers generally to the ability of chemokine receptors to associate with G-proteins to transmit cell signals following ligand binding. Activation of G proteins, by chemokine receptors, causes the subsequent activation of phospholipase C (PLC). PLC cleaves a phosphatidylinositol (4,5)-bisphosphate (PIP2) into two second messenger molecules, inositol triphosphate (IP3) and diacyl glycerol (DAG) that trigger intracellular signaling events; DAG activates another enzyme called protein kinase C (PKC), and IP3 triggers the release of calcium from intracellular stores.
  • PLC phospholipase C
  • PLC cleaves a phosphatidylinositol (4,5)-bisphosphate (PIP2) into two second messenger molecules, inositol triphosphate (IP3) and diacyl glycerol (DAG) that trigger intracellular signaling events; DAG activates
  • MAP kinase pathway that generate responses including chemotaxis, degranulation, release of superoxide anions and changes in the avidity of cell adhesion molecules such as integrins within the cell harboring the chemokine receptor.
  • the term "marker” or “biomarker” refers to a molecule (typically protein, nucleic acid, carbohydrate, or lipid) that is expressed in a cell, expressed on the surface of a cell or secreted by a cell and which is useful for providing a prognosis of relapsing-remitting multiple sclerosis (RRMS) in a subject treated with IVIG.
  • RRMS relapsing-remitting multiple sclerosis
  • Some of the biomarkers disclosed herein are molecules that are overexpressed in individuals with relapsing-remitting multiple sclerosis (RRMS) treated with FVIG, in comparison to individuals not treated IVIG or in RRMS patients prior to treatment with IVIG, for instance, 1 -fold overexpression, 2-fold overexpression, 3-fold overexpression, or more.
  • biomarkers are molecules that are underexpressed in individuals with relapsing-remitting multiple sclerosis (RRMS) treated with IVIG, in comparison to individuals not treated IVIG or in RRMS patients prior to treatment with FVIG, for instance, 1-fold underexpression, 2-fold underexpression, 3-fold underexpression, or more.
  • a marker can be a molecule that is inappropriately synthesized in individuals with relapsing-remitting multiple sclerosis (RRMS) treated with FVIG, in comparison to individuals not treated IVIG or in RRMS patients prior to treatment with IVIG, for instance, a molecule that contains deletions, additions or mutations in comparison to the molecule expressed on a normal cell.
  • markers may be used singly or in combination with other markers for any of the uses, e.g., prognosis of FVIG treatment of relapsing-remitting multiple sclerosis (RRMS), disclosed herein.
  • RRMS relapsing-remitting multiple sclerosis
  • Biological sample includes biological fluid samples, such as blood and cerebrospinal fluid, sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histologic purposes.
  • biological fluid samples include blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), cerebrospinal fluid, sputum, cervicovaginal fluid, lymph and tongue tissue, cultured cells, e.g., primary cultures, explants, and transformed cells, stool, urine, etc.
  • a biological sample is typically obtained from a eukaryotic organism, most preferably a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, Mouse; rabbit; or a bird; reptile; or fish.
  • a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, Mouse; rabbit; or a bird; reptile; or fish.
  • overexpress refers to a protein or nucleic acid (RNA) that is transcribed or translated at a detectably greater level, usually in an IVIG-treated relapsing-remitting multiple sclerosis (RRMS) patient, in comparison to a patient not undergoing IVIG treatment.
  • RNA nucleic acid
  • RRMS relapsing-remitting multiple sclerosis
  • the term includes overexpression due to transcription, post transcriptional processing, translation, post- translational processing, cellular localization (e.g., organelle, cytoplasm, nucleus, cell surface), and RNA and protein stability, as compared to a control.
  • Overexpression can be detected using conventional techniques for detecting mRNA (i.e., RT-PCR, PCR, hybridization) or proteins (i.e., ELISA, immunohistochemical techniques). Overexpression can be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a normal cell. In certain instances, overexpression is 1-fold, 2-fold, 3-fold, 4-fold or more higher levels of transcription or translation in comparison to a control.
  • underexpress refers to a protein or nucleic acid that is transcribed or translated at a detectably lower level, usually in an IVIG-treated relapsing-remitting multiple sclerosis (RRMS) patient, in comparison to a patient not undergoing IVIG treatment.
  • the term includes underexpression due to transcription, post transcriptional processing, translation, post-translational processing, cellular localization (e.g., organelle, cytoplasm, nucleus, cell surface), and RNA and protein stability, as compared to a control.
  • Underexpression can be detected using conventional techniques for detecting mRNA (i.e., RT-PCR, PCR, hybridization) or proteins (i.e., ELISA, immunohistochemical techniques). Underexpression can be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or less in comparison to a control. In certain instances, underexpression is 1-fold, 2-fold, 3-fold, 4-fold or more lower levels of transcription or translation in comparison to a control.
  • the term “differentially expressed” or “differentially regulated” refers generally to a protein or nucleic acid that is overexpressed (upregulated) or underexpressed (downregulated) in one sample compared to at least one other sample, generally in an FVIG- treated relapsing-remitting multiple sclerosis (RRMS) patient, in comparison to a patient not undergoing IVIG treatment, in the context of the present invention.
  • RRMS relapsing-remitting multiple sclerosis
  • Therapeutic treatment refers to drug therapy, hormonal therapy, immunotherapy, and biologic (targeted) therapy.
  • terapéuticaally effective amount or dose or “sufficient amount or dose” herein is meant a dose that produces effects for which it is administered.
  • the exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques ⁇ see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site http://www.ncbi.nlm.nih.gov/BLAST/ or the like).
  • sequences are then said to be "substantially identical.”
  • This definition also refers to, or may be applied to, the compliment of a test sequence.
  • the definition also includes sequences that have deletions and/or additions, as well as those that have substitutions.
  • the preferred algorithms can account for gaps and the like.
  • identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Preferably, default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, A dv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. MoI. Biol.
  • a preferred example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al, J. MoI Biol. 215:403-410 (1990), respectively.
  • BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/).
  • This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive- valued threshold score T when aligned with a word of the same length in a database sequence.
  • T is referred to as the neighborhood word score threshold (Altschul et al, supra).
  • a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form, and complements thereof.
  • the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
  • Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
  • RNAi molecule or an “siRNA” refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to reduce or inhibit expression of a gene or target gene when the siRNA expressed in the same cell as the gene or target gene.
  • siRNA thus refers to the double stranded RNA formed by the complementary strands.
  • the complementary portions of the siRNA that hybridize to form the double stranded molecule typically have substantial or complete identity.
  • an siRNA refers to a nucleic acid that has substantial or complete identity to a target gene and forms a double stranded siRNA.
  • the sequence of the siRNA can correspond to the full length target gene, or a subsequence thereof.
  • the siRNA is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded siRNA is 15-50 nucleotides in length, and the double stranded siRNA is about 15-50 base pairs in length, preferable about preferably about 20-30 base nucleotides, preferably about 20-25 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
  • An "antisense" polynucleotide is a polynucleotide that is substantially complementary to a target polynucleotide and has the ability to specifically hybridize to the target polynucleotide.
  • Ribozymes are enzymatic RNA molecules capable of catalyzing specific cleavage of RNA.
  • the composition of ribozyme molecules preferably includes one or more sequences complementary to a target mRNA, and the well known catalytic sequence responsible for mRNA cleavage or a functionally equivalent sequence (see, e.g., U.S. Pat. No. 5,093,246, which is incorporated herein by reference in its entirety).
  • Ribozyme molecules designed to catalytically cleave target mRNA transcripts can also be used to prevent translation of subject target mRNAs.
  • nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
  • nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
  • a particular nucleic acid sequence also implicitly encompasses "splice variants" and nucleic acid sequences encoding truncated forms of a protein.
  • a particular protein encoded by a nucleic acid implicitly encompasses any protein encoded by a splice variant or truncated form of that nucleic acid.
  • "Splice variants,” as the name suggests, are products of alternative splicing of a gene. After transcription, an initial nucleic acid transcript may be spliced such that different (alternate) nucleic acid splice products encode different polypeptides. Mechanisms for the production of splice variants vary, but include alternate splicing of exons.
  • Alternate polypeptides derived from the same nucleic acid by read-through transcription are also encompassed by this definition. Any products of a splicing reaction, including recombinant forms of the splice products, are included in this definition. Nucleic acids can be truncated at the 5' end or at the 3' end. Polypeptides can be truncated at the N-terminal end or the C-terminal end. Truncated versions of nucleic acid or polypeptide sequences can be naturally occurring or recombinantly created.
  • polypeptide peptide
  • protein protein
  • amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non- naturally occurring amino acid polymer.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ - carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an ⁇ carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
  • Constantly modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • TGG which is ordinarily the only codon for tryptophan
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
  • the following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M). See, e.g., Creighton, Proteins (1984).
  • a “label” or a “detectable moiety” is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means.
  • useful labels include 32 P, fluorescent dyes, electron-dense reagents, enzymes ⁇ e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins which can be made detectable, e.g., by incorporating a radiolabel into the peptide or used to detect antibodies specifically reactive with the peptide.
  • recombinant when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified.
  • recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
  • stringent hybridization conditions refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acids, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology— Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays” (1993). Generally, stringent conditions are selected to be about 5-1O 0 C lower than the thermal melting point (T m ) for the specific sequence at a defined ionic strength pH.
  • T m thermal melting point
  • the T m is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at T m , 50% of the probes are occupied at equilibrium).
  • Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide.
  • a positive signal is at least two times background, preferably 10 times background hybridization.
  • Exemplary stringent hybridization conditions can be as following: 50% formamide, 5x SSC, and 1% SDS, incubating at 42 0 C, or, 5x SSC, 1% SDS, incubating at 65 0 C, with wash in 0.2x SSC, and 0.1% SDS at 65 0 C.
  • Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical. This occurs, for example, when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code. In such cases, the nucleic acids typically hybridize under moderately stringent hybridization conditions.
  • Exemplary “moderately stringent hybridization conditions” include a hybridization in a buffer of 40% formamide, 1 M NaCl, 1% SDS at 37 0 C, and a wash in IX SSC at 45 0 C. A positive hybridization is at least twice background. Those of ordinary skill will readily recognize that alternative hybridization and wash conditions can be utilized to provide conditions of similar stringency.
  • a temperature of about 36°C is typical for low stringency amplification, although annealing temperatures may vary between about 32°C and 48°C depending on primer length.
  • a temperature of about 62°C is typical, although high stringency annealing temperatures can range from about 50 0 C to about 65°C, depending on the primer length and specificity.
  • Typical cycle conditions for both high and low stringency amplifications include a denaturation phase of 90°C - 95°C for 30 sec - 2 min., an annealing phase lasting 30 sec. - 2 min., and an extension phase of about 72°C for 1 - 2 min. Protocols and guidelines for low and high stringency amplification reactions are provided, e.g., in Innis et al. (1990) PCR Protocols, A Guide to Methods and Applications, Academic Press, Inc. N. Y.).
  • Antibody refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
  • Antibodies can be polyclonal or monoclonal, derived from serum, a hybridoma or recombinantly cloned, and can also be chimeric, primatized, or humanized.
  • An exemplary immunoglobulin (antibody) structural unit comprises a tetramer.
  • Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy” chain (about 50-70 kDa).
  • the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the terms variable light chain (V L ) and variable heavy chain (V H ) refer to these light and heavy chains respectively.
  • Antibodies exist, e.g., as intact immunoglobulins or as a number of well- characterized fragments produced by digestion with various peptidases.
  • pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)' 2j a dimer of Fab which itself is a light chain joined to VH-C H I by a disulfide bond.
  • the F(ab)' 2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)' 2 dimer into an Fab' monomer.
  • the Fab' monomer is essentially Fab with part of the hinge region ⁇ see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries ⁇ see, e.g., McCafferty et al, Nature 348:552-554 (1990)).
  • An antibody immunologically reactive with a particular biomarker protein of the present invention can be generated by recombinant methods such as selection of libraries of recombinant antibodies in phage or similar vectors, see, e.g., Huse et al., Science, 246:1275- 1281 (1989); Ward et al, Nature, 341 :544-546 (1989); and Vaughan et al, Nature Biotech, 14:309-314 (1996), or by immunizing an animal with the antigen or with DNA encoding the antigen.
  • polyclonal antibodies can be raised in a mammal, e.g., by one or more injections of an immunizing agent and, if desired, an adjuvant.
  • an immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections.
  • the immunizing agent may include a protein encoded by a nucleic acid of the figures or fragment thereof or a fusion protein thereof.
  • immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor.
  • adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
  • the immunization protocol may be selected by one skilled in the art without undue experimentation.
  • the antibodies can, alternatively, be monoclonal antibodies.
  • Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler & Milstein, Nature, 256:495 (1975).
  • a hybridoma method a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
  • the lymphocytes may be immunized in vitro.
  • PBLs peripheral blood lymphocytes
  • spleen cells or lymph node cells are used if nonhuman mammalian sources are desired.
  • the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (1986)).
  • a suitable fusing agent such as polyethylene glycol
  • Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed.
  • the hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the urifused, immortalized cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
  • HGPRT hypoxanthine guanine phosphoribosyl transferase
  • Human antibodies can be produced using various techniques known in the art, including phage display libraries (Hoogenboom & Winter, J MoI. Biol., 227:381 (1991); Marks et al., J. MoI. Biol, 222:581 (1991)). The techniques of Cole et al. and Boemer et al. are also available for the preparation of human monoclonal antibodies (Cole et al, Monoclonal Antibodies and Cancer Therapy, p. 77 (1985) and Boemer et al, J. Immunol, 147(l):86-95 (1991)).
  • human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, e.g., in U.S. Patent Nos.
  • the antibody is conjugated to an "effector" moiety.
  • the effector moiety can be any number of molecules, including labeling moieties such as radioactive labels or fluorescent labels, or can be a therapeutic moiety.
  • the antibody modulates the activity of the protein.
  • nucleic acids of the differentially expressed genes of this invention or their encoded polypeptides refer to all forms of nucleic acids (e.g., gene, pre-mRNA, mRNA) or proteins, their polymorphic variants, alleles, mutants, and interspecies homologs that (as applicable to nucleic acid or protein): (1) have an amino acid sequence that has greater than about 60% amino acid sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, or more amino acids, to a polypeptide encoded by a referenced nucleic acid or an amino acid sequence described herein; (2) specifically bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising a referenced amino acid sequence, immunogenic fragments thereof, and conservatively modified variant
  • a polynucleotide or polypeptide sequence is typically from a mammal including, but not limited to, primate, e.g., human; rodent, e.g., rat, mouse, hamster; cow, pig, horse, sheep, or any mammal.
  • the nucleic acids and proteins of the invention include both naturally occurring or recombinant molecules. Truncated and alternatively spliced forms of these antigens are included in the definition.
  • the phrase "specifically (or selectively) binds" when referring to a protein, nucleic acid, antibody, or small molecule compound refers to a binding reaction that is determinative of the presence of the protein or nucleic acid, such as the differentially expressed genes of the present invention, often in a heterogeneous population of proteins or nucleic acids and other biologies.
  • a specified antibody may bind to a particular protein at least two times the background and more typically more than 10 to 100 times background. Specific binding to an antibody under such conditions requires an antibody that is selected for its specificity for a particular protein.
  • polyclonal antibodies can be selected to obtain only those polyclonal antibodies that are specifically immunoreactive with the selected antigen and not with other proteins. This selection may be achieved by subtracting out antibodies that cross-react with other molecules.
  • a variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein.
  • solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein ⁇ see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).
  • the phrase "functional effects" in the context of assays for testing compounds that modulate a marker protein includes the determination of a parameter that is indirectly or directly under the influence of a biomarker of the invention, e.g., a chemical or phenotypic effect such as altered chemokine cell signaling.
  • a functional effect therefore includes ligand binding activity, transcriptional activation or repression, the ability of cells to proliferate, the ability to migrate, among others.
  • “Functional effects” include in vitro, in vivo, and ex vivo activities.
  • determining the functional effect is meant assaying for a compound that increases or decreases a parameter that is indirectly or directly under the influence of a biomarker of the invention, e.g., measuring physical and chemical or phenotypic effects.
  • Such functional effects can be measured by any means known to those skilled in the art, e.g., changes in spectroscopic characteristics (e.g., fluorescence, absorbance, refractive index); hydrodynamic (e.g., shape), chromatographic; or solubility properties for the protein; ligand binding assays, e.g., binding to antibodies; measuring inducible markers or transcriptional activation of the marker; measuring changes in enzymatic activity; the ability to increase or decrease cellular proliferation, apoptosis, cell cycle arrest, measuring changes in cell surface markers.
  • spectroscopic characteristics e.g., fluorescence, absorbance, refractive index
  • hydrodynamic e.g., shape
  • solubility properties for the protein e.g., changes in spectroscopic characteristics (e.g., fluorescence, absorbance, refractive index); hydrodynamic (e.g., shape), chromatographic; or solubility properties for the protein
  • ligand binding assays e.g., binding
  • the functional effects can be evaluated by many means known to those skilled in the art, e.g., microscopy for quantitative or qualitative measures of alterations in morphological features, measurement of changes in RNA or protein levels for other genes expressed in chemokine-responsive cells, measurement of RNA stability, identification of downstream or reporter gene expression (CAT, luciferase, ⁇ -gal, GFP and the like), e.g., via chemiluminescence, fluorescence, colorimetric reactions, antibody binding, inducible markers, etc.
  • Inhibitors are used to refer to activating, inhibitory, or modulating molecules identified using in vitro and in vivo assays of biomarkers responsive to FVIG treatment of relapsing-remitting multiple sclerosis (RRMS).
  • Inhibitors are compounds that, e.g., bind to, partially or totally block activity, decrease, prevent, delay activation, inactivate, desensitize, or down regulate the activity or expression of biomarkers responsive to FVIG treatment of relapsing-remitting multiple sclerosis (RRMS).
  • Activators are compounds that increase, open, activate, facilitate, enhance activation, sensitize, agonize, or up regulate activity of biomarkers responsive to IVIG treatment of relapsing-remitting multiple sclerosis (RRMS), e.g., agonists.
  • Inhibitors, activators, or modulators also include genetically modified versions of biomarkers responsive to rVIG treatment of relapsing-remitting multiple sclerosis (RRMS), e.g., versions with altered activity, as well as naturally occurring and synthetic ligands, antagonists, agonists, antibodies, peptides, cyclic peptides, nucleic acids, antisense molecules, ribozymes, RNAi molecules, small organic molecules and the like.
  • Such assays for inhibitors and activators include, e.g., expressing biomarkers responsive to IVIG treatment of relapsing-remitting multiple sclerosis (RRMS) in vitro, in cells, or cell extracts, applying putative modulator compounds, and then determining the functional effects on activity, as described above.
  • RRMS relapsing-remitting multiple sclerosis
  • Samples or assays comprising biomarkers responsive to IVIG treatment of relapsing-remitting multiple sclerosis (RRMS) that are treated with a potential activator, inhibitor, or modulator are compared to control samples without the inhibitor, activator, or modulator to examine the extent of inhibition.
  • Control samples (untreated with inhibitors) are assigned a relative protein activity value of 100%.
  • Inhibition of biomarkers responsive to IVIG treatment of relapsing-remitting multiple sclerosis (RRMS) is achieved when the activity value relative to the control is about 80%, preferably 50%, more preferably 25-0%.
  • Activation of biomarkers responsive to IVIG treatment of relapsing-remitting multiple sclerosis is achieved when the activity value relative to the control (untreated with activators) is 110%, more preferably 150%, more preferably 200-500% (i.e., two to five fold higher relative to the control), more preferably 1000-3000% higher.
  • test compound or “drug candidate” or “modulator” or grammatical equivalents as used herein describes any molecule, either naturally occurring or synthetic, e.g., protein, oligopeptide (e.g., from about 5 to about 25 amino acids in length, preferably from about 10 to 20 or 12 to 18 amino acids in length, preferably 12, 15, or 18 amino acids in length), small organic molecule, polysaccharide, peptide, circular peptide, lipid, fatty acid, siRNA, polynucleotide, oligonucleotide, etc., to be tested for the capacity to directly or indirectly modulate biomarkers responsive to IVIG treatment of relapsing-remitting multiple sclerosis (RRMS).
  • RRMS relapsing-remitting multiple sclerosis
  • the test compound can be in the form of a library of test compounds, such as a combinatorial or randomized library that provides a sufficient range of diversity.
  • Test compounds are optionally linked to a fusion partner, e.g., targeting compounds, rescue compounds, dimerization compounds, stabilizing compounds, addressable compounds, and other functional moieties.
  • a fusion partner e.g., targeting compounds, rescue compounds, dimerization compounds, stabilizing compounds, addressable compounds, and other functional moieties.
  • new chemical entities with useful properties are generated by identifying a test compound (called a "lead compound") with some desirable property or activity, e.g., inhibiting activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds.
  • HTS high throughput screening
  • a "small organic molecule” refers to an organic molecule, either naturally occurring or synthetic, that has a molecular weight of more than about 50 daltons and less than about 2500 daltons, preferably less than about 2000 daltons, preferably between about 100 to about 1000 daltons, more preferably between about 200 to about 500 daltons.
  • the present invention provides methods of providing a prognosis of IVIG treatment of multiple sclerosis, including relapsing-remitting multiple sclerosis (RRMS), Alzheimer's disease, or Parkinson's disease by detecting the expression of markers overexpressed or underexpressed in patients treated with IVIG.
  • Providing a prognosis involves determining the level of one or more IVIG responsive biomarker polynucleotides or the corresponding polypeptides in a patient or patient sample and then comparing the level to a baseline or range.
  • the baseline value is representative of levels of the polynucleotide or nucleic acid in a relapsing-remitting multiple sclerosis (RRMS) patient prior to IVIG treatment, as measured using a biological sample such as a sample of a bodily fluid (e.g., blood or cerebrospinal fluid).
  • a biological sample such as a sample of a bodily fluid (e.g., blood or cerebrospinal fluid).
  • the term "providing a prognosis” refers to providing a prediction of the probable course and outcome of treatment of a patient suffering from multiple sclerosis, including relapsing-remitting multiple sclerosis (RRMS), Alzheimer's disease, or Parkinson's disease with IVIG.
  • the methods can also be used to devise a suitable alternative or additional therapy for multiple sclerosis, including relapsing-remitting multiple sclerosis (RRMS) treatment, Alzheimer's disease, or Parkinson's disease, e.g., by indicating the failure of IVIG treatment to alleviate multiple sclerosis, including relapsing-remitting multiple sclerosis (RRMS), Alzheimer's disease, or Parkinson's disease.
  • Antibody reagents can be used in assays to detect expression levels of the biomarkers of the invention in patient samples using any of a number of immunoassays known to those skilled in the art. Immunoassay techniques and protocols are generally described in Price and Newman, "Principles and Practice of Immunoassay," 2nd Edition, Grove's Dictionaries, 1997; and Gosling, "Immunoassays: A Practical Approach," Oxford University Press, 2000. A variety of immunoassay techniques, including competitive and non-competitive immunoassays, can be used. See, e.g., Self et al, Curr. Opin.
  • immunoassay encompasses techniques including, without limitation, en2yme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MELA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL). If desired, such immunoassays can be automated.
  • EIA enzyme multiplied immunoassay technique
  • ELISA enzyme-linked immunosorbent assay
  • MAC ELISA IgM antibody capture ELISA
  • MELA microparticle enzyme immunoassay
  • CEIA capillary electrophoresis immunoassays
  • RIA radioimmunoassays
  • Immunoassays can also be used in conjunction with laser induced fluorescence. See, e.g., Schmalzing et al. , Electrophoresis, 18:2184-93 (1997); Bao, J Chromatogr. B. Biomed. ScI, 699:463-80 (1997).
  • Liposome immunoassays such as flow-injection liposome immunoassays and liposome immunosensors, are also suitable for use in the present invention. See, e.g., Rongen et al., J. Immunol. Methods, 204: 105-133 (1997).
  • nephelometry assays in which the formation of protein/antibody complexes results in increased light scatter that is converted to a peak rate signal as a function of the marker concentration, are suitable for use in the methods of the present invention.
  • Nephelometry assays are commercially available from Beckman Coulter (Brea, CA; Kit #449430) and can be performed using a Behring Nephelometer Analyzer (Fink et al., J. Clin. Chem. Clin. Biochem., 27:261-276 (1989)).
  • Direct labels include fluorescent or luminescent tags, metals, dyes, radionuclides, and the like, attached to the antibody.
  • An antibody labeled with iodine- 125 ( 125 I) can be used.
  • a chemiluminescence assay using a chemiluminescent antibody specific for the nucleic acid is suitable for sensitive, non-radioactive detection of protein levels.
  • An antibody labeled with fluorochrome is also suitable.
  • fluorochromes examples include, without limitation, DAPI, fluorescein, Hoechst 33258, R-phycocyanin, B-phycoerythrin, R-phycoerythrin, rhodamine, Texas red, and lissamine.
  • Indirect labels include various enzymes well known in the art, such as horseradish peroxidase (HRP), alkaline phosphatase (AP), ⁇ -galactosidase, urease, and the like.
  • HRP horseradish peroxidase
  • AP alkaline phosphatase
  • AP alkaline phosphatase
  • ⁇ -galactosidase urease
  • a horseradish-peroxidase detection system can be used, for example, with the chromogenic substrate tetramethylbenzidine (TMB), which yields a soluble product in the presence of hydrogen peroxide that is detectable at 450 run.
  • TMB chromogenic substrate
  • An alkaline phosphatase detection system can be used with the chromogenic substrate p-nitrophenyl phosphate, for example, which yields a soluble product readily detectable at 405 run.
  • a ⁇ - galactosidase detection system can be used with the chromogenic substrate o-nitrophenyl- ⁇ - D-galactopyranoside (ONPG), which yields a soluble product detectable at 410 nm.
  • An urease detection system can be used with a substrate such as urea-bromocresol purple (Sigma Immunochemicals; St. Louis, MO).
  • a signal from the direct or indirect label can be analyzed, for example, using a spectrophotometer to detect color from a chromogenic substrate; a radiation counter to detect radiation such as a gamma counter for detection of 125 I; or a fluorometer to detect fluorescence in the presence of light of a certain wavelength.
  • a quantitative analysis can be made using a spectrophotometer such as an EMAX Microplate Reader (Molecular Devices; Menlo Park, CA) in accordance with the manufacturer's instructions.
  • the assays of the present invention can be automated or performed robotically, and the signal from multiple samples can be detected simultaneously.
  • the antibodies can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), and the like.
  • An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
  • nucleic acid binding molecules such as probes, oligonucleotides, oligonucleotide arrays, and primers can be used in assays to detect differential RNA expression in patient samples, e.g., RT-PCR.
  • RT-PCR is used according to standard methods known in the art.
  • PCR assays such as Taqman ® assays available from, e.g., Applied Biosystems, can be used to detect nucleic acids and variants thereof.
  • qPCR and nucleic acid microarrays can be used to detect nucleic acids.
  • Reagents that bind to selected biomarkers can be prepared according to methods known to those of skill in the art or purchased commercially.
  • nucleic acids can be achieved using routine techniques such as Southern analysis, reverse-transcriptase polymerase chain reaction (RT-PCR), or any other methods based on hybridization to a nucleic acid sequence that is complementary to a portion of the marker coding sequence (e.g., slot blot hybridization) are also within the scope of the present invention.
  • Applicable PCR amplification techniques are described in, e.g., Ausubel et al and Innis et al, supra.
  • General nucleic acid hybridization methods are described in Anderson, "Nucleic Acid Hybridization," BIOS Scientific Publishers, 1999.
  • Amplification or hybridization of a plurality of nucleic acid sequences can also be performed from mRNA or cDNA sequences arranged in a microarray.
  • Microarray methods are generally described in Hardiman, “Microarrays Methods and Applications: Nuts & Bolts,” DNA Press, 2003; and Baldi et al, “DNA Microarrays and Gene Expression: From Experiments to Data Analysis and Modeling," Cambridge University Press, 2002.
  • PCR-based analysis includes a Taqman ® allelic discrimination assay available from Applied Biosystems.
  • sequence analysis include Maxam-Gilbert sequencing, Sanger sequencing, capillary array DNA sequencing, thermal cycle sequencing (Sears et al.
  • Non- limiting examples of electrophoretic analysis include slab gel electrophoresis such as agarose or polyacrylamide gel electrophoresis, capillary electrophoresis, and denaturing gradient gel electrophoresis.
  • Other methods for detecting nucleic acid variants include, e.g., the INVADER ® assay from Third Wave Technologies, Inc., restriction fragment length polymorphism (RFLP) analysis, allele-specific oligonucleotide hybridization, a heteroduplex mobility assay, single strand conformational polymorphism (SSCP) analysis, single- nucleotide primer extension (SNUPE) and pyro sequencing.
  • RFLP restriction fragment length polymorphism
  • SSCP single strand conformational polymorphism
  • SNUPE single- nucleotide primer extension
  • a detectable moiety can be used in the assays described herein.
  • a wide variety of detectable moieties can be used, with the choice of label depending on the sensitivity required, ease of conjugation with the antibody, stability requirements, and available instrumentation and disposal provisions.
  • Suitable detectable moieties include, but are not limited to, radionuclides, fluorescent dyes (e.g., fluorescein, fluorescein isothiocyanate (FITC), Oregon GreenTM, rhodamine, Texas red, tetrarhodimine isothiocynate (TRITC), Cy3, Cy5, etc.), fluorescent markers (e.g., green fluorescent protein (GFP), phycoerythrin, etc.), autoquenched fluorescent compounds that are activated by tumor-associated proteases, enzymes (e.g., luciferase, horseradish peroxidase, alkaline phosphatase, etc.), nanoparticles, biotin, digoxigenin, and the like.
  • fluorescent dyes e.g., fluorescein, fluorescein isothiocyanate (FITC), Oregon GreenTM, rhodamine, Texas red, tetrarhodimine isothiocynate (TRI
  • Useful physical formats comprise surfaces having a plurality of discrete, addressable locations for the detection of a plurality of different markers.
  • Such formats include microarrays and certain capillary devices. See, e.g., Ng et al., J. Cell MoI. Med., 6:329-340 (2002); U.S. Pat. No. 6,019,944.
  • each discrete surface location may comprise antibodies to immobilize one or more markers for detection at each location.
  • Surfaces may alternatively comprise one or more discrete particles (e.g., microparticles or nanoparticles) immobilized at discrete locations of a surface, where the microparticles comprise antibodies to immobilize one or more markers for detection.
  • Analysis can be carried out in a variety of physical formats. For example, the use of microtiter plates or automation could be used to facilitate the processing of large numbers of test samples. Alternatively, single sample formats could be developed to facilitate a prognosis in a timely fashion.
  • the antibodies or nucleic acid probes of the invention can be applied to sections of patient biopsies immobilized on microscope slides.
  • the resulting antibody staining or in situ hybridization pattern can be visualized using any one of a variety of light or fluorescent microscopic methods known in the art.
  • the various markers of the invention also provide reagents for in vivo imaging such as, for instance, the imaging of labeled regents that detect the nucleic acids or encoded proteins of the biomarkers of the invention.
  • reagents that detect the presence of proteins encoded by IVIG-responsive relapsing-remitting multiple sclerosis (RRMS) biomarkers, such as antibodies may be labeled using an appropriate marker, such as a fluorescent marker.
  • IVIG compositions comprising whole antibodies have been described for the treatment of certain autoimmune conditions. ⁇ See, e.g. , U.S. Patent Publication US 2002/0114802, US 2003/0099635, and US 2002/0098182.)
  • the IVIG compositions disclosed in these references include polyclonal antibodies.
  • Immunoglobulin preparations can be prepared from any suitable starting materials.
  • immunoglobulin preparations can be prepared from donor serum or monoclonal or recombinant immunoglobulins.
  • blood is collected from healthy donors.
  • the blood is collected from the same species of animal as the subject to which the immunoglobulin preparation will be administered (typically referred to as "homologous" immunoglobulins).
  • the immunoglobulins are isolated from the blood by suitable procedures, such as, for example, Cohn fractionation, ultracentrifugation, electrophoretic preparation, ion exchange chromatography, affinity chromatography, immunoaffinity chromatography, polyethylene glycol fractionation, or the like.
  • immunoglobulin is prepared from gamma globulin- containing products produced by the alcohol fractionation and/or ion exchange and affinity chromatography methods well known to those skilled in the art.
  • Purified Cohn Fraction II is commonly used.
  • the starting Cohn Fraction II paste is typically about 95 percent IgG and is comprised of the four IgG subtypes. The different subtypes are present in Fraction II in approximately the same ratio as they are found in the pooled human plasma from which they are obtained.
  • the Fraction II is further purified before formulation into an administrable product.
  • the Fraction II paste can be dissolved in a cold purified aqueous alcohol solution and impurities removed via precipitation and filtration.
  • the immunoglobulin suspension can be dialyzed or diafiltered (e.g., using ultrafiltration membranes having a nominal molecular weight limit of less than or equal to 100,000 daltons) to remove the alcohol.
  • the solution can be concentrated or diluted to obtain the desired protein concentration and can be further purified by techniques well known to those skilled in the art.
  • Preparative steps can be used to enrich a particular isotype or subtype of immunoglobulin.
  • protein A, protein G or protein H sepharose chromatography can be used to enrich a mixture of immunoglobulins for IgG, or for specific IgG subtypes.
  • immunoglobulins can also be used. Such sources include but are not limited to: Gammagard S/D ® (Baxter Healthcare); BayRho-D ® products (Bayer Biological); Gamimune N ® , 5% (Bayer Biological); Gamimune N ® , 5% Solvent/Detergent Treated (Bayer Biological); Gamimune N ® , 10% (Bayer Biological); Sandoglobulin LV.
  • An alternative approach is to use fragments of antibodies, such as Fc fragments of immunoglobulins.
  • An Fc preparation comprises Fc fragments of immunoglobulins.
  • the term "Fc fragment” refers to a portion of an immunoglobulin heavy chain constant region containing at least one heavy chain constant region domain (e.g., C H 2, C H 3 and/or C H 4) or an antigenic portion thereof, but excluding the variable regions of the immunoglobulin.
  • variable region refers to region of the immunoglobulin that binds to an antigen, but excludes the C H I and C L domains.
  • the Fc preparation can contain entire Fc fragments and/or portions thereof (e.g., one or more heavy chain constant region domains or portions thereof containing an epitope(s) bound by the rheumatoid factors).
  • An Fc fragment optionally can include an immunoglobulin hinge region, a heavy chain C H I domain, and/or a heavy chain CHI domain joined to a light chain CL domain.
  • An Fc preparation includes Fc fragments of at least one Fc isotype and can contain a mixture of immunoglobulin Fc fragments of different isotypes (e.g., IgA, IgD, IgE, IgG and/or IgM).
  • the Fc preparation also can contain predominantly (at least 60%, at least 75%, at least 90%, at least 95%, or at least 99%) Fc fragments from one immunoglobulin isotype, and can contain minor amounts of the other subtypes.
  • an Fc preparation can contain at least at least about 75%, at least about 90%, at least about 95%, or at least about 99% IgG Fc fragments.
  • the Fc preparation can comprise a single IgG subtype or a mixture two or more of IgG Fc subtypes. Suitable IgG subtypes include IgGl, IgG2, IgG3, and IgG4. In a specific embodiment, the Fc preparation comprises IgGl Fc fragments.
  • An Fc preparation is substantially free of F(ab') 2 fragments (i.e., heavy and light chain variable and first constant regions and a portion of the hinge region, which can be produced by pepsin digestion of the antibody molecule), Fab' fragments (i.e., Fab' fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragment), or Fab fragments (i.e., which can be generated by treating the antibody molecule with papain and a reducing agent).
  • F(ab') 2 fragments i.e., heavy and light chain variable and first constant regions and a portion of the hinge region, which can be produced by pepsin digestion of the antibody molecule
  • Fab' fragments i.e., Fab' fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragment
  • Fab fragments i.e., which can be generated by treating the antibody molecule with papain and a reducing agent.
  • substantially free means the Fc preparation contains less than about 30%, less than about 20%, less than about 10%, less than about 5%, or less than about 1% F(ab') 2 , Fab' or Fab fragments. In another embodiment, the Fc preparation contains Fc fragments which are essentially free of F(ab') 2 , Fab' or Fab fragments. The Fc preparations are typically substantially free of whole (i.e., full length) immunoglobulins. In this context, “substantially free” means less than about 25%, or less than about 10%, or less than about 5%, or less than about 2%, less than about 1% or are free of full length immunoglobulins .
  • Immunoglobulins can be cleaved at any suitable time during preparation to separate the Fc fragments from the Fab, F(ab') and/or F(ab') 2 fragments, as applicable.
  • a suitable enzyme for cleavage is, for example, papain, pepsin or plasmin. (See, e.g. , Harlow and Lane, Using Antibodies, Cold Spring Harbor Laboratory Press (1999); Plan and Makula, Vox Sanguinis 28:157-75 (1975).)
  • the Fc portions can be separated from the Fab F(ab') and/or F(ab') 2 fragments by, for example, affinity chromatography, ion exchange chromatography, gel filtration, or the like.
  • immunoglobulins are digested with papain to separate the Fc fragment from the Fab fragments. The digestion mixture is then subjected to cationic exchange chromatography to separate the Fc fragments from the Fab fragments.
  • Immunoglobulin or Fc fragments can also be prepared from hybridomas or other culture system which express monoclonal antibody.
  • monoclonal antibody See, e.g., Kohler and Milstein, Nature 256:495-97 (1975); Hagiwara and Yuasa, Hum. Antibodies Hybridomas 4:15-19 (1993); Kozbor et ah, Immunology Today 4:72 (1983); Cole et ah, in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96 (1985).
  • Human monoclonal antibodies can be obtained, for example, from human hybridomas ⁇ see, e.g., Cote et ah, Proc. Natl.
  • Monoclonal antibodies produced from hybridomas can be purified and the Fc fragments separated from the Fab, F(ab') and/or F(ab') 2 fragments as described herein or as known to the skilled artisan.
  • Immunoglobulin or Fc fragments also can be produced recombinantly, such as from eukaryotic cell culture systems.
  • an Fc fragment of an immunoglobulin can be recombinantly produced by Chinese hamster ovary (CHO) cells transfected with a vector containing a DNA sequence encoding the Fc fragment.
  • CHO Chinese hamster ovary
  • Methods for creating such recombinant mammalian cells are described in, for example, Sambrook and Russell, Molecular Cloning, A Laboratory Manual, 3rd ed. (Cold Spring Harbor Laboratory Press (New York) 2001) and Ausubel et a , Short Protocols in Molecular Biology, 4th ed. (John Wiley & Sons, Inc.
  • Recombinant Fc can also be produced in other mammalian cell lines, such as baby hamster kidney (BHK) cells. Methods of culturing recombinant cells to produce recombinant proteins are also known to the art.
  • a variety of other expression systems can be utilized to express recombinant immunoglobulins or Fc fragments. These include, but are not limited to, insect cell systems and microorganisms such as yeast or bacteria which have been transfected or transformed with an expression cassette encoding the desired Fc fragment. In certain embodiments, the microorganism optionally can be engineered to reproduce glycosylation patterns of mammalian or human Fc fragments.
  • further preparative steps can be used in order to render an immunoglobulin or Fc preparation safe for use in the methods according to the present invention.
  • steps can include, for example, treatment with solvent/detergent, pasteurization and sterilization.
  • Additional preparative steps may be used in order to ensure the safety of an Fc preparation.
  • Such preparative steps can include, for example, enzymatic hydrolysis, chemical modification via reduction and alkylation, sulfonation, treatment with ⁇ - propiolactone, treatment at low pH, or the like. Descriptions of suitable methods can also be found in, for example, U.S. Patent Nos.
  • an effective amount of an immunoglobulin or Fc preparation is administered to the subject generally by intravenous means.
  • the term "effective amount” refers to an amount of an immunoglobulin or Fc preparation that results in an improvement or remediation of RRMS in the subject.
  • An effective amount to be administered to the subject can be determined by a physician with consideration of individual differences in age, weight, disease severity and response to the therapy.
  • an immunoglobulin or Fc preparation can be administered to a subject at about 5 mg/kilogram to about 500 mg/kilogram each day.
  • an mmunoglobulin or Fc preparation can be administered in amounts of at least about 10 mg/kilogram, at last 15 mg/kilogram, at least 20 mg/kilogram, at least 25 mg/kilogram, at least 30 mg/kilogram or at least 50 mg/kilogram.
  • an mmunoglobulin or Fc preparation can be administered to a subject at doses up to about 100 mg/kilogram, to about 150 mg/kilogram, to about 200 mg/kilogram, to about 250 mg/kilogram, to about 300 mg/kilogram, to about 400 mg/kilogram each day.
  • the doses of the mmunoglobulin or Fc preparation can be greater or less. Immunoglobulin or Fc preparations can be administered in one or more doses per day.
  • the time needed to complete a course of the treatment can be determined by a physician and may range from as short as one day to more than a month. In certain embodiments, a course of treatment can be from 1 to 6 months.
  • the invention provides compositions, kits and integrated systems for practicing the assays described herein using antibodies specific for the polypeptides or nucleic acids specific for the polynucleotides of the invention.
  • Kits for carrying out the diagnostic assays of the invention typically include a probe that comprises an antibody or nucleic acid sequence that specifically binds to polypeptides or polynucleotides of the invention, and a label for detecting the presence of the probe.
  • the kits may include several antibodies or polynucleotide sequences encoding polypeptides of the invention, e.g., a cocktail of antibodies that recognize the proteins encoded by the biomarkers of the invention.
  • a variety of methods may be used to identify compounds that prevent or treat multiple sclerosis, including relapsing-remitting multiple sclerosis (RRMS), Alzheimer's disease, or Parkinson's disease.
  • RRMS relapsing-remitting multiple sclerosis
  • an assay that provides a readily measured parameter is adapted to be performed in the wells of multi-well plates in order to facilitate the screening of members of a library of test compounds as described herein.
  • an appropriate number of cells e.g., T cells
  • RRMS IVIG-responsive relapsing-remitting multiple sclerosis
  • the compounds to be tested can be any small chemical compound, or a macromolecule, such as a protein, sugar, nucleic acid or lipid.
  • test compounds will be small chemical molecules and peptides.
  • any chemical compound can be used as a test compound in this aspect of the invention, although most often compounds that can be dissolved in aqueous or organic (especially DMSO-based) solutions are used.
  • the assays are designed to screen large chemical libraries by automating the assay steps and providing compounds from any convenient source to assays, which are typically run in parallel (e.g., in microtiter formats on microtiter plates in robotic assays). It will be appreciated that there are many suppliers of chemical compounds, including Sigma (St. Louis, MO), Aldrich (St. Louis, MO), Sigma-Aldrich (St. Louis, MO), Fluka Chemika-Biochemica Analytika (Buchs Switzerland) and the like.
  • high throughput screening methods are used which involve providing a combinatorial chemical or peptide library containing a large number of potential therapeutic compounds. Such "combinatorial chemical libraries” or “ligand libraries” are then screened in one or more assays, as described herein, to identify those library members (particular chemical species or subclasses) that display a desired characteristic activity. In this instance, such compounds are screened for their ability to reduce or increase the expression of the relapsing-remitting multiple sclerosis (RRMS) biomarkers of the invention.
  • RRMS relapsing-remitting multiple sclerosis
  • a combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical "building blocks" such as reagents.
  • a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks (amino acids) in every possible way for a given compound length (/. e. , the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.
  • combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent 5,010,175, Furka, Int. J. Pept. Prot. Res., 37:487-493 (1991) and Houghton et al, Nature, 354:84-88 (1991)).
  • Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (e.g., PCT Publication No. WO 91/19735), encoded peptides (e.g., PCT Publication No.
  • WO 93/20242 random bio-oligomers (e.g., PCT Publication No. WO 92/00091), benzodiazepines (e.g., U.S. Patent No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al, PNAS USA, 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al. , J. Amer. Chem. Soc, 114:6568 (1992)), nonpeptidal peptidomimetics with glucose scaffolding (Hirschmann et al., J. Amer. Chem.
  • each well of a microtiter plate can be used to run a separate assay against a selected potential modulator, or, if concentration or incubation time effects are to be observed, every 5-10 wells can test a single modulator.
  • a single standard microtiter plate can assay about 96 modulators. If 1536 well plates are used, then a single plate can easily assay from about 100- about 1500 different compounds. It is possible to assay many plates per day; assay screens for up to about 6,000, 20,000, 50,000, or 100,000 or more different compounds is possible using the integrated systems of the invention.
  • the biomarker proteins or their cellular receptors may serve as targets for multiple sclerosis therapy using antibodies.
  • chemokines such as CXCL5, CXCL3, and CCLl 3, whose expression is decreased upon treatment of RRMS with rVIG
  • antibodies that bind to and inactivate these chemokines or their receptors can be used in the treatment of multiple sclerosis, Alzheimer's disease, or Parkinson's disease.
  • chemokines such as XCL2
  • XCL2 whose expression is increased upon IVIG treatment
  • antibodies may be generated which bind to and activate XCL2 receptors, thus mimicking the effect of XCL2 binding.
  • the antibodies described above may be formulated into pharmaceutical compositions comprising a carrier suitable for the desired delivery method.
  • Suitable carriers include any material which when combined with the antibody does not interfere with function of the antibody and is non-reactive with the subject's immune systems. Examples include, but are not limited to, any of a number of standard pharmaceutical carriers such as sterile phosphate buffered saline solutions, bacteriostatic water, and the like (see, generally, Remington 's Pharmaceutical Sciences, 20 th ed., 2003).
  • Antibody formulations may be administered via any route capable of delivering the antibodies to an individual suffering from multiple sclerosis.
  • Potentially effective routes of administration include, but are not limited to, intravenous, intraperitoneal, intramuscular, intradermal, and the like.
  • One preferred route of administration is by intravenous injection.
  • a preferred formulation for intravenous injection comprises the antibodies in a solution of preserved bacteriostatic water, sterile unpreserved water, and/or diluted in polyvinylchloride or polyethylene bags containing 0.9% sterile Sodium Chloride for Injection, USP.
  • the antibody preparation may be lyophilized and stored as a sterile powder, preferably under vacuum, and then reconstituted in bacteriostatic water containing, for example, benzyl alcohol preservative, or in sterile water prior to injection.
  • Treatment will generally involve the repeated administration of antibody preparations via an acceptable route of administration such as intravenous injection (JV), at an effective dose.
  • JV intravenous injection
  • Dosages will depend upon various factors generally appreciated by those of skill in the art, including without limitation the type, stage, the severity, grade, or stage of multiple sclerosis, the binding affinity and half life of the antibody used, the degree of biomarker or receptor expression in the patient, the desired steady-state antibody concentration level, frequency of treatment, and the influence of any other agents used in combination with the treatment method of the invention.
  • Typical daily doses may range from about 0.1 to 100 mg/kg. Doses in the range of 10-500 mg mAb per week may be effective and well tolerated, although even higher weekly doses may be appropriate and/or well tolerated.
  • the principal determining factor in defining the appropriate dose is the amount of a particular antibody necessary to be therapeutically effective in a particular context. Repeated administrations may be required in order to achieve longer lasting remission in RRMS.
  • Initial loading doses may be higher.
  • the initial loading dose may be administered as an infusion.
  • Periodic maintenance doses may be administered similarly, provided the initial dose is well tolerated.
  • nucleic acids such as antisense nucleic acids, siRNAs or ribozymes
  • Ribozymes that cleave mRNA at site-specific recognition sequences can be used to destroy target mRNAs, particularly through the use of hammerhead ribozymes.
  • Hammerhead ribozymes cleave mRNAs at locations dictated by flanking regions that form complementary base pairs with the target mRNA.
  • the target mRNA has the following sequence of two bases: 5'- UG-3'. The construction and production of hammerhead ribozymes is well known in the art.
  • Gene targeting ribozymes necessarily contain a hybridizing region complementary to two regions, each of at least 5 and preferably each 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 contiguous nucleotides in length of a target mRNA.
  • ribozymes possess highly specific endoribonuclease activity, which autocatalytically cleaves the target sense mRNA.
  • phosphorothioate oligonucleotides can be used. Modifications of the phosphodiester linkage as well as of the heterocycle or the sugar may provide an increase in efficiency. Phophorothioate is used to modify the phosphodiester linkage. An N3'-P5' phosphoramidate linkage has been described as stabilizing oligonucleotides to nucleases and increasing the binding to RNA.
  • PNA linkage is a complete replacement of the ribose and phosphodiester backbone and is stable to nucleases, increases the binding affinity to RNA, and does not allow cleavage by RNAse H. Its basic structure is also amenable to modifications that may allow its optimization as an antisense component. With respect to modifications of the heterocycle, certain heterocycle modifications have proven to augment antisense effects without interfering with RNAse H activity. An example of such modification is C-5 thiazole modification. Finally, modification of the sugar may also be considered. 2'-O-propyl and T- methoxyethoxy ribose modifications stabilize oligonucleotides to nucleases in cell culture and in vivo.
  • Inhibitory oligonucleotides can be delivered to a cell by direct transfection or transfection and expression via an expression vector.
  • Appropriate expression vectors include mammalian expression vectors and viral vectors, into which has been cloned an inhibitory oligonucleotide with the appropriate regulatory sequences including a promoter to result in expression of the antisense RNA in a host cell. Suitable promoters can be constitutive or development-specific promoters.
  • Transfection delivery can be achieved by liposomal transfection reagents, known in the art ⁇ e.g., Xtreme transfection reagent, Roche, Alameda, CA; Lipofectamine formulations, Invitrogen, Carlsbad, CA). Delivery mediated by cationic liposomes, by retroviral vectors and direct delivery are efficient. Another possible delivery mode is targeting using antibody to cell surface markers for the target cells.
  • a composition comprising one or more nucleic acid molecules can comprise a delivery vehicle, including liposomes, for administration to a subject, carriers and diluents and their salts, and/or can be present in pharmaceutically acceptable formulations.
  • a delivery vehicle including liposomes
  • Methods for the delivery of nucleic acid molecules are described, for example, in Gilmore, et al., Curr Drug Delivery (2006) 3:147-5 and Patil, et al., AAPS Journal (2005) 7:E61-E77, each of which are incorporated herein by reference. Delivery of siRNA molecules is also described in several U.S.
  • Nucleic acid molecules can be administered to cells by a variety of methods known to those of skill in the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, by electroporation, or by incorporation into other vehicles, including biodegradable polymers, hydrogels, cyclodextrins (see, for example Gonzalez et al., 1999, Bioconjugate Chem., 10, 1068-1074; Wang et al., International PCT publication Nos.
  • WO 03/47518 and WO 03/46185 poly(lactic-co-glycolic)acid (PLGA) and PLCA microspheres (see for example U.S. Pat. No. 6,447,796 and US Patent Application Publication No. 2002/130430), biodegradable nanocapsules, and bioadhesive microspheres, or by proteinaceous vectors (O'Hare and Normand, International PCT Publication No. WO 00/53722).
  • nucleic acid molecules of the invention can also be formulated or complexed with polyethyleneimine and derivatives thereof, such as polyethyleneimine-polyethyleneglycol-N-acetylgalactosamine (PEI-PEG-GAL) or polyethyleneimine-polyethyleneglycol-tri-N-acetylgalactosamine (PEI-PEG-triGAL) derivatives.
  • polyethyleneimine-polyethyleneglycol-N-acetylgalactosamine PEI-PEG-GAL
  • PEI-PEG-triGAL polyethyleneimine-polyethyleneglycol-tri-N-acetylgalactosamine
  • liposomal transfection reagents of use with this invention include, for example: CellFectin, 1 :1.5 (M/M) liposome formulation of the cationic lipid N,NI,NII,NIII- tetramethyl-N,NI,NII,NIII-tetrapalmit-y-spermine and dioleoyl phosphatidylethanolamine (DOPE) (GIBCO BRL); Cytofectin GSV, 2:1 (M/M) liposome formulation of a cationic lipid and DOPE (Glen Research); DOTAP (N-[I -(2,3 -dioleoyloxy)-N,N,N-tri-methyl- ammoniummethylsulfate) (Boehringer Manheim); Lipofectamine, 3:1 (M/M) liposome formulation of the polycationic lipid DOSPA and the neutral lipid DOPE (GIBCO BRL); and (5) siPORT (Ambion); HiPerfect (Qi
  • antisense, siRNA, or ribozyme sequences are delivered into the cell via a mammalian expression vector.
  • mammalian expression vectors suitable for siRNA expression are commercially available, for example, from Ambion (e.g., pSilencer vectors), Austin, TX; Promega (e.g., GeneClip, siSTRIKE, SiLentGene), Madison, WI; Invitrogen, Carlsbad, CA; InvivoGen, San Diego, CA; and Imgenex, San Diego, CA.
  • expression vectors for transcribing siRNA molecules will have a U6 promoter.
  • antisense, siRNA, or ribozyme sequences are delivered into cells via a viral expression vector.
  • Viral vectors suitable for delivering such molecules to cells include adenoviral vectors, adeno-associated vectors, and retroviral vectors (including lentiviral vectors).
  • viral vectors developed for delivering and expressing siRNA oligonucleotides are commercially available from, for example, GeneDetect, Bradenton, FL; Ambion, Austin, TX; Invitrogen, Carlsbad, CA; Open BioSystems, Huntsville, AL; and Imgenex, San Diego, CA.
  • Example 1 Methods and Materials Patients Involved in the Study
  • the primary outcome measure of the study was a change in the EDSS score from baseline to week 3 after the start of IVIG therapy on day 21. Secondary outcome measures were changes in the volumes of Tl-, T2-, Flair- and gadolinium (Gd)-enhanced lesions, the number of Gd-enhanced lesions, and brain volumes (Elovaara I. et al., Intravenous Immunoglobulin is effective and well tolerated in the treatment of MS Relapse, Manuscript submitted; Dastidar P. et al., Med Biol Eng Comput, 37:104-7 (1999)).
  • Brain MRI examinations were done using a 1.5 Tesla MRI unit (Philips Gyroscan ACS NT Intera, Best, Netherlands) as described (Kurtzke J.F., Neurology, 33:1444-1452 (1983)).
  • the MRI protocol included sagittal Tl localizer, axial fluid attenuated inversion recovery (FLAIR), Tl magnetization transfer contrast (MTC), Tl spin echo (SE) , T2 turbo spin echo (TSE) (3mm thick and 0mm gap) and gadolinium-enhanced Tl MTC sequences.
  • FLAIR axial fluid attenuated inversion recovery
  • MTC Tl magnetization transfer contrast
  • SE Tl spin echo
  • TSE turbo spin echo
  • Tl axial SE (3mm thick and Omm gap) and axial FLAIR (5mm thick and lmm gap) sequences were used for volumetric analyses of plaques.
  • PBMC Peripheral blood mononuclear cells
  • RNA samples were frozen and stored at -80°C until further processing.
  • Total RNA was isolated according to the manufacturer's protocol. RNA pellets were dissolved in nuclease-free water (Invitrogen, Carlsbad, CA) and stored at -80° C.
  • HU-133 A Genechip (Affymetrix, Santa Clara, CA) containing approximately 33,000 human genes was used. 5 ⁇ g of total RNA were transcribed, labelled and hybridized in vitro on the array according to the manufacturer's protocol (see Affvmetrix.com). The quality of the RNA was checked before in vitro processing using a Bioanalyzer (Agilent Technologies, Palo Alto, CA).
  • PBMCs obtained from peripheral blood were separated into T cells and non-T cells using a mixture of non-stimulating anti-CD4+ and anti-CD8+ magnetic Dynabeads at 4°C. This procedure was chosen to prevent stimulation of T cells during cell separation.
  • Statistic analysis of gene expression data included all results obtained from microarray analysis done at three different time points (before treatment, 1 day and 21 days after beginning of treatment) and included all 10 patients treated with IVIG. The analysis revealed that 360 genes in peripheral T cells were significantly changed in expression during the course of FVIG treatment. The expression of 91 of these genes changed between day 0 and day 6, the expression of 147 genes changed between day 0 and day 21, and the expression of 122 genes changed between day 6 and day 21.
  • Tables 3a-3d present the 20 most significant changes in gene expression observed in patients treated with IVIG and IVMP.
  • Table 3a 10 genes that were most extensively up-regulated in peripheral T cells of patients during IVIG therapy
  • Table 3b 10 genes that were most extensively down-regulated in peripheral T cells of patients during IVIG therapy
  • Tunepoints 6 vs represents genes with a different expression between day 0 and day 6
  • 21 vs 0 represents genes with a differential expression between day 21 and day 0
  • 21 vs 6 refers to genes with a change in expression between day 6 and day 21
  • Table 3c 10 genes that were most extensively up-regulated in peripheral T cells of patients during IVMP therapy
  • Table 3d 10 genes that were most extensively down-regulated in peripheral blood cells of patients during FVMP therapy
  • Timepoints 6 vs 0 represents genes with a differential expression between day 0 and day 6
  • 21 vs 0 represents genes with a differential expression between day 21 and day 0, and 21 vs 6 refers to genes with a change in expression between day 6 and day 21
  • Genes mostly affected in expression by IVIG treatment include genes that encode proteins that regulate cell cycle (transcriptional regulating factor 1, TRERFl; cyclin- dependent kinase inhibitor 1C, CDKNlC; breast cancer 1, BRCAl; SH3-domain binding protein 4, SH3BP4); but also proteins that regulate inflammation [chemokine (C-X-C motif) ligand 5, CXCL5], cell adhesion (FAT tumor suppressor homolog 2, FAT2) or cell differentiation (early growth response, EGR2).
  • Other genes included in the list encode proteins that are involved in electron transport, phosphorylation, glycosylation, skeletal development or proteins that have not yet been defined in function.
  • genes of interest that were differentially regulated upon FVIG treatment encoded proteins involved in immune regulation such as interleukin 11 (ILl 1), chemokine (C motif) ligand 2 (XCL2), prostaglandin E receptor 4 (PTGER4), caspase 2 (CASP2), killer cell immunoglobin-like receptor, two domains, short cytoplasmic tail 1 (KIR2DS1), mitogen- activated protein kinase kinase kinase kinase kinase 2 (MAP4K2), chemokine (C-X-C motif) ligand 5 (CXCL5), chemokine (C-X-C motif) ligand 3 (CXCL3), C-type lectin domain family 4, member E (CLEC4E), chemokine (C-C motif) ligand 13 (CCLl 3) and alpha- fetoprotein (AFP) (see Table 4).
  • ILl 1 interleukin 11
  • XCL2 chemok
  • Timepoints 6 vs 0 represents genes with a differential expression between day 0 and day 6
  • 21 vs 0 represents genes with a differential expression between day 21 and day 0
  • 21 vs 6 refers to genes with a change in expression between day 6 and day 21
  • SH3-doma ⁇ n binding protein 4 SH3BP4 endocytosis /// cell cyde NM_014521 o ⁇ gin recognition complex, subunit 1-l ⁇ ke (yeast) ORClL DNA replication /// DNA replication initiation NM_004153
  • the present study was designed to identify genes that are differentially expressed in peripheral T cells of patients with RRMS in acute exacerbation after treatment with IVIG.
  • Peripheral T cells CD4+ and CD8+ T cells
  • CD4+ and CD8+ T cells have been shown to be involved in the disease pathogenesis, in particular in the process of demyelination and axonal damage (Stinissen P. et al., Mult Scler. , 4:203-11 (1998)).
  • This is supported by a recent study in which a number of genes in peripheral blood cells of MS patients were shown to be differentially expressed compared with those in healthy twins (Sarkijarvi S. et al., BMC Medical Genetics, 7:11 (2006)).
  • Chemokines have been shown to mediate trafficking of immune cells across the blood-brain barrier and to direct migration of immune cells towards sites of active lesions (Szczucinski A. and Losy J., Acta Neurol Scand, 115:137-146 (2007)). Moreover, chemokines were detected in active lesions and were found to be elevated in the cerebrospinal fluid of patients with MS during relapse (Sindern E. et al., J Neuroimmunol, 131:186-90 (2002)). Two of the chemokines (CXCL3 and CXCL5) that were significantly down-regulated in our study are known to specifically interact with the chemokine receptor CXCR2 (Oman K.
  • CXCR2 is not only expressed on peripheral blood cells such as granulocytes, monocytes or lymphocytes (Murdoch C. et al., Brain, 128:1003-1015 (2005(?)); Murphy P.M. et al., Pharmacol Rev., 52:145-76 (2000)) but also on oligodendrocytes in the brain. Oligodendrocytes are most essential for the myelination of axons in the white matter of the Central Nervous System and for remyelination after demyelination of axons during inflammation in MS (Blakemore W.F., J Neurol Sci., (2007)).
  • CXCR2 expressed on oligodendrocytes is essential for the development and maintenance of the oligodendrocyte lineage, myelination and white matter in the vertebrate CNS (Tsai H.H. et al., Cell, 110:373-83 (2002); Padovani-Claudio D. et al., GHa, 54:471-483 (2006)).
  • the regulation of oligodendrocyte development and migration depends on the localized expression of the chemokine CXCLl and its interaction with CXCR2 expressed on oligodendrocyte precursor cells and oligodendrocytes (Padovani- Claudio D. et al., GUa, 54:471-483 (2006)).
  • Both T cells and monocytes produce chemokines in the brain that interfere with the tightly regulated activity of oligodendrocyte precursor cells and oligodendrocytes.
  • This interference could be caused by either a desensitization of the CXCR2 receptor expressed on oligodendrocytes or by interference with the interaction between locally expressed CXCLl and CXCR2 on oligodendrocytes.
  • IVIG down-regulates the expression of chemokines in peripheral T cells, monocytes or both. Consequently, the interference of chemokines produced by these cells with the function of oligodendrocytes would be prevented and the natural process of remyelination induced by oligodendrocytes would be re-established. It remains to be shown whether IVIG might not only modulate the expression of chemokines in peripheral T cells but also the expression of chemokines in cells of the CNS, e.g., in astrocytes.
  • the aim of our study was to identify genes that are likely to be associated with T cell responses in MS.
  • the strategy that we used for positive cell selection does not exclude the possibility that some of the identified genes are associated with peripheral monocytes rather than T cells. This has to be taken into consideration when interpreting the above data.
  • the genes that we found to be differentially expressed under IVIG treatment will be confirmed in a second clinical trial with a larger study group. Differentially expressed genes can be used as diagnostic markers for the therapeutic efficacy of IVIG treatment. Furthermore, some of the proteins encoded by the genes of interest will provide suitable targets for future drug development.
  • SEQ ID NO: 1 Homo sapiens transcriptional regulating factor 1 (TRERFl) (NM_018415) ctctgctcgc cccccatctc accccccaag cggatactgg tcttctcgtc ggattgccca tgcacttgtt gcagaaacag ccaaggccct ggctgtggag aatgctgaag gaagaagacg cagaagcagg acgaccctga agattcagc ctcttcatccc tcaaacaggt cgcttctcgg gagttcttgg tgtggaata ttttacagca aagcagtcga ccaggcctcccacc tgtccagcag catgaaaagcagcagtcga ccaggcctc
  • SEQ ID NO: 4 Homo sapiens chromosome 19 open reading frame 28 (C19orf28) (NP_778148.2)
  • SEQ ID NO: 6 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57 , Kip2) (NP_000067.1)
  • SEQ ID NO: 7 Homo sapiens breast cancer 1, early onset (BRCAl) (NM_007294) cttagcggta gccccttggt ttccgtggca acggaaagc gcgggaatta cagataaatt aaaactgcga ctgcgcggcg tgagctcgct gagacttcct ggacggggga caggctgtgg ggtttctcag ataactgggc ccctgcgctc aggaggcctt caccctctgc tctgggtaaa gttcattgga acagaaagaa atggatttat tat tgctcttcg cgttgaagaa gtacaaaatg tcattaatgc tatgcagaaa atcttag
  • SEQ ID NO: 8 Homo sapiens breast cancer 1, early onset (BRCAl) (NP 009225.1) MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQE STRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQET SLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAA CEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITL NSSIQKVNE
  • SEQ ID NO: 10 Homo sapiens SH3-domain binding protein 4 (SH3BP4) (NP_055336.1)
  • SEQ ID NO: 12 Homo sapiens collagen, type III, alpha 1 (Ehlers-Danlos syndrome type IV, autosomal dominant) (COL3A1) (NP_000081.1)
  • SEQ ID NO: 14 Homo sapiens UDP-GaI :betaGlcNAc beta 1,3- galactosyltransferase, polypeptide 2 (B3GALT2) (NP_003774.1)
  • SEQ ID NO: 16 Homo sapiens glycosylphosphatidylinositol specific phospholipase Dl (GPLDl) (NP_001494.2)
  • MTMR7 Homo sapiens myotubularin related protein 7 (MTMR7) (NM_004686) gcgcccgccc gggaccctgc agacgtgggc cagccatgga gcacatccgc acgcccaagg ttgaaaatgt ccgcttggta gatcgagtgt ctcctaaaagcagctcta ggtactttgt atttgacggc tacccatgtc atattcgtgg aaaattcacc tgacgcaaga aaagaaacat ggattcttca cagtcagatt tccaccattg agaaacaggc aacaaccgct accggatgcc ctctgctgat tcgctgcaag aactttcaga taata
  • SEQ ID NO: 18 Homo sapiens myotubularin related protein 7
  • SEQ ID NO: 20 Homo sapiens transmembrane protein with EGF-like and two follistatin-like domains 1 (TMEFFl) (NP_003683.2)
  • SEQ ID NO: 22 Homo sapiens NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5) , nuclear gene encoding mitochondrial protein (NP_004991.1)
  • SEQ ID NO: 24 Homo sapiens FAT tumor suppressor homolog 2 (Drosophila) (FAT2) (NP_001438.1)
  • SEQ ID NO: 26 Homo sapiens ⁇ hemokine (C-X-C motif) ligand 5 (CXCL5) (NP_002985.1)
  • SEQ ID NO: 27 Homo sapiens zinc finger protein 771 (ZNF771) (NM_016643) gaggtggtga aactcaagat ccccatggac aacaaggagg tcccgggcga ggcgcccgcg ccgtccgcg acccggcgcg tccccacgcg tgcccgact gcggccgcgcgc cttcgcgcgcgcgcgcgctccacgc tggcgaagca cgcgcgcacg cacacgggcg aacggccctt cgggtgcacc gagtgcgggc ggcgcttctc acagaagtcg gcgctgacca aacacggcccg cacgcacacg ggcgagcggct
  • SEQ ID NO: 28 Homo sapiens zinc finger protein 771 (ZNF771) (NP_057727.1)
  • SEQ ID NO: 30 Homo sapiens natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) (NPR3) (NP_000899.1)
  • SEQ ID NO: 32 Homo sapiens early growth response 2 (Krox-20 homolog, Drosophila) (EGR2) (NP_000390.2)
  • SEQ ID NO: 33 Homo sapiens leukocyte immunoglobulin-like receptor, subfamily A (with TM domain) , member 4 (LILRA4) (NM_012276) ctacgggcac cgtggccaca cctgcctgca cagccagggc caggaggagg agatgccatg accctcattc tcacaagcct gctcttcttt gggctgagcc tgggccccag gacccgggtg caggcagaaa acctacccaa acccatcctg tgggccgagc caggtcccgt gatcacctgg cataaccccg tgaccatctg gtgtcagggc accctggagg cccaggggta ccgtggat aaagagggaa actcaatgtc gaggcacata t
  • SEQ ID NO: 34 Homo sapiens leukocyte immunoglobulin-like receptor, subfamily A (with TM domain) , member 4 (LILRA4) (NP_036408.3)
  • SEQ ID NO: 36 Homo sapiens prostaglandin D2 synthase 2IkDa (brain) (PTGDS) (NP 000945.3) MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSWAPATDG GLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSWETDYDQYALLYSQGSKGPGEDFRMATLYS RTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ
  • SEQ ID NO: 37 Homo sapiens periostin, osteoblast specific factor (POSTN) (NM_006475) agagactcaa gatgattccc tttttaccca tgttttctct actattgctg cttattgtta accctataaa cgccaacaat cattatgaca agatcttggc tcatagtcgt atcaggggtc gggaccaagg cccaaatgtc tgtgcccttc aacagatttt gggcaccaaa aagaaatact tcagcacttg taagaactgg tataaaaagt ccatctgtgg acagaaaacg actgttttat atgaatgttg cctggttat atgagaatgg aaggaatgaaggctgccca g actg
  • SEQ ID NO: 39 Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A) (NM_003392) agttgcctgc gcgccctcgc cggaccggcg gctccctagt tgcgccccga ccaggccctg cccttgctgcc cggctcgcgcgcgcgcgcccctccatt cctgggcgca tcccagctct gcccaactc gggagtccag gcccgggcgc cagtgcccgc ttcagctccg gttcactgcg cccgcggac gcgcggac gcgcggac gcgcggagga ggactccgca gctctccg
  • SEQ ID NO: 40 Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A) (NP 003383.2) MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQWIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGL SQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGWNAM SRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEA GRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKC
  • SEQ ID NO: 42 Homo sapiens prostaglandin D2 synthase 2IkDa (brain) (PTGDS) (NP_000945.3)
  • SEQ ID NO: 44 Homo sapiens defensin, alpha 3, neutrophil-specific (DEFA3) (NP_005208.1)
  • SEQ ID NO: 45 Homo sapiens POU domain, class 1, transcription factor 1 (Pitl, growth hormone factor 1) (POUlFl) (NM_000306) ctcagagcct tcctgatgta tatatgcagg tagtgagaat tgaatcggcc ctttgagaca gtaatataat aaaactctga tttggggagc agcggttctc cttatttttc tactctcttg tgggaatgag ttgccaagct tttacttcgg ctgatacctt tatacctctg aattctgacg cctctgcaac tctgcctctg ataatgcatc acagtgctgctgc ctga ccagtctcca accatgccac caat
  • SEQ ID NO: 46 Homo sapiens POU domain, class 1, transcription factor 1 (Pitl, growth hormone factor 1) (POUlFl) (NP_000297.1)
  • SEQ ID NO: 48 Homo sapiens cadherin 13, H-cadherin (heart) (CDH13) (NP_001248.1)
  • SEQ ID NO: 58 Homo sapiens tripartite motif-containing 58 (TRIM58)
  • SEQ ID NO: 59 Homo sapiens Zwilch, kinetochore associated, homolog (Drosophila) (ZWILCH) (NM_017975) agtcgaggta tcttctccc aaccactgct cttattttaa ttattgcaga cggaagttga agactattga catagtaaat agctctgggt ggcttgaaac gaaagtttaa ctttgcggac aaacaggact tattgtaggg ggtggtcaaa atagtcccgg cggggcgggg ccatgacccc tgacgtcgcc ggtcggcgc gcagttcagt tggcggttc cggtaccgct ctcacattgg ggc
  • SEQ ID NO: 60 Homo sapiens Zwilch, kinetoohore associated, homolog (Drosophila) (ZWILCH) (NP_060445.3)
  • SEQ ID NO: 62 Homo sapiens pelota homolog (Drosophila) (PELO) (NP_057030.3)
  • SEQ ID NO: 63 Homo sapiens zinc finger protein 711 (ZNF711) (NM_021998) agacgcagag tagattgtga ttggctcggg ctgcggaacc tcggaaaccc gaatgtgagg accttaaggg atccacagct gccgcccccc gcagccatcc agagcgcggt cacagtccga ctggcggcac ggaggcggcg gcggcggcggcagc ggcggcggcagc ggcggcggca gcggcggcgg cagctgtagc tgcagcagca ggtaaagaga gcgttttccc aaagaaaata acatagcaca gaaggaaaaaata acatagcaca gaaggaaaaaata acatagca gaa
  • SEQ ID NO: 64 Homo sapiens zinc finger protein 711 (ZNF711) (NP_068838.3)
  • SEQ ID NO: 65 Homo sapiens intersectin 1 (SH3 domain protein) (ITSNl) (NM 003024) gagcgaggga gggagcgaag gaggtagaga agagtggagg cgccagggga gggagcgtag cttggttgct ccgtagtacg gcggctcgcg aggaagaatc ccgagcgggc tccgggacgg acagagaggc gggcggggat ggtgtgcggg gctgcggctc ctgcgtcct cccagcggcg cgtgagcggc actgatttgt ccctggggcg gcagcgcgga ccgccgga gatgaggcgt cgattagcaa ggtaaagta acagaacc
  • SEQ ID NO: 66 Homo sapiens interseotin 1 (SH3 domain protein) (ITSNl) (NP 003015.2)
  • SEQ ID NO: 68 Homo sapiens phorbol-12-myristate-13-acetate-induced protein 1 (PMA.IP1) (NP_066950.1)
  • SEQ ID NO: 70 Homo sapiens transmembrane protein 47 (TMEM47) (NP_113630.1) MASAGSGMEEVRVSVLTPLKLVGLVCI FLALCLDLGAVLSPAWVTADHQYYLSLWESCRKPASLDIWHCESTLSS DWQIATLALLLGGAAI ILIAFLVGLISICVGSRRRFYRPVAVMLFAAWLQVCSLVLYPIKFIETVSLKIYHEFN WGYGLAWGATIFSFGGAILYCLNPKNYEDYYY
  • SEQ ID NO: 72 Homo sapiens interleukin 11 (ILIl) (NP_000632.1)
  • SEQ ID NO: 74 Homo sapiens chemokine (C motif) ligand 2 (XCL2) (NP_003166.1)
  • SEQ ID NO: 74 Homo sapiens prostaglandin E receptor 4 (subtype EP4) (PTGER4) (NM 000958) gcgagagcgg agctccaagc ccggcagccc gagaggaaga tgaacagccc caggccagag cctctggcag agtggacccc gagccgcccc caggtagcca ggagcggcct cagcggcagc cgcaaactccc agtagccgccc cgtgctgccc gtggctgggg cggagggcag ccagagctgg ggaccaaggc tccgcgccac ctgcgcgcac agcctcacac ctgaacgctgctccccgcac agcctcacac ctgaacgctg
  • SEQ ID NO: 76 Homo sapiens prostaglandin E receptor 4 (subtype EP4) (PTGER4) (NP_000949.1)
  • SEQ ID NO: 77 Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural precursor cell expressed, developmentally down-regulated 2) (CASP2) (NM_032982) gggtggcctg gtgtgtgggc gcggcagggc gcaggcgcag gcgcagtgtg cgtccgcgtc tgaggggagg gatgtggggg aagcgacggc cccggtttg ttgggctgt gggcggtgcg cagcggagag cccgggaaaa gcgggaaatg gcggcgccga gcgcggggtc ttggtccacc ttccagcaca aggagctgat ggccgctgac aggggacgca ggat
  • SEQ ID NO: 78 Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural precursor cell expressed, developmentally down-regulated 2) (CASP2) (NP_116764.2)
  • SEQ ID NO: 79 Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 (KIR2DS1) (NM_014512) caccggcagc accatgtcgc tcacggtcgt cagcatggcg tgtgttgggt tcttcttgct gcagggggcc tggccacatg agggagtcca cagaaaacct tccctctgg cccacccagg tcgcctggtg aaatcagaag agacagtcat cctgcaatgt tggtcagatg tcatgttttga acacttcctt ctgcacagag aggggatgtttaacact tgccttctgcacagag aggggatgtttaacact tgcc
  • SEQ ID NO: 80 Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 (KIR2DS1) (NP_055327.1)
  • SEQ ID NO: 82 Homo sapiens mitogen-activated protein kinase kinase kinase kinase 2 (MAP4K2) (NP_004570.2)
  • SEQ ID NO: 84 Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5) (NP_002985.1)
  • SEQ ID NO: 88 Homo sapiens chemokine (C-C motif) ligand 13 (CCL13) (NP_005399.1)
  • SEQ ID NO: 90 Homo sapiens alpha-fetoprotein (AFP) ( NP_005399.1)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Analytical Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Wood Science & Technology (AREA)
  • Pathology (AREA)
  • Genetics & Genomics (AREA)
  • Hospice & Palliative Care (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Physics & Mathematics (AREA)
  • Oncology (AREA)
  • Psychiatry (AREA)
  • Transplantation (AREA)
  • Psychology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2008/006608 2007-08-13 2008-08-11 Ivig modulation of chemokines for treatment of multiple sclerosis, alzheimer's disease, and parkinson's disease Ceased WO2009021708A2 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP08785488A EP2191014B1 (en) 2007-08-13 2008-08-11 Ivig modulation of chemokines for treatment of multiple sclerosis, alzheimer's disease, and parkinson's disease
ES08785488T ES2416719T3 (es) 2007-08-13 2008-08-11 Modulación por IVIG de quimioquinas para el tratamiento de la esclerosis múltiple, la enfermedad de Alzheimer y la enfermedad de Parkinson
JP2010520478A JP5555626B2 (ja) 2007-08-13 2008-08-11 多発性硬化症、アルツハイマー病およびパーキンソン病を処置するためのケモカインのivig調節
AU2008286361A AU2008286361B2 (en) 2007-08-13 2008-08-11 IVIG modulation of chemokines for treatment of multiple sclerosis, Alzheimer's disease, and Parkinson's disease
CA2695972A CA2695972A1 (en) 2007-08-13 2008-08-11 Ivig modulation of chemokines for treatment of multiple sclerosis, alzheimer's disease, and parkinson's disease

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US95561007P 2007-08-13 2007-08-13
US60/955,610 2007-08-13

Publications (2)

Publication Number Publication Date
WO2009021708A2 true WO2009021708A2 (en) 2009-02-19
WO2009021708A3 WO2009021708A3 (en) 2009-05-28

Family

ID=40259157

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2008/006608 Ceased WO2009021708A2 (en) 2007-08-13 2008-08-11 Ivig modulation of chemokines for treatment of multiple sclerosis, alzheimer's disease, and parkinson's disease

Country Status (7)

Country Link
US (2) US7968293B2 (https=)
EP (5) EP2522754B1 (https=)
JP (1) JP5555626B2 (https=)
AU (1) AU2008286361B2 (https=)
CA (1) CA2695972A1 (https=)
ES (5) ES2416719T3 (https=)
WO (1) WO2009021708A2 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010112034A3 (en) * 2009-04-02 2011-05-05 Aarhus Universitet Compositions and methods for treatment and diagnosis of synucleinopathies
WO2012135752A1 (en) * 2011-04-01 2012-10-04 Baxter International Inc. Use of cytokine levels in intravenous immunoglobulin treatment of alzheimer's disease
JP2012210413A (ja) * 2010-04-13 2012-11-01 Baxter Internatl Inc アルツハイマー病の静脈内免疫グロブリン処置における脳室拡大速度の使用
EP2996772A4 (en) * 2013-05-13 2016-11-16 Momenta Pharmaceuticals Inc Methods for the treatment of neurodegeneration
US10450361B2 (en) 2013-03-15 2019-10-22 Momenta Pharmaceuticals, Inc. Methods related to CTLA4-Fc fusion proteins
US11661456B2 (en) 2013-10-16 2023-05-30 Momenta Pharmaceuticals, Inc. Sialylated glycoproteins
US12559542B2 (en) 2012-07-26 2026-02-24 Momenta Pharmaceuticals, Inc. Glycoproteins with anti-inflammatory properties

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090280114A1 (en) * 2002-04-12 2009-11-12 Ramot At Tel Aviv University Ltd. Prevention of brain inflammation as a result of induced autoimmune response
TWI445714B (zh) 2009-05-27 2014-07-21 Baxter Int 產製用於皮下使用之高濃度免疫球蛋白製備物之方法
US8796430B2 (en) 2010-05-26 2014-08-05 Baxter International Inc. Method to produce an immunoglobulin preparation with improved yield
AU2010202125B1 (en) 2010-05-26 2010-09-02 Takeda Pharmaceutical Company Limited A method to produce an immunoglobulin preparation with improved yield
WO2011150284A2 (en) 2010-05-26 2011-12-01 Baxter International Inc. Removal of serine proteases by treatment with finely divided silicon dioxide
EP2477032A1 (en) 2011-01-18 2012-07-18 Baxter International Inc Measurement of anti-amyloid antibodies in human blood
JP2014507649A (ja) 2011-01-18 2014-03-27 バクスター・インターナショナル・インコーポレイテッド ヒト血液中の抗βアミロイド抗体の測定
US9075069B2 (en) 2011-12-13 2015-07-07 Baxter International Inc. Measurement of autoantibodies at low conductivity with increased sensitivity
WO2017070589A1 (en) * 2015-10-22 2017-04-27 Duke University Methods and compositions for the diagnosis and treatment of central nervous system autoimmune diseases
US20220118060A1 (en) * 2019-02-04 2022-04-21 The Regents Of The University Of California Exercise-induced circulatory factors for amelioration of cognitive, neurological, and regenerative dysfunction during aging
WO2021202373A1 (en) 2020-03-31 2021-10-07 Baxalta Incorporated A method to produce an immunoglobulin preparation from c-1 inhibitor depleted plasma
CN119173446A (zh) 2022-03-08 2024-12-20 赤盾医疗有限公司 机器人药物制备系统中的流体转移站
CN116790745A (zh) * 2023-07-03 2023-09-22 复旦大学 阿尔茨海默病临床前期疾病转化的标志物及其筛选方法
WO2025068923A2 (en) 2023-09-26 2025-04-03 Takeda Pharmaceutical Company Limited IMMUNOGLOBULIN FORMULATIONS DEPLETED IN IgA
CN119020481B (zh) * 2024-08-29 2026-01-30 河络新图生物科技(上海)有限公司 检测xcl2基因表达的物质在制备检测帕金森病产品中的应用

Family Cites Families (57)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK166763C (da) 1983-03-16 1993-07-12 Immuno Ag Immunoglobulin-g-holdig fraktion
AT376367B (de) 1983-03-16 1984-11-12 Immuno Ag Verfahren zur herstellung von therapeutisch verabreichbaren, in endbehaeltern abgefuellten plasmaderivaten
EP0124506B1 (de) 1983-05-02 1988-08-17 IMMUNO Aktiengesellschaft für chemisch-medizinische Produkte Verfahren zur Inaktivierung von vermehrungsfähigen Krankheitserregern
AT389815B (de) 1984-03-09 1990-02-12 Immuno Ag Verfahren zur inaktivierung von vermehrungsfaehigen filtrierbaren krankheitserregern in blutprodukten
US5506337A (en) 1985-03-15 1996-04-09 Antivirals Inc. Morpholino-subunit combinatorial library and method
AT390560B (de) 1986-05-30 1990-05-25 Immuno Ag Verfahren zur inaktivierung von vermehrungsfaehigen filtrierbaren krankheitserregern
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
US5010175A (en) 1988-05-02 1991-04-23 The Regents Of The University Of California General method for producing and selecting peptides with specific properties
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
JP2871709B2 (ja) 1988-11-21 1999-03-17 住友製薬株式会社 免疫グロブリンg結合活性を有する新規な蛋白質プロテインh、該蛋白質をコードする遺伝子及び該蛋白質の製造法
US5177194A (en) 1990-02-01 1993-01-05 Baxter International, Inc. Process for purifying immune serum globulins
IE66205B1 (en) 1990-06-14 1995-12-13 Paul A Bartlett Polypeptide analogs
US5650489A (en) 1990-07-02 1997-07-22 The Arizona Board Of Regents Random bio-oligomer library, a method of synthesis thereof, and a method of use thereof
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
AT402891B (de) 1991-06-20 1997-09-25 Immuno Ag Verfahren zur herstellung eines inaktivierten blutproduktes
US5573905A (en) 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
US6019944A (en) 1992-05-21 2000-02-01 Biosite Diagnostics, Inc. Diagnostic devices and apparatus for the controlled movement of reagents without membranes
US5288514A (en) 1992-09-14 1994-02-22 The Regents Of The University Of California Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support
AU6653094A (en) 1992-12-16 1994-07-04 Immuno Aktiengesellschaft Process for preparing a virus-safe biological composition
HRP940645A2 (en) 1993-10-06 1996-12-31 Immuno Ag Process for virus deactivation in the presence of polyalkylene glycol and the pharmaceutical preparation thus obtained
US5519134A (en) 1994-01-11 1996-05-21 Isis Pharmaceuticals, Inc. Pyrrolidine-containing monomers and oligomers
US5593853A (en) 1994-02-09 1997-01-14 Martek Corporation Generation and screening of synthetic drug libraries
US5539083A (en) 1994-02-23 1996-07-23 Isis Pharmaceuticals, Inc. Peptide nucleic acid combinatorial libraries and improved methods of synthesis
US6447796B1 (en) 1994-05-16 2002-09-10 The United States Of America As Represented By The Secretary Of The Army Sustained release hydrophobic bioactive PLGA microspheres
US5525735A (en) 1994-06-22 1996-06-11 Affymax Technologies Nv Methods for synthesizing diverse collections of pyrrolidine compounds
US5549974A (en) 1994-06-23 1996-08-27 Affymax Technologies Nv Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof
US5569588A (en) 1995-08-09 1996-10-29 The Regents Of The University Of California Methods for drug screening
US20020114802A1 (en) 1998-02-10 2002-08-22 Tjellstrom Bo Arthur Einar Oral immunoglobulin treatment for inflammatory bowel disease
DE60040274D1 (de) 1999-03-10 2008-10-30 Phogen Ltd Verabreichung von nukleinsäuren und proteinen an zellen
WO2002002000A2 (en) * 2000-06-30 2002-01-10 Duke University Methods of screening for alzheimer's disease
US20020098182A1 (en) 2000-09-28 2002-07-25 Richard Weisbart Treatment of immune-mediated diseases by oral administration of plasma fractions enriched in immunoglobulin G
US20020130430A1 (en) 2000-12-29 2002-09-19 Castor Trevor Percival Methods for making polymer microspheres/nanospheres and encapsulating therapeutic proteins and other products
AU2002225219A1 (en) * 2001-01-26 2002-08-06 Oxford Glycosciences (Uk) Ltd Diagnosis and treatment of multiple sclerosis
US6905827B2 (en) * 2001-06-08 2005-06-14 Expression Diagnostics, Inc. Methods and compositions for diagnosing or monitoring auto immune and chronic inflammatory diseases
EP1463527A4 (en) 2001-10-04 2005-05-11 Protein Therapeutics Inc USE OF GAMMAGLOBULIN FOR THE TREATMENT OF IMMUNE-MEDIATED DISEASES
US7060498B1 (en) 2001-11-28 2006-06-13 Genta Salus Llc Polycationic water soluble copolymer and method for transferring polyanionic macromolecules across biological barriers
US7442512B2 (en) * 2001-11-30 2008-10-28 Chemocentryx, Inc. Compositions and methods for detecting and treating diseases and conditions related to chemokine receptors
US7141540B2 (en) 2001-11-30 2006-11-28 Genta Salus Llc Cyclodextrin grafted biocompatible amphilphilic polymer and methods of preparation and use thereof
US20050222064A1 (en) 2002-02-20 2005-10-06 Sirna Therapeutics, Inc. Polycationic compositions for cellular delivery of polynucleotides
WO2003081201A2 (en) * 2002-03-21 2003-10-02 Yissum Research Development Company Of The Hebrew University Of Jerusalem Peripheral blood cell markers useful for diagnosing multiple sclerosis and methods and kits utilizing same
US20040014109A1 (en) * 2002-05-23 2004-01-22 Pericak-Vance Margaret A. Methods and genes associated with screening assays for age at onset and common neurodegenerative diseases
AU2003251962A1 (en) * 2002-07-08 2004-01-23 Duke University Screening for alzheimer's disease
EP1585756B1 (en) 2002-11-26 2010-04-21 University of Massachusetts Delivery of sirnas
WO2005027733A2 (en) * 2003-09-18 2005-03-31 Ppd Biomarker Discovery Sciences, Llc Biological markers for diagnosing multiple sclerosis
EP1709195B1 (en) 2003-12-19 2014-01-22 Novartis Vaccines and Diagnostics, Inc. Cell transfecting formulations of small interfering rna, related compositions and methods of making and use
JP2007525211A (ja) 2004-01-19 2007-09-06 テクニオン リサーチ アンド ディベロップメント ファウンデーション リミテッド パーキンソン病の診断検査
US20060014289A1 (en) 2004-04-20 2006-01-19 Nastech Pharmaceutical Company Inc. Methods and compositions for enhancing delivery of double-stranded RNA or a double-stranded hybrid nucleic acid to regulate gene expression in mammalian cells
US7514530B2 (en) 2004-04-26 2009-04-07 Centre National De La Recherche Scientifique Peptide carrier for delivering siRNA into mammalian cells
WO2006077126A2 (en) * 2005-01-19 2006-07-27 Bayer Schering Pharma Aktiengesellschaft Cx3cr1 as a marker which correlates with both disease and disease activity in multiple sclerosis patients
CA2601157A1 (en) * 2005-03-16 2006-09-28 Osi Pharmaceuticals, Inc. Biological markers predictive of anti-cancer response to epidermal growth factor receptor kinase inhibitors
US20080045582A1 (en) * 2006-05-15 2008-02-21 Issam Zineh ENA-78 Gene Polymorphisms and Protein Concentrations as Diagnostic and Prognostic Tools
DE602007013615D1 (de) * 2006-12-29 2011-05-12 Tel Hashomer Medical Res Infrastructure & Services Ltd Verfahren und kits zur diagnose von multipler sklerose bei wahrscheinlichen multiple-sklerose-patienten
TWI552751B (zh) 2011-06-20 2016-10-11 H 朗德貝克公司 投予4-((1r,3s)-6-氯-3-苯基-二氫茚-1-基)-1,2,2-三甲基-哌及其鹽用於治療精神分裂症的方法

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
HUANG ET AL., FASEB, vol. 19, 2005, pages 761
KIM ET AL., EXP. AND MOL. MED., vol. 38, 2006, pages 333
WILMS ET AL., CURR. PHARM. DES., vol. 13, 2007, pages 1925
YAMAMOTO ET AL., AM. J. PATHOLOGY, vol. 166, 2006, pages 1475

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010112034A3 (en) * 2009-04-02 2011-05-05 Aarhus Universitet Compositions and methods for treatment and diagnosis of synucleinopathies
JP2012210413A (ja) * 2010-04-13 2012-11-01 Baxter Internatl Inc アルツハイマー病の静脈内免疫グロブリン処置における脳室拡大速度の使用
JP2013509985A (ja) * 2010-04-13 2013-03-21 バクスター、インターナショナル、インコーポレイテッド アルツハイマー病の静脈内免疫グロブリン処置における脳室拡大速度の使用
EP2451348A4 (en) * 2010-04-13 2013-07-31 Baxter Int USE OF THE VENTRICULAR MAGNITUDE RATE IN INTRAVENOUS IMMUNOGLOBULIN TREATMENT OF MORBUS ALZHEIMER
WO2012135752A1 (en) * 2011-04-01 2012-10-04 Baxter International Inc. Use of cytokine levels in intravenous immunoglobulin treatment of alzheimer's disease
US12559542B2 (en) 2012-07-26 2026-02-24 Momenta Pharmaceuticals, Inc. Glycoproteins with anti-inflammatory properties
US10450361B2 (en) 2013-03-15 2019-10-22 Momenta Pharmaceuticals, Inc. Methods related to CTLA4-Fc fusion proteins
EP2996772A4 (en) * 2013-05-13 2016-11-16 Momenta Pharmaceuticals Inc Methods for the treatment of neurodegeneration
US10464996B2 (en) 2013-05-13 2019-11-05 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US11352415B2 (en) 2013-05-13 2022-06-07 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US12297256B2 (en) 2013-05-13 2025-05-13 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US11661456B2 (en) 2013-10-16 2023-05-30 Momenta Pharmaceuticals, Inc. Sialylated glycoproteins

Also Published As

Publication number Publication date
EP2522753A1 (en) 2012-11-14
EP2522755A1 (en) 2012-11-14
US7968293B2 (en) 2011-06-28
EP2522755B1 (en) 2014-04-02
EP2522752B1 (en) 2014-04-02
AU2008286361A1 (en) 2009-02-19
ES2477294T3 (es) 2014-07-16
ES2477292T3 (es) 2014-07-16
ES2477271T3 (es) 2014-07-16
EP2522754A1 (en) 2012-11-14
EP2522753B1 (en) 2014-04-02
EP2522752A1 (en) 2012-11-14
EP2191014A2 (en) 2010-06-02
EP2522754B1 (en) 2014-04-02
JP5555626B2 (ja) 2014-07-23
CA2695972A1 (en) 2009-02-19
ES2477293T3 (es) 2014-07-16
EP2191014B1 (en) 2013-04-03
US20110177094A1 (en) 2011-07-21
JP2010535825A (ja) 2010-11-25
US20090148463A1 (en) 2009-06-11
AU2008286361B2 (en) 2013-09-26
ES2416719T3 (es) 2013-08-02
WO2009021708A3 (en) 2009-05-28

Similar Documents

Publication Publication Date Title
AU2008286361B2 (en) IVIG modulation of chemokines for treatment of multiple sclerosis, Alzheimer's disease, and Parkinson's disease
AU2020270508B2 (en) C/EBP alpha short activating RNA compositions and methods of use
US10889865B2 (en) Thyroid tumors identified
CN109863251B (zh) 对肺鳞状细胞癌亚型分型的方法
ES2374954T3 (es) Variaciones genéticas asociadas con tumores.
AU2016295347A1 (en) Gene signature for immune therapies in cancer
CA2430981A1 (en) Gene expression profiling of primary breast carcinomas using arrays of candidate genes
AU2018290809B2 (en) Biomarkers for the diagnosis and treatment of fibrotic lung disease
KR20140006898A (ko) 결장암 유전자 발현 시그니처 및 이용 방법
WO2010151841A2 (en) Single nucleotide polymorphisms in brca1 and cancer risk
CA2666057C (en) Genetic variations associated with tumors
AU2018304242A1 (en) Methods for detection of plasma cell dyscrasia
CN101778954A (zh) Egfr抑制剂治疗的预测性标记物
AU2013276994C1 (en) IVIG Modulations of Chemokines for Treatment of Multiple Sclerosis, Alzheimer's Disease, and Parkinson's Disease
IL270787B2 (en) Melanoma detection methods
CA2587863A1 (en) Genes associated with colorectal cancer
KR20120093956A (ko) 종양 분류를 위한 ir-a 및 ir-b의 정량
KR20220122197A (ko) 비근침윤성 방광암의 예후 예측을 위한 바이오마커 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08785488

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2695972

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2008286361

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2010520478

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2008286361

Country of ref document: AU

Date of ref document: 20080811

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2008785488

Country of ref document: EP