WO2008036682A2 - Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates - Google Patents
Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates Download PDFInfo
- Publication number
- WO2008036682A2 WO2008036682A2 PCT/US2007/078792 US2007078792W WO2008036682A2 WO 2008036682 A2 WO2008036682 A2 WO 2008036682A2 US 2007078792 W US2007078792 W US 2007078792W WO 2008036682 A2 WO2008036682 A2 WO 2008036682A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- rap
- variant
- liver
- amino acids
- fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/244—Lanthanides; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/715—Polysaccharides, i.e. having more than five saccharide radicals attached to each other by glycosidic linkages; Derivatives thereof, e.g. ethers, esters
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/243—Platinum; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/168—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
- A61N5/1001—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy using radiation sources introduced into or applied onto the body; brachytherapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to the use of receptor-associated protein (RAP), RAP fragments and RAP variants in methods for the treatment of liver disorders or conditions comprising administering RAP polypeptides conjugated to a therapeutic or active agent.
- RAP receptor-associated protein
- LRP1 is a member of the low-density lipoprotein receptor "LDLR".
- LRP1 is a large protein of 4525 amino acids (600 kDa), which is cleaved by furin to produce two subunits of 515-(alpha) kD and 85-( ⁇ ) kDa that remain non-covalently bound. LRP is expressed on most tissue types, but is primarily found in the liver.
- LDL-R low-density lipoprotein receptor family
- LRP2 megalin, gp330
- LRP/LRP1 and LRP1 B 600 kDa
- VLDL-R 130 kDa
- Mosaic LDL-R LR11 , 250 KDa
- LRP3, LRP6, and LRP-7 members of the low-density lipoprotein (LDL) receptor family
- LRP1 is believed to be a multifunctional receptor.
- a binding repeat resembling those found in the LDL receptor, is the molecular principle for the ability to bind a variety of ligands that were previously thought to be unrelated. These include the ligands lactoferhn, receptor associated protein (RAP), lipoprotein lipase, apoE, Factor VIII, beta-amyloid precursor, alpha-2- macroglobulin, thrombospondin 2 MMP-2 (matrix metalloproteinase-2), MPP- 9-TIMP-1 (tissue inhibitor of matrix metalloproteinase-1 ); uPA (urokinase plasminogen activator):PAI-l (plasminogen activator inhibitor-1 ):uPAR (uPA receptor); and tPA (tissue plasminogen activator):PAI-1 :uPAR, Pseudomonas exotoxin A, and human rhinovirus.
- RAP receptor associated protein
- LRP1 is has the GenBank Accession No.: X 13916 and SwissProt Primary Accession No.: Q07954.
- Alternative names for the LRP1 gene/protein include: Low-density lipoprotein receptor-related protein 1 [precursor], LRP, Alpha-2-macroglobulin receptor, A2MR, Apolipoprotein E receptor, ApoER, CD91 , LRP1 or A2MR.
- RAP receptor-associated protein
- CR complement repeat
- RAP is comprised of an array of three weakly homologous domains (Obermoeller, et al., (1997) J Biol Chem 272, 10761 -10768). Each of these domains (d1 , d2 and d3) has been shown to bind with varying affinity to pairs of immediately adjacent CR sequences within the LDLR ectodomains. Each of the effects of full-length RAP on LDLR, including facilitation of folding and inhibition of the binding of most other ligands (except ⁇ -2-macroglobulin), are recapitulated by RAPd3 alone.
- RAP d3 comprises amino acids 200-323 of mature Uniprot P30533 and amino acids 234-357 of precursor Uniprot P30533.
- Hepatocytes are epithelial cells lining the vascular sinusoids of the liver. This cell type constitutes about 80% of total liver mass, providing the vast blood contact surface necessary for the function of the organ. Hepatocytes express large amounts of the low-density lipoprotein receptor-associated protein (LRP1 ), which participates in lipoprotein metabolism, specifically chylomicron remnant clearance (1 ,2,3), as well as uptake of other circulating proteins into the liver (2,4,5). Consistent with its physiological roles, LRP1 is a highly efficient ligand trafficking receptor, undergoing constitutive endocytosis with rapid internalization and recycling rates (6). Following internalization, LRP1 delivers bound cargo to the lysosome where the protein is rapidly degraded.
- LRP1 low-density lipoprotein receptor- associated protein
- Hepatocellular carcinoma originates from hepatocytes or their progenitors. HCC is the fifth most common cancer worldwide, the third most common cause of cancer-related death, and has shown increasing incidence in the U. S (7,8,9,10,11 ,12). The probability of developing hepatocellular carcinoma increases with viral infection (hepatitis B and C), alcoholism, smoking and obesity. Prognosis for this disease is poor, with a reported 5-year median survival rate of under 5%. Surgical resection, transplant and physical ablation are first choices for treatment, but only 5 to 10% of patients present with tumors suitable for these approaches.
- Transartehal chemoembolism a procedure in which the blood supply to a tumor is blocked (embolized) and chemotherapy is administered directly into the tumor
- intrahepatic chemotherapy direct introduction of chemotherapy into liver tissue
- Systemic chemotherapy such as adhamycin yields response rates of 15-20%, both because of the systemic toxicity of effective chemotherapeutics and tumor-cell resistance to the same (16,17).
- Targeted delivery of conjugated therapeutics, such as 90 Yttrium, to liver after intravenous administration would significantly reduce the systemic toxicities associated with these drugs, reducing risk to the patient during treatment of HCC.
- conjugated therapeutics such as 90 Yttrium
- One method of providing this targeted delivery could employ liver specific molecules, or ligands that bound to receptors on the liver with high-affinity, such as RAP.
- the present invention relates to the use of RAP, RAP fragments and RAP variants for the treatment of liver disorders in a subject via administration of RAP-conjugated active agents which have improved transport into the liver.
- the invention provides a method of treating a liver disorder in a subject comprising administering to said subject an effective amount of a conjugate comprising (a) a receptor binding moiety selected from the group consisting of Receptor Associated Protein of SEQ ID NO: 1 (RAP), RAP fragments, and RAP variants that retain RAP's binding affinity to LRP1 of about 1 -5 nM, attached to (b) an active agent for treatment of liver disorder
- a conjugate comprising (a) a receptor binding moiety selected from the group consisting of Receptor Associated Protein of SEQ ID NO: 1 (RAP), RAP fragments, and RAP variants that retain RAP's binding affinity to LRP1 of about 1 -5 nM, attached to (b) an active agent for treatment of liver disorder
- the RAP variant molecule may constitute a portion of full-length human RAP.
- the RAP variant is missing at least 200 and up to 243 amino acids from the N-terminus of SEQ ID NO: 1.
- the RAP fragment or variant is missing 243 amino acids from the N-terminus of SEQ ID NO: 1.
- the RAP variant is missing up to 11 amino acids from the C-terminus, and may further be missing at least 4 amino acids from the C-terminus of SEQ ID NO: 1.
- the RAP variant comprises a continuous portion of mature RAP (SEQ ID NO: 1 ) that is (a) at least 71 amino acids in length and (b) comprises amino acids 256-270.
- the RAP variant comprises a continuous portion of RAP d3 (SEQ ID NO: 2) that is (a) at least 71 amino acids in length and (b) comprises amino acids 256-270.
- the RAP variants have mutations within the third domain (d3) of RAP.
- RAP d3 comprises amino acids 200-323 of mature RAP (Uniprot P30533) (SEQ ID NO: 2) and amino acids 234-357 of precursor RAP (Uniprot P30533).
- the polypeptide comprises a RAP variant that lacks at least amino acids 1 -143 of RAP of mature P30533.
- the RAP variant lacks at least amino acids 1 -143 and amino acids 320-323 of mature RAP.
- the polypeptide lacks up to 4 of the C-terminal amino acids of RAP of mature P30533.
- the invention contemplates a method wherein the receptor binding moiety is a cyclic RAP peptide that is less than about 85 amino acids in length, comprising 50 contiguous amino acids that are at least 70% identical to SEQ ID NO: 4, and which binds to LRP1.
- the cyclic RAP peptide binds to LRP1 with a Kd of about 1 x 10 ⁇ 8 M or less.
- the invention provides methods wherein the RAP, RAP fragment or RAP variant comprises a mutation.
- the mutation comprises one or more conservative substitutions relative to native RAP of SEQ ID NO: 1.
- the mutation is the replacement of an acidic amino acid with a basic amino acid.
- said acidic amino acid is selected from the group consisting of D and E.
- said basic amino acid is selected from the group consisting of K and R.
- said mutation in the RAP, RAP fragment or RAP variant is the replacement of a basic amino acid with an acidic amino acid.
- said basic amino acid is selected from the group consisting of K and R.
- said acidic amino acid is selected from the group consisting of D and E.
- said mutation is the replacement of an amino acid selected from the group consisting of A, C, D, E, G, I, K, L, M, N, P, Q, R, S, T, and V with an amino acid selected from the group consisting of F, Y, W, and H.
- the RAP fragment or RAP variants contemplated for use in the invention comprise a mutation at any one of positions 251 , 256, 257, 266, 270, 279, 280, 296 or 305 of mature RAP.
- the invention contemplates oligomeric combinations of RAP domains or variants of RAP domains.
- the RAP coding sequence has been divided into the three, previously defined domains. Each domain comprises approximately 100 amino acids with a molecular mass of approximately 10 kD.
- Domain 1 (or d1 ) consists of amino acids 1-94 of the mature sequence of Genbank Accession No. P30533; domain 2 (or d2) consists of amino acids 95-198; and domain 3 (or d3) consists of amino acids 199-319, lacking the C-terminal 4 amino acid retention signal (SEQ ID NO: 9).
- variants of RAP domains include polypeptides comprising 2 or more variants of RAP d1 , comprising 2 or more variants of RAP d2, comprising 2 or more variants of RAP d3, comprising a variant of RAP d1 and variant of RAP d3 but lacking RAP d2, comprising 2 or more variants of RAP d1 together with 2 or more variants of RAP d2 or RAP d3 in various combinations (e.g.
- the invention contemplates an oligomeric combination comprising 2 or more variants of RAP d3, wherein the variant of RAP d3 is a cyclic RAP peptide as described herein.
- the invention further contemplates use of a conjugate comprising the polypeptide receptor-associated protein (RAP), RAP variant, RAP fragment or combination of variants, conjugated to a diagnostic or therapeutic agent.
- RAP polypeptide receptor-associated protein
- the polypeptide and diagnostic or therapeutic agent are linked through a linker.
- said linker is a peptide linker.
- the invention provides for use of a pharmaceutical composition comprising a RAP variant conjugated to a diagnostic or therapeutic agent in a pharmaceutically acceptable carrier, diluent or excipient.
- the present invention provides a method to produce RAP variants and conjugates in amounts which enable using compositions comprising such RAP variants and RAP conjugates therapeutically.
- the invention also provides a nucleic acid that encodes any of the foregoing polypeptides comprising RAP, RAP fragments and RAP variants useful in the methods of the invention.
- Vectors comprising such nucleic acids, host cells containing such nucleic acids or vectors, and methods of producing such polypeptides comprising the steps of cultuhng the host cells in suitable culture medium and isolating the polypeptide from said host cells or culture medium are also provided.
- the invention provides methods for treatment of a disease or condition associated with liver damage, wherein the liver condition or disease is selected from the group consisting of hepatic cancer, hepatitis, cirrhosis, fungal, rickettsial or parasitic infections, damage associated with alcohol, chemical toxins, and drug toxicity, metabolic liver disease, idiopathic autoimmune liver disease, biliary obstruction, hepatic steatis, cholestasis, and post-hepatectomy conditions.
- the hepatic cancer is Hepatocellular carcinoma.
- the hepatic cancer is selected from the group consisting of hepatocellular carcinoma and the active agent moiety is a cytotoxic chemotherapeutic agent.
- the disorder is a liver tumor or tumor metastases in the liver
- the therapeutic agent is a chemotherapeutic agent.
- the invention provides a method for treatment wherein the active agent is a cytotoxic agent.
- the cytotoxic agent is selected from the group consisting of Mechlorethamine hydrochloride, Cyclophosphamide, Ifosfamide, Chlorambucil, Melphalan, Busulfan, Thiotepa, Carmustine, Lomustine, dacarbazine and Streptozocin.
- the cytotoxic agent is a radioisotope.
- the radioisotope is selected from the group consisting of 131 I, 125 I, 111 In, 90 Y, 67 Cu, 127 Lu, 212 Bi, 213 Bi, 255 Fm, 149 Tb, 223 Rd 1 213 Pb, 212 Pb, 211 At, 89 Sr, 153 Sm, 166 Ho, 225 Ac, 186 Re, 67 Ga, 68 Ga and 99m Tc.
- method of the invention provides that the disorder to be treated is hepatitis caused by a virus, and the therapeutic agent is an antiviral agent.
- Figure 1A-B depict binding of RAP d3, MegaRAPI d3 (RAPv2A d3) and intermediate sequence variants to LRP2 CR89 and LRP1 CR3-5.
- Figure 1 A illustrates binding of RAP d3 mutants and RAPv2A d3 revertants to LRP2 CR89.
- Figure 1 B illustrates binding of RAP d3 mutants and RAPv2A d3 revertants to LRP1 CR3-5. Data were plotted and fitted by non-linear regression with the assumption of a single binding site (GraphPad Prism). Kd values with standard deviations were derived from the regression analysis.
- Figure 2 shows the percent of cell death after administration of a RAP peptide-toxin conjugate to cells expressing the LRP1 receptor.
- Figure 3 is an illustration of the structure of cyclic RAP and multimehzed cyclic RAP peptides.
- Figure 4 shows the uptake and bio-distribution of mRAPc multimerized peptides in tissues in vivo.
- Table 2 shows data for binding of RAP d3 and RAP v2 (RAP v2A) variants to LRP1 CR3-5 and LRP2 CR89.
- NF indicates that binding could not be measured or that data could not be reliably fit using non-linear regression with the assumption of a single binding site.
- Percent of maximum binding is the ratio of the OD at the highest concentration tested for each ligand and the highest OD measured for all such ligands at that concentration.
- the present invention relates to methods of delivering compounds to the liver comprising administering RAP protein conjugates that bind to liver receptor LRP1 and are internalized into the liver. Internalization of the RAP- conjugate is an effective means of delivering therapeutic compounds or other active agents to the liver to treat a liver disease or condition.
- Liver tumors and other neoplasia in or around the liver includes both primary tumors and/or metastases that develop in or around the liver. It may also mean metastases of liver tumors that migrate elsewhere in the body, but remain responsive to RAP, RAP fragments or RAP variant polypeptide conjugates with chemotherapeutic agents. Many types of such tumors and neoplasia are known.
- Primary liver tumors include hepatocellular carcinoma and others known in the art.
- tumors and neoplasia may be associated with the liver and hepatic tissue. Such tumors are generally solid tumors, or they are diffuse tumors with accumulations localized to the liver. Tumors or neoplasia for treatment according to the invention may be malignant or benign, and may have been treated previously with chemotherapy, radiation and/or other treatments.
- the term "effective amount” means a dosage sufficient to produce a desired result on a health condition, pathology, and disease of a subject or for a diagnostic purpose.
- the desired result may comprise a subjective or objective improvement in the recipient of the dosage.
- “Therapeutically effective amount” refers to that amount of an agent effective to produce the intended beneficial effect on health.
- Small organic molecule refers to organic molecules of a size comparable to those organic molecules generally used in pharmaceuticals.
- Preferred small organic molecules range in size up to about 5,000 Da, up to about 2,000 Da, or up to about 1 ,000 Da.
- a "subject" of diagnosis or treatment is a human or non-human animal, including a mammal or a primate.
- Treatment refers to prophylactic treatment or therapeutic treatment or diagnostic treatment.
- a "prophylactic" treatment is a treatment administered to a subject who does not exhibit signs of a disease or exhibits only early signs for the purpose of decreasing the risk of developing pathology.
- the conjugate compounds of the invention may be given as a prophylactic treatment to reduce the likelihood of developing a pathology or to minimize the severity of the pathology, if developed.
- a "therapeutic" treatment is a treatment administered to a subject who exhibits signs or symptoms of pathology for the purpose of diminishing or eliminating those signs or symptoms.
- the signs or symptoms may be biochemical, cellular, histological, functional, subjective or objective.
- the conjugate compounds of the invention may be given as a therapeutic treatment or for diagnosis.
- Diagnostic means identifying the presence or nature of a pathologic condition. Diagnostic methods differ in their specificity and selectivity. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
- composition refers to a composition suitable for pharmaceutical use in subject animal, including humans and mammals.
- a pharmaceutical composition comprises a pharmacologically effective amount of a RAP, RAP fragment or RAP variant polypeptide conjugated to an active agent, and also comprises a pharmaceutically acceptable carrier.
- a pharmaceutical composition encompasses a composition comprising the active ingredient(s), and the inert ingredient(s) that make up the carrier, as well as any product which results, directly or indirectly, from combination, complexation or aggregation of any two or more of the ingredients, or from dissociation of one or more of the ingredients, or from other types of reactions or interactions of one or more of the ingredients.
- the pharmaceutical compositions of the present invention encompass any composition made by admixing a conjugate compound of the present invention and a pharmaceutically acceptable carrier.
- “Pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers, buffers, and excipients, such as a phosphate buffered saline solution, 5% aqueous solution of dextrose, and emulsions, such as an oil/water or water/oil emulsion, and various types of wetting agents and/or adjuvants. Suitable pharmaceutical carriers and formulations are described in Remington's Pharmaceutical Sciences, 19th Ed. (Mack Publishing Co., Easton, 1995). Preferred pharmaceutical carriers depend upon the intended mode of administration of the active agent.
- Typical modes of administration include enteral (e.g., oral) or parenteral (e.g., subcutaneous, intramuscular, intravenous or intraperitoneal injection; or topical, transdermal, or transmucosal administration).
- a "pharmaceutically acceptable salt” is a salt that can be formulated into a compound for pharmaceutical use including, e.g., metal salts (sodium, potassium, magnesium, calcium, etc.) and salts of ammonia or organic amines.
- unit dosage form refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of compounds of the present invention calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle.
- the specifications for the novel unit dosage forms of the present invention depend on the particular conjugate employed and the effect to be achieved, and the pharmacodynamics associated with each compound in the host.
- Modulate refers to the ability to alter, by increase or decrease (e.g., to act as an antagonist or agonist).
- Increasing relative delivery refers to the effect whereby the accumulation at the intended delivery site (e.g., liver) of a RAP, RAP fragment or RAP variant -conjugated active agent is increased relative to the accumulation of the unconjugated active agent.
- Therapeutic index refers to the dose range (amount and/or timing) above the minimum therapeutic amount and below an unacceptably toxic amount.
- Equivalent dose refers to a dose, which contains the same amount of active agent.
- Polynucleotide refers to a polymer composed of nucleotide units.
- Polynucleotides include naturally occurring nucleic acids, such as deoxyribonucleic acid (“DNA”) and ribonucleic acid (“RNA”) as well as nucleic acid analogs.
- Nucleic acid analogs include those which include non-naturally occurring bases, nucleotides that engage in linkages with other nucleotides other than the naturally occurring phosphodiester bond or which include bases attached through linkages other than phosphodiester bonds.
- nucleotide analogs include, for example and without limitation, phosphorothioates, phosphorodithioates, phosphorothesters, phosphoramidates, boranophosphates, methylphosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs), and the like.
- PNAs peptide-nucleic acids
- Such polynucleotides can be synthesized, for example, using an automated DNA synthesizer.
- the term “nucleic acid” typically refers to large polynucleotides.
- oligonucleotide typically refers to short polynucleotides, generally no greater than about 50 nucleotides.
- nucleotide sequence when a nucleotide sequence is represented by a DNA sequence (i.e., A, T, G, C), this also includes an RNA sequence (i.e., A, U, G, C) in which "U” replaces "T.” Nucleotide sequences that encode proteins and RNA may include introns.
- cDNA refers to a DNA that is complementary or identical to an mRNA, in either single stranded or double stranded form.
- the DNA strand having the same sequence as an mRNA is referred to as the "coding strand”; sequences on the DNA strand having the same sequence as an mRNA transcribed from that DNA and which are located 5' to the 5'-end of the RNA transcript are referred to as "upstream sequences"; sequences on the DNA strand having the same sequence as the RNA and which are 3' to the 3' end of the coding RNA transcript are referred to as "downstream sequences.”
- “Complementary” refers to the topological compatibility or matching together of interacting surfaces of two polynucleotides.
- the two molecules can be described as complementary, and furthermore, the contact surface characteristics are complementary to each other.
- a first polynucleotide is complementary to a second polynucleotide if the nucleotide sequence of the first polynucleotide is identical to the nucleotide sequence of the polynucleotide binding partner of the second polynucleotide.
- the polynucleotide whose sequence 5'-TATAC-3' is complementary to a polynucleotide whose sequence is 5'-GTATA-3'.
- An example of stringent hybridization conditions for hybridization of complementary nucleic acids which have more than 100 complementary residues on a filter in a Southern or northern blot is 50% formalin with 1 mg of heparin at 42°C, with the hybridization being carried out overnight.
- An example of highly stringent wash conditions is 0.15 M NaCI at 72°C for about 15 minutes.
- An example of stringent wash conditions is a 0.2X SSC wash at 65°C for 15 minutes (see, Sambrook et al. for a description of SSC buffer).
- a linear sequence of amino acids within each CR with the motif AxcBxCxD, where c is a conserved cysteine, x is any amino acid, and B and D are either aspartate, glutamate or asparagine, has been demonstrated to participate in calcium binding and in the binding of ligands.
- c is a conserved cysteine
- x is any amino acid
- B and D are either aspartate, glutamate or asparagine
- Recombinant polynucleotide refers to a polynucleotide having sequences that are not naturally joined together.
- An amplified or assembled recombinant polynucleotide may be included in a suitable vector, and the vector can be used to transform a suitable host cell.
- a host cell that comprises the recombinant polynucleotide is referred to as a "recombinant host cell.”
- the gene is expressed in the recombinant host cell to produce, e.g., a "recombinant polypeptide.”
- a recombinant polynucleotide may serve a non-coding function (e.g., promoter, origin of replication, hbosome-binding site, etc.) as well.
- “Expression control sequence” refers to a nucleotide sequence in a polynucleotide that regulates the expression (transcription and/or translation) of a nucleotide sequence operatively linked thereto. "Operatively linked” refers to a functional relationship between two parts in which the activity of one part (e.g., the ability to regulate transcription) results in an action on the other part (e.g., transcription of the sequence).
- Expression control sequences can include, for example and without limitation, sequences of promoters (e.g., inducible or constitutive), enhancers, transcription terminators, a start codon (i.e., ATG), splicing signals for introns, and stop codons.
- Expression vector refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
- An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in vitro expression system.
- Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses that incorporate the recombinant polynucleotide.
- Polypeptide refers to a polymer composed of amino acid residues, related naturally occurring structural variants, and synthetic non-naturally occurring analogs thereof linked via peptide bonds, related naturally occurring structural variants, and synthetic non-naturally occurring analogs thereof. Synthetic polypeptides can be synthesized, for example, using an automated polypeptide synthesizer.
- the term "protein” typically refers to large polypeptides.
- the term “peptide” typically refers to short polypeptides.
- RAP variant refers to any of two or more polymorphic forms of alpha-2-macroglobulin/low density lipoprotein receptor-related protein- associated protein 1 (RAP), Uniprot accession P30533, Pfam accession numbers PF06400 and PF06401 ). Variants differ in the composition of their amino acid sequences based on one or more mutations involving substitution of one or more amino acids for other amino acids. Substitutions can be conservative or non-conservative based on the physico-chemical or functional relatedness of the amino acid that is being replaced and the amino acid replacing it.
- nucleotide or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- substantially homologous or “substantially identical” in the context of two nucleic acids or polypeptides, generally refers to two or more sequences or subsequences that have at least 40%, 60%, 80%, 90%, 95%, 98% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- the substantial identity exists over a region of the sequences that is at least about 50 residues in length, more preferably over a region of at least about 100 residues, and most preferably the sequences are substantially identical over at least about 150 residues.
- the sequences are substantially identical over the entire length of either or both comparison biopolymers.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, Adv. Appl. Math. 2:482 (1981 ), by the homology alignment algorithm of Needleman and Wunsch, J. MoI. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wl), or by visual inspection.
- Another example of algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. MoI. Biol. 215:403-410 (1990).
- substantially pure or “isolated” means an object species is the predominant species present (i.e., on a molar basis, more abundant than any other individual macromolecular species in the composition), and a substantially purified fraction is a composition wherein the object species comprises at least about 50% (on a molar basis) of all macromolecular species present.
- a substantially pure composition means that about 80% to 90% or more of the macromolecular species present in the composition is the purified species of interest.
- the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) if the composition consists essentially of a single macromolecular species.
- the conjugates of the invention are substantially pure or isolated.
- the conjugates useful in the methods of the invention are substantially pure or isolated with respect to the macromolecular starting materials used in their synthesis.
- the pharmaceutical composition of the invention comprises a substantially purified or isolated conjugate of a RAP, RAP fragment or RAP variant polypeptide and the active agent admixed with one or more pharmaceutically acceptable excipient.
- Naturally-occurring refers to the fact that the object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.
- Linker refers to a molecule that joins two other molecules, either covalently, or through ionic, van der Waals or hydrogen bonds, e.g., a nucleic acid molecule that hybridizes to one complementary sequence at the 5' end and to another complementary sequence at the 3' end, thus joining two non- complementary sequences.
- LDLR refers to members of the low-density lipoprotein receptor family including the low-density lipoprotein receptor-related protein 1 (LRP1 ), LDL-R (132 kDa); LRP2 (megalin, gp330); LRP/LRP1 and LRP1 B (600 kDa); VLDL-R (130 kDa); LRP5; LRP6; apoER-2 (LRP-8, 130 kDa); Mosaic LDL-R (LR11 , 250 KDa); and other members such as LRP3, LRP6, and LRP-7.
- LRP1 low-density lipoprotein receptor-related protein 1
- LRP2 megalin, gp330
- LRP/LRP1 and LRP1 B 600 kDa
- VLDL-R 130 kDa
- Mosaic LDL-R LR11 , 250 KDa
- Characteristic features of the family include cell-surface expression; extracellular ligand binding domain repeats (DxSDE); a requirement of Ca++ for ligand binding; binding of RAP and apoE; EGF precursor homology domain repeats (YWTD); a single membrane spanning region; internalization signals in the cytoplasmic domain (FDNPXY); and receptor mediated endocytosis of various ligands.
- DxSDE extracellular ligand binding domain repeats
- YWTD EGF precursor homology domain repeats
- FDNPXY internalization signals in the cytoplasmic domain
- receptor mediated endocytosis of various ligands Some members of the family, including LRP1 , participate in signal transduction pathways
- LDLR ligands refer to a number of molecules that are known to bind LDLR. These molecules include, for instance, lactoferrin, RAP, lipoprotein lipase, apoE, Factor VIII, beta-amyloid precursor, alpha-2-macroglobulin, thrombospondin 2 MMP-2 (matrix metalloproteinase-2), MPP-9-TIMP-1 (tissue inhibitor of matrix metalloproteinase-1 ); uPA (urokinase plasminogen activator):PAI-l (plasminogen activator inhibitor-1 ):uPAR (uPA receptor); and tPA (tissue plasminogen activator):PAI-1 :uPAR.
- LDLR bind to a wide variety of extracellular ligands through conserved protein domains within the N-terminal extracellular domain, or ectodomain, of each receptor. These domains include the complement-type repeat (CR, or low-density lipoprotein receptor domain class A, Idl-a), the EGF-like repeat and the YWTD, or beta-propeller, domain.
- the CR domains are responsible for association with most of the ligands that have been identified.
- the CR sequence specifies a conserved fold, termed the LDL receptor-like module (SCOP terminology).
- Each approximately 36 amino acid CR contains six cysteines that form three intramolecular cystines in a 1 -3, 2-5, 4-6 configuration, and a calcium ion bound within one lobe of a bilobate loop.
- the second ligand-binding domain of human LRP1 is composed of eight consecutive CR units. Each of the seven possible adjacent CR pairs have been individually expressed and assayed for binding to RAPd3 (Andersen, et al., (2000) J Biol Chem 275, 21017-21024). Except for the last pair (CR9 and CR10), which contains non-preferred residues at CR positions in the second CR, all pairs bind with similar affinity (1 -5 nM) to RAP.
- Random and site-directed mutagenesis of RAP indicates that there may be a few residues that contribute disproportionately to the affinity of the ligand complex with the CR pair ( Migliorini, et al.,(2003) J Biol Chem 278, 17986-17992).
- lysines at positions 256 and 270 in RAPd3 have been found to be important for binding of this domain to LRP1.
- a RAPd3 variant termed Mega RAP1 which has mutations of H249T, E251 K, K256A and K270D (based on full-length RAP sequence), fails to bind LRP1 CR domains (See Figure 1 , Table 2).
- the RAP molecule is initially produced as a 357 amino acid protein (SEQ ID NO: 6 and 7) having a 35 amino acid signal sequence which is cleaved to form mature RAP which is a 323 amino acid peptide (SEQ ID NO: 1 ).
- the mature RAP also retains a 4 amino acid C-terminal endoplasmic reticulum retention signal.
- RAP binding motifs have also been characterized by use of truncated and site-directed RAP mutants (see Melman et al. J. Biol. Chem. 276(31 ):29338-29346, 2001 ).
- Particular RAP polypeptide fragments include fragments (defined from RAP N terminus amino acid to RAP C-terminus amino acid position) 1 -323 (RAP); 1 -319; 1 -250; 1-110; 91 -210; 191 -323; 221 - 323; 1 -190; 1 -200; and 1 -210.
- a RAP protein for use in the invention is mature RAP lacking the signal peptide (SEQ ID NO: 1 ),
- the RAP lacks both the RAP signal peptide at the N-terminus and the HNEL endoplasmic reticulum retention signal at the C-terminus (SEQ ID NO: 8).
- Preferred RAP polypeptides include fragments 1 -323 (RAP); 1 - 319; 191 -323; and 1 -210, fragments having at least 71 consecutive amino acids of RAP comprising amino acids 256-270, and RAP fragments having at least 71 consecutive amino acids of RAP comprising amino acids 256-270 and comprise a continuous portion of RAP d3.
- a modified RAP polypeptide having the C-terminal four amino acid sequence substituted by the sequence KDEL is also suitable.
- a modified RAP polypeptide in which the C-terminal- four amino acid sequence (HNEL) is deleted is also suitable.
- RAP variants may also include conservative substitution of particular amino acid residues. "Conservative" amino acid substitutions are made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
- nonpolar (hydrophobic) amino acids include alanine (Ala, A), leucine (Leu, L), isoleucine (lie, I), valine (VaI, V), proline (Pro, P), phenylalanine (Phe, F), tryptophan (Trp, W), and methionine (Met, M); polar neutral amino acids include glycine (GIy, G), serine (Ser, S), threonine (Thr, T), cysteine (Cys, C), tyrosine (Tyr, Y), asparagine (Asn, N), and glutamine (GIn, Q); positively charged (basic) amino acids include arginine (Arg, R), lysine (Lys, K), and histidine (His, H); and negatively charged (acidic) amino acids include aspartic acid (Asp, D) and glutamic acid (GIu, E).
- polar neutral amino acids include glycine (GIy, G
- the variation may be introduced by systematically making substitutions of amino acids in a polypeptide molecule using recombinant DNA techniques and assaying the resulting recombinant variants for activity. Nucleic acid alterations can be made at sites that differ in the nucleic acids from different species (variable positions) or in highly conserved regions (constant regions). Methods for expressing polypeptide compositions useful in the invention are described in greater detail below.
- RAP polypeptide comprises the native amino acid sequence of RAP over positions 282-289, 201 -210, and 311 -319. Mutated and N-terminus or C-terminus truncated variants of RAP which bind to the LRP receptor are disclosed in Melman et al. (J. Biol. Chem. 276(31 ): 29338- 46, 2001 ) which is incorporated herein by reference in its entirety and with particularity to these RAP mutated and truncated variants.
- Other preferred RAP polypeptides comprise a native sequence of RAP between amino acids 85-148 and 178-248. (See Farquhar et al., Proc. Nat. Acad. Sci. USA 91 :3161 -3162 (1994).
- RAP and RAP fragments disclose the binding sites and structure activity relationships for binding of RAP and RAP fragments to the LRP receptor.
- the skilled artisan can readily adapt a variety of well known techniques in the art in order to obtain RAP polypeptides that contain a LRP binding site and are suitable for use as RAP polypeptides according to the invention.
- the preferred fragments of RAP are soluble under physiological conditions.
- the N-terminus or C-terminus of these polypeptides can be shortened as desired, provided that the binding capacity for the LRP particle remains intact.
- RAP is functionally bidentate, with both the first and third domains (d1 and d3) binding with low nanomolar affinity to particular tandem pairs of complement-type repeats (CR) within the LDLR (27).
- Domain 3 consisting of approximately 110 amino acids, has been shown to have the highest affinity for relevant CR pairs.
- stable folding of d3 has been shown to require sequences within RAP that do not participate directly in forming the receptor contact surface (28). These additional sequences, found within the N-terminal region of d3 and the C- terminal region of d2, are therefore necessary to ensure stable folding and high-affinity receptor binding.
- Isolated d3 does not bind as tightly to receptor as does d3 within the context of full-length RAP. Truncated versions of d3 that lack the fold-stabilizing sequences also bind poorly to receptor. Structural data derived from the complex between RAP d3 and LDLR CR34 (29) indicates that the receptor-binding sequences of RAP d3 are found within two anti-parallel alpha-helices of approximately equal length joined by a flexible loop. The paired helical ensemble has a pronounced counter-clockwise twist and resembles a stretched, twisted "U".
- a non-native disulfide bond has been engineered connecting the termini of the two anti-parallel helices making up the receptor binding unit of RAP d3 (See co-owned US patent application No. 60/919,238, filed March 21 , 2007 (Attorney docket no. 31075/42620)), the disclosure of which is incorporated by reference herein in its entirety.
- the cyclized peptide is approximately 75 amino acids long but has superior binding affinity compared to uncyclized peptide and comparable affinity to 110-amino acid RAP d3.
- One possible application for such minimized RAP d3 peptides is as a targeting agent for delivering therapeutic agents according to the methods of the invention.
- the cyclic RAP peptides contemplated by the invention are based on the amino acid sequence of mature RAP, preferably domain 3, are preferably less than 123 amino acids in length and contain a covalent bond between two non-consecutive amino acids.
- the covalent bond stabilizes the three-dimensional structure of the RAP peptide.
- the covalent bond provides an improvement in binding affinity so that the cyclic RAP peptide binds to a CR-containing protein with a Kd of about 1 x 10 "8 M or less (less meaning better affinity).
- binding affinities can be measured by any method known in the art, such as radioimmunoassay, ELISA, surface plasmon resonance (SPR) based technology (e.g., Biacore) analysis, or kinetic exclusion assay (e.g., KinExA).
- the affinity data may be analyzed, for example, by the method of Scatchard et al., Ann N.Y. Acad. Sci., 51 :660 (1949).
- the binding affinity for a CR-protein, such as LRP1 is about 1 x 10 ⁇ 9 , 10 ⁇ 10 , 10 "11 , 10 ⁇ 12 , 10 ⁇ 13 , 10 "14 M or less.
- the invention provides cyclic RAP peptides of various sizes, including about 103, about 99, about 95, about 90, about 85, about 82, about 80, about 78, about 76, 75, 74, 73, 72, 71 , 70, 69, 68, 67, 66, 65, 64, 63, 62, 61 , 60, 59, 58, 57, or 56 amino acids in length or less.
- the covalent bond is formed between amino acids that are separated by about 76, 75, 74, 73, 72, 71 , 70, 69, 68, 67, 66, 65, 64, 63, 62, 61 , 60, 59, 58, 57, or 56 amino acids.
- the amino acid sequence of the RAP peptides (including cyclic RAP peptides) useful in the methods of the invention is missing at least 200 and up to 243 amino acids from the N-terminus of mature RAP.
- the RAP peptide may be missing amino acids 1 -200, 1 -220, 1- 225, 1 -230, 1 -235, 1 -240, 1 -241 , 1 -242, 1-243, or alternatively 1 -244, 1 -245, 1 -246, 1 -247, or 1 -248 of mature RAP.
- the RAP peptide amino acid sequence is further missing at least 4 and up to 11 amino acids from the C-terminus of mature RAP.
- the RAP peptide may be missing amino acids 314-323 or 313-323, or alternatively 304-323, 305-323, 306-323, 307-323, 308-323, 309-323, 310-323, 311 -323, or 312-323 of mature RAP.
- the RAP peptide amino acid sequence comprises a continuous portion of mature RAP that is (a) at least 71 amino acids in length and (b) comprises amino acids 256-270.
- the RAP peptide amino acid sequence comprises a continuous portion of mature RAP domain 3 that is (a) at least 71 amino acids in length and (b) comprises amino acids 256-270.
- RAP peptide including cyclic RAP peptide
- exemplary portions of RAP include amino acids 200-323, 221 -323, 200-319, 221 -319, 243-319, 244-319, 249- 319, 200-313, 221 -313, 243-313, 244-313, 249-313, 200-303, 221 -303, 243- 303, 244-303, or 249-303 of mature RAP (SEQ ID NO: 1 ).
- cyclic RAP peptides can be prepared that exhibit affinity for and selectivity for CR-containing proteins that is similar to that of native RAP (e.g., about 5-fold difference or less compared to native RAP). Cyclic RAP peptides can also be prepared that exhibit improved affinity for LRP1 compared to native RAP. In one embodiment, the cyclic RAP peptide exhibits at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, 5-fold, 7- fold, 10-fold, or 20-fold improved affinity (relative to native RAP) for LRP1 (P98157).
- the cyclic RAP peptides contemplated by the invention may be composed of native RAP sequence or may include mutations to the native sequence.
- the cyclic RAP peptides of the invention comprise an amino acid sequence at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to either amino acids 243-313 of RAP set forth in SEQ ID NO: 3 or amino acids 249-303 of RAP set forth in SEQ ID NO: 4.
- the cyclic RAP peptide is less than about 85 amino acids in length, comprises 50 contiguous amino acids that are at least 70% identical to SEQ ID NO: 4, and binds to a CR-containing protein with a binding affinity Kd of about 1 x 10 "8 M or less.
- Cyclic RAP peptides may be made that contain conservative substitutions (e.g., up to 5, up to 10, up to 15, up to 20 or up to 25) relative to the native RAP sequence yet still retain binding affinity for LRP1.
- RAP peptides containing non-conservative substitutions may also retain binding affinity for LRP1.
- a non-conservative mutation at any one of positions 217, 249, or 251 of mature RAP has been shown not to affect binding affinity.
- the RAP peptides may contain a cysteine at or near the N-terminus of the peptide and a cysteine at or near the C-terminus of the peptide, allowing cyclization of the peptide and stabilization of the alpha-helices through disulfide bond formation between the two cysteines.
- a glycine or proline may be interposed between the cysteines and the alpha-helices (e.g. Cys-Gly at the N-terminus and Gly-Cys at the C-terminus). Introduction of glycines allows a break in the alpha-helix for an adjacent non-native inter-helical disulfide bond.
- the Hep1 sequence differs from human RAP at three positions at the N-terminus (LEA/XCG) and two positions at the C-terminus (RI/GC) (SEQ ID NO: 9). Patients should be immunologically tolerant of peptides derived from RAP. While an epitope within domains 1 and 2 of RAP plays a role in the development of experimental Heymann nephritis in rats, the Hep1 peptide is derived entirely from domain 3. Since human RAP has sequence differences with both rodent and canine RAP sequences, these species are expected to develop significant anti-drug antibody titers within a few weeks of intravenous administration.
- any of the cyclic RAP peptides herein are multimerized into oligomeric combinations as described herein.
- “Multimerized cyclic RAP peptide” as used herein refers to a polypeptide comprising 2 or more variants of RAP d3, wherein the variant of RAP d3 is a cyclic RAP peptide as described herein.
- the terms “multimer” and “oligomer” are used interchangeably herein.
- the oligomer or multimer comprises at least two, at least three, at least four, at least five, at least six, at least seven or at least eight cyclic RAP peptides.
- the cyclic RAP peptides are conjugated to a biotin molecule in order to facilitate multimehzation or oligomehzation.
- the biotin- conjugated-cyclic peptides may then be multimerized by binding to streptavidin or by binding to an anti-biotin antibody (Figure 3).
- Cyclic RAP peptide oligomers or multimers may also be made by other techniques well- known in the art and described below. [0099] A number of techniques are known in the art to create multimers or oligomers of peptides.
- peptides can be linked by linkers as described herein or via polyethylene glycol. See Zhang et al., Bioconjug Chem.
- Peptides may be attached in tandem or branched fashion, with or without linkers, to antibody Fc domains. See Int'l Publication No. WO 00/24782, published May 4, 2000, incorporated by reference herein in its entirety. Peptides and other proteins may be displayed on a macromolecular scaffold derived from a multienzyme complex. See Domingo et al., J MoI Biol. 305(2):259-67, 2001 , incorporated by reference herein in its entirety.
- scaffolds suitable for displaying peptides see Hosse et al., Protein Science 15:14-27, 2006 (reviewing scaffolds such as the fibronectin type III domain, a lipocalin, a knottin, cytochrome b562, a kunitz-type protease inhibitor, the Z-domain, and the carbohydrate binding module CBM4-2), incorporated by reference herein in its entirety.
- bivalent oligomeric combinations are made by homodimerization of a polypeptide comprising a cyclic RAP peptide and an antibody Fc region. Tetravalent oligomeric combinations are made by replacing antibody variable regions in a tetrameric immunoglobulin (containing two heavy chains and two light chains) with a cyclic RAP peptide.
- bivalent, thvalent, tetravalent, or other oligomeric combinations are made by conjugation of cyclic RAP peptide to a PEG molecule.
- Other oligomeric combinations can be envisioned by those of ordinary skill in the art.
- a "RAP conjugate”, “ligand-polypeptide conjugate” "chimeric molecule comprising a RAP, RAP fragment or RAP variant conjugated to an active agent” each refers to a compound comprising a RAP, RAP fragment or RAP variant attached to an active agent.
- conjugated means that the therapeutic agent(s) and RAP, RAP fragment or RAP variant polypeptide are physically linked by, for example, by covalent chemical bonds, physical forces such van der Waals or hydrophobic interactions, encapsulation, embedding, or combinations thereof.
- the therapeutic agent(s) and the RAP, RAP fragment or RAP variant polypeptide are physically linked by covalent chemical bonds.
- preferred chemotherapeutic agents contain a functional group such as an alcohol, acid, carbonyl, thiol or amine group to be used in the conjugation to RAP, RAP fragment or RAP variant or fragment thereof.
- Adriamycin is in the amine class and there is also the possibility to link through the carbonyl as well.
- Paclitaxel is in the alcohol class.
- Chemotherapeutic agents without suitable conjugation groups may be further modified to add such a group. All these compounds are contemplated in this invention. In the case of multiple therapeutic agents, a combination of various conjugations can be used.
- a covalent chemical bond that may be either direct (no intervening atoms) or indirect (through a linker e.g., a chain of covalently linked atoms) joins the RAP, RAP fragment or RAP variant and the active agent.
- a linker e.g., a chain of covalently linked atoms
- the RAP, RAP fragment or RAP variant and the active agent moiety of the conjugate are directly linked by covalent bonds between an atom of the RAP, RAP fragment or RAP variant and an atom of the active agent.
- the receptor binding moiety is connected to the active agent moiety of the compound according to the invention by a linker that comprises a covalent bond or a peptide of virtually any amino acid sequence or any molecule or atoms capable of connecting the RAP, RAP fragment or RAP variant to the active agent.
- the linker comprises a chain of atoms from 1 to about 60, or 1 to 30 atoms or longer, 2 to 5 atoms, 2 to 10 atoms, 5 to 10 atoms, or 10 to 20 atoms long
- the chain atoms are all carbon atoms.
- the chain atoms are selected from the group consisting of C, O, N, and S. Chain atoms and linkers may be selected according to their expected solubility (hydrophilicity) so as to provide a more soluble conjugate.
- the linker provides a functional group that is subject to enzymatic attack in a lysosome.
- the linker provides a functional group which is subject to attack by an enzyme found in the target tissue or organ and which upon attack or hydrolysis severs the link between the active agent and the RAP, RAP fragment or RAP variant.
- the linker provides a functional group that is subject to hydrolysis under the conditions found at the target site (e.g., low pH of a lysosome).
- a linker may contain one or more such functional groups.
- the length of the linker is long enough to reduce the potential for steric hindrance (when an active agent is large) between one or both of the RAP, RAP fragment or RAP variant binding site and the active agent active binding site.
- the entire conjugate can be a fusion protein.
- peptidyl linkers may be any length. Exemplary linkers are from about 1 to 50 amino acids in length, 5 to 50, or 10 to 30 amino acids in length.
- fusion proteins may be produced by recombinant genetic engineering methods known to one of ordinary skill in the art.
- the RAP, RAP fragment or RAP variant portion of the conjugate is formulated to rapidly degrade to release the active compound.
- the linker is subject to cleavage under intracellular, or more preferably, lysosomal environmental conditions to release or separate the active agent portion from the RAP, RAP fragment or RAP variant polypeptide portion.
- the conjugate can comprise one or more active agents linked to the same RAP, RAP fragment or RAP variant.
- conjugation reactions may conjugate from 1 to 5, about 5, about 1 to 10, about 5 to 10, about 10 to 20, about 20 to 30, or 30 or more molecules of an active agent to the RAP, RAP fragment or RAP variant polypeptide.
- These formulations can be employed as mixtures, or they may be purified into specific stoichiometric formulations.
- more than one type of active agent may be linked to the RAP, RAP fragment or RAP variant polypeptide where delivery of more than one type of an agent to a target site or compartment is desired.
- a plurality of active agent species may be attached to the same RAP, RAP fragment or RAP variant polypeptide e.g., adriamycin- cisplatinum RAP, (or other RAP variant) conjugates.
- the conjugates may consist of a range of stoichiometric ratios and incorporate more than one type of active agent. These, too, may be separated into purified mixtures or they may be employed in aggregate.
- RAP, RAP fragment or RAP variant or fragments thereof, conjugated a described herein and using methods known in the art may be modified as desired to enhance its stability or pharmacokinetic properties (e.g., PEGylation).
- Suitable linkers and their functional groups for conjugating RAP variant polypeptides and an active agent, and the synthetic chemical methods readily adaptable for preparing such, are described in U.S. Patent Publication No. 2003253890, herein incorporated by reference in its entirety.
- Active agents according to the invention include agents that can affect a biological process.
- Particularly preferred active agents for use in the compounds compositions and methods of the invention are therapeutic agents, including drugs and diagnostic agents.
- the term "drug” or “therapeutic agent” refers to an active agent that has a pharmacological activity or benefits health when administered in a therapeutically effective amount.
- Particularly preferred agents are naturally occurring biological agents (e.g., enzymes, proteins, polynucleotides, antibodies, polypeptides, nanoparticles, glyconjugates).
- the active agent conjugated to a RAP, RAP fragment or RAP variant is a molecule, as well as any binding portion or fragment thereof, that is capable of modulating a biological process in a living host.
- Examples of drugs or therapeutic agents include substances that are used in the prevention, diagnosis, alleviation, treatment or cure of a disease or condition. It is particularly contemplated that the agent is not an agent that causes a disease.
- the active agent can be a non-protein or a protein.
- the active agent can be a protein or enzyme or any fragment of such that still retains some, substantially all, or all of the therapeutic or biological activity of the protein or enzyme.
- the protein or enzyme is one that, if not expressed or produced or if substantially reduced in expression or production, would give rise to a disease.
- the protein or enzyme is derived or obtained from a human or mouse.
- the active agent conjugated to RAP, RAP fragment or RAP variant polypeptide is a protein or enzyme, or fragment thereof possessing a biological activity of the protein or enzyme
- the active agent has an amino acid sequence identical to the amino acid sequence to the corresponding portion of the human or mammalian protein or enzyme.
- the active agent moiety of the conjugate is a protein or enzyme native to the species of the human or mammal.
- the protein or enzyme, or fragment thereof is substantially homologous (i.e., at least 80%, 85%, 90%, 95%, more preferably 98%, or most preferably 99% identical in amino acid sequence over a length of at least 10, 25, 50, 100, 150, or 200 amino acids, or the entire length of the active agent) to a native sequence of the corresponding human or mammal protein or enzyme.
- the RAP, RAP fragment or RAP variant -active agent conjugate can comprise one or more active agent moieties (e.g., 1 to 10 or 1 to 4 or 2 to 3 moieties) linked to the RAP, RAP fragment or RAP variant or LRP1 -binding fragment thereof.
- active agent moieties e.g., 1 to 10 or 1 to 4 or 2 to 3 moieties
- conjugation reactions may conjugate from 1 to 4 or more molecules to a single RAP, RAP fragment or RAP variant.
- These formulations can be employed as mixtures, or they may be purified into specific RAP, RAP fragment or RAP variant polypeptide-agent stoichiometric formulations. Those skilled in the art are able to determine which format and which stoichiometric ratio is preferred.
- RAP, RAP fragment or RAP variant conjugated agents may consist of a range of stoichiometric ratios. These, too, may be separated into purified mixtures or they may be employed in aggregate. It may be the order of RAP, RAP fragment or RAP variant and the active agent in the fusion is important for the ability of the LRP1 binding moiety to bind to LRP1. Therefore, in preferred embodiments, the RAP, RAP fragment or RAP variant is located N-terminally to the protein active agent coding sequence.
- the drug active agent may be of any size.
- Preferred drugs are small organic molecules that are capable of binding to the target of interest.
- a drug moiety of the conjugate when a small molecule, generally has a molecular weight of at least about 50 D, usually at least about 100 D, where the molecular weight may be as high as 500 D or higher, but will usually not exceed about 2000 D.
- the drug moiety is capable of interacting with a target in the host into which the conjugate is administered during practice of the subject methods.
- the active agent or drug has a hydroxyl or an amino group for reacting with the isocyanate reagent or the active agent is chemically modified to introduce a hydroxyl or an amino group for reacting with the isocyanate reagent.
- the active agent or drug comprises a region that may be modified and/or participate in covalent linkage, preferably, without loss of the desired biological activity of the active agent.
- the drug moieties often comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups.
- Also of interest as drug moieties are structures found among biomolecules, proteins, enzymes, polysaccharides, and polynucleic acids, including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof.
- Suitable active agents include, but are not limited to, psychopharmacological agents, such as (1 ) central nervous system depressants, e.g., general anesthetics (barbiturates, benzodiazepines, steroids, cyclohexanone derivatives, and miscellaneous agents), sedative- hypnotics (benzodiazepines, barbiturates, piperidinediones and triones, quinazoline derivatives, carbamates, aldehydes and derivatives, amides, acyclic ureides, benzazepines and related drugs, phenothiazines, etc.), central voluntary muscle tone modifying drugs (anticonvulsants, such as hydantoins, barbiturates, oxazolidinediones, succinimides, acylureides, glutarimides, benzodiazepines, secondary and tertiary alcohols, dibenzazepine derivatives, valproic acid and derivatives, G
- Preferred chemotherapeutic agents are those, which in the free form, demonstrate unacceptable systemic toxicity at desired doses.
- the general systemic toxicity associated with therapeutic levels of such agents may be reduced by their linkage to the RAP, RAP fragment or RAP variant polypeptide.
- Particularly preferred are cardiotoxic compounds that are useful therapeutics but are dose limited by cardiotoxicity.
- a classic example is adriamycin (also known as doxorubicin) and its analogs, such as daunorubicin.
- Linking RAP, RAP fragment or a RAP variant polypeptide to such drugs may prevent accumulation of the active agent at the heart and associated cardiotoxicity.
- Suitable active agents include, but are not limited to: Antibiotics, such as: aminoglycosides, e.g., amikacin, apramycin, arbekacin, bambermycins, butirosin, dibekacin, dihydrostreptomycin, fortimicin, gentamicin, isepamicin, kanamycin, micronomcin, neomycin, netilmicin, paromycin, ribostamycin, sisomicin, spectinomycin, streptomycin, tobramycin, trospectomycin; amphenicols, e.g., azidamfenicol, chloramphenicol, florfenicol, and theimaphenicol; ansamycins, e.g., rifamide, rifampin, rifamycin, rifapentine, rifaximin; beta.
- Antibiotics such as: aminoglycosides, e.g., am
- -lactams e.g., carbacephems, carbapenems, cephalosporins, cehpamycins, monobactams, oxaphems, penicillins; lincosamides, e.g., clinamycin, lincomycin; macrolides, e.g., clarithromycin, dirthromycin, erythromycin, etc.; polypeptides, e.g., amphomycin, bacitracin, capreomycin, etc.; tetracyclines, e.g., apicycline, chlortetracycline, clomocycline, etc.; synthetic antibacterial agents, such as 2,4-diaminopyhmidines, nitrofurans, quinolones and analogs thereof, sulfonamides, sulfones;
- Suitable active agents include, but are not limited to: Antifungal agents, such as: polyenes, e.g., amphotericin B, candicidin, dermostatin, filipin, fungichromin, hachimycin, hamycin, lucensomycin, mepartricin, natamycin, nystatin, pecilocin, perimycin; synthetic antifungals, such as allylamines, e.g., butenafine, naftifine, terbinafine; imidazoles, e.g., bifonazole, butoconazole, chlordantoin, chlormidazole, etc., thiocarbamates, e.g., tolciclate, triazoles, e.g., fluconazole, itraconazole, terconazole;
- Antifungal agents such as: polyenes, e.g., amphotericin B, candicidin, dermostatin,
- Suitable active agents include, but are not limited to: Antihelmintics, such as: arecoline, aspidin, aspidinol, dichlorophene, embelin, kosin, napthalene, niclosamide, pelletiehne, quinacrine, alantolactone, amocarzine, amoscanate, ascaridole, bephenium, bitoscanate, carbon tetrachloride, carvacrol, cyclobendazole, diethylcarbamazine, etc.;
- Antihelmintics such as: arecoline, aspidin, aspidinol, dichlorophene, embelin, kosin, napthalene, niclosamide, pelletiehne, quinacrine, alantolactone, amocarzine, amoscanate, ascaridole, bephenium, bitoscanate, carbon tetrachloride, carvacrol, cyclobendazole, diethylcarbamaz
- Suitable active agents include, but are not limited to: Antimalarials, such as: acedapsone, amodiaquin, arteether, artemether, artemisinin, artesunate, atovaquone, bebeerine, berberine, chirata, chlorguanide, chloroquine, chlorprogaunil, cinchona, cinchonidine, cinchonine, cycloguanil, gentiopicrin, halofantrine, hydroxychloroquine, mefloquine hydrochloride, 3- methylarsacetin, pamaquine, plasmocid, primaquine, pyrimethamine, quinacrine, quinidine, quinine, quinocide, quinoline, dibasic sodium arsenate;
- Antimalarials such as: acedapsone, amodiaquin, arteether, artemether, artemisinin, artesunate, atovaquone, be
- Suitable active agents include, but are not limited to: Antiprotozoan agents, such as: acranil, tinidazole, ipronidazole, ethylstibamine, pentamidine, acetarsone, aminitrozole, anisomycin, nifuratel, tinidazole, benzidazole, suramin, and the like.
- Antiprotozoan agents such as: acranil, tinidazole, ipronidazole, ethylstibamine, pentamidine, acetarsone, aminitrozole, anisomycin, nifuratel, tinidazole, benzidazole, suramin, and the like.
- Suitable drugs for use as active agents are also listed in: Goodman and Gilman's, The Pharmacological Basis of Therapeutics (9th Ed) (Goodman et al. eds) (McGraw-Hill) (1996); and 1999 Physician's Desk Reference (1998).
- Suitable active agents include, but are not limited to: antineoplastic agents, as disclosed in U.S. Pat. Nos. 5,880,161 , 5,877,206, 5,786,344, 5,760,041 , 5,753,668, 5,698,529, 5,684,004, 5,665,715, 5,654,484, 5,624,924, 5,618,813, 5,610,292, 5,597,831 , 5,530,026,
- cardiovascular agents as disclosed in U.S. Pat. Nos. 4,966,967, 5,661 ,129, 5,552,411 , 5,332,737, 5,389,675, 5,198,449, 5,079,247, 4,966,967, 4,874,760, 4,954,526, 5,051 ,423, 4,888,335, 4,853,391 ,
- antimicrobial agents as disclosed in U.S. Pat. Nos. 5,902,594, 5,874,476, 5,874,436, 5,859,027, 5,856,320, 5,854,242, 5,81 1 ,091 , 5,786,350, 5,783,177, 5,773,469, 5,762,919, 5,753,715, 5,741 ,526, 5,709,870, 5,707,990, 5,696,117, 5,684,042, 5,683,709, 5,656,591 , 5,643,971 , 5,643,950, 5,610,196, 5,608,056, 5,604,262, 5,595,742, 5,576,341 , 5,554,373, 5,541 ,233, 5,534,546, 5,534,508, 5,514,715, 5,508,417, 5,464,832, 5,428,073, 5,428,016, 5,424,396, 5,399,553, 5,391 ,544, 5,385,902, 5,359,066, 5,356,803, 5,354,
- anti-inflammatory agents as disclosed in U.S. Pat. Nos. 5,872,109, 5,837,735, 5,827,837, 5,821 ,250, 5,814,648, 5,780,026, 5,776,946, 5,760,002, 5,750,543, 5,741 ,798, 5,739,279, 5,733,939, 5,723,481 , 5,716,967, 5,688,949, 5,686,488, 5,686,471 , 5,686,434, 5,684,204, 5,684,041 , 5,684,031 , 5,684,002, 5,677,318, 5,674,891 , 5,672,620, 5,665,752, 5,656,661 , 5,635,516, 5,631 ,283, 5,622,948, 5,618,835, 5,607,959, 5,593,980, 5,593,960, 5,580,888, 5,552,424, 5,552,422, 5,516,764, 5,510,361 , 5,508,026, 5,500
- immunosuppressive agents as disclosed in U.S. Pat. Nos. 4,450,159, 4,450,159, 5,905,085, 5,883,1 19, 5,880,280, 5,877,184, 5,874,594, 5,843,452, 5,817,672, 5,817,661 , 5,817,660, 5,801 ,193, 5,776,974, 5,763,478, 5,739,169, 5,723,466, 5,719,176, 5,696,156, 5,695,753, 5,693,648, 5,693,645, 5,691 ,346, 5,686,469, 5,686,424, 5,679,705, 5,679,640, 5,670,504, 5,665,774, 5,665,772, 5,648,376, 5,639,455, 5,633,277, 5,624,930, 5,622,970, 5,605,903, 5,604,229, 5,574,041 , 5,565,560, 5,550,233, 5,545,734, 5,540,931 , 5,53
- immunomodulatory agents as disclosed in U.S. Pat. Nos. 4,446,128, 4,524,147, 4,720,484, 4,722,899, 4,748,018, 4,877,619, 4,998,931 , 5,049,387, 5,1 18,509, 5,152,980, 5,256,416, 5,468,729, 5,583,139, 5,604,234, 5,612,060, 5,612,350, 5,658,564, 5,672,605, 5,681 ,571 , 5,708,002, 5,723,718, 5,736,143, 5,744,495, 5,753,687, 5,770,201 , 5,869,057, 5,891 ,653, 5,939,455, 5,948,407, 6,006,752, 6,024,957, 6,030,624, 6,037,372, 6,037,373, 6,043,247, 6,060,049, 6,087,096, 6,096,315, 6,099,838, 6,103,235, 6,124
- cholinergic agents as disclosed in U.S. Pat. Nos. 5,219,872, 5,219,873, 5,073,560, 5,073,560, 5,346,911 , 5,424,301 , 5,073,560, 5,219,872, 4,900,748, 4,786,648, 4,798,841 , 4,782,071 , 4,710,508, 5,482,938, 5,464,842, 5,378,723, 5,346,911 , 5,318,978, 5,219,873, 5,219,872, 5,084,281 , 5,073,560, 5,002,955, 4,988,710, 4,900,748, 4,798,841 , 4,786,648, 4,782,071 , 4,745,123, 4,710,508;
- adrenergic agents as disclosed in U.S. Pat. Nos. 5,091 ,528, 5,091 ,528, 4,835,157, 5,708,015, 5,594,027, 5,580,892, 5,576,332, 5,510,376, 5,482,961 , 5,334,601 , 5,202,347, 5,135,926, 5,1 16,867, 5,091 ,528, 5,017,618, 4,835,157, 4,829,086, 4,579,867, 4,568,679, 4,469,690, 4,395,559, 4,381 ,309, 4,363,808, 4,343,800, 4,329,289,
- steroidal agents as disclosed in U.S. Pat. Nos. 5,863,538, 5,855,907, 5,855,866, 5,780,592, 5,776,427, 5,651 ,987, 5,346,887, 5,256,408, 5,252,319, 5,209,926, 4,996,335, 4,927,807, 4,910,192, 4,710,495, 4,049,805, 4,004,005, 3,670,079, 3,608,076, 5,892,028, 5,888,995, 5,883,087, 5,880,115, 5,869,475, 5,866,558, 5,861 ,390, 5,861 ,388, 5,854,235, 5,837,698, 5,834,452, 5,830,886, 5,792,758, 5,792,757, 5,763,361 , 5,744,462, 5,741 ,787, 5,741 ,786, 5,733,899, 5,731 ,345, 5,723,638, 5,7
- the drug moiety of the conjugate may be the whole drug or a binding fragment or portion thereof that retains its affinity and specificity for the target of interest while having a linkage site for covalent bonding to the vector protein ligand or linker.
- the conjugates of such drugs may be used for the same disorders, diseases, and indications as the drugs themselves.
- Preferred cancer chemotherapeutic agents for use in the RAP, RAP fragment or RAP variant based conjugates useful in the methods of the invention include all drugs which may be useful for treating liver tumors or other neoplasia in or around the liver, either in the free form, or, if not so useful for such tumors in the free form, useful when linked to the RAP, RAP fragment or RAP variant or LRP1 -binding fragment thereof.
- Such chemotherapeutic agents are preferably cytotoxic chemotherapeutic agents including but not limited to adhamycin (also known as doxorubicin), cisplatin, paclitaxel, analogs thereof, and other chemotherapeutic agents demonstrate activity against tumors ex vivo and in vivo.
- chemotherapeutic agents also include alkylating agents, antimetabolites, natural products (such as vinca alkaloids, epidophyllotoxins, antibiotics, enzymes and biological response modifiers), topoisomerase inhibitors, microtubule inhibitors, spindle poisons, hormones and antagonists, and miscellaneous agents such as platinum coordination complexes, anthracendiones, substituted ureas, etc.
- alkylating agents such as vinca alkaloids
- Cytotoxic chemotherapeutic agents useful in treating cancers or neoplasias including, but not limited to, radioisotopes such as 131 I (Iodine), 125 I, 111 In (indium), 90 Y (Yttrium), 67 Cu (Copper), 127 Lu (Lutetium), 212 Bi (Bismuth), 213 Bi, 255 Fm (Fermium), 149 Tb (Terbium), 223 Rd (Radium), 213 Pb (lead), 212 Pb, 211 At (Astatine), 89 Sr (Strontium), 153 Sm (Samarium), 166 Ho (Holmium), 225 Ac (Actinium), 186 Re (Rhenium), 67 Ga (Gallium), 68 Ga and 99m Tc (Technetium), may be conjugated a RAP, RAP fragment or RAP variant useful in the invention.
- radioisotopes such as 131 I (Iodine), 125
- the radioisotopes may be linked to the polypeptide using metal chelating agents common in the art for such purposes, including, but not limited to 1 ,4,7,10-tetraazacyclo-11 dodecane-N,N ,N ,N -tetraacetic acid (DOTA), 1 ,4,8,11 -tetraazacyclotetradecane N,N',N",N"'-tetraacetic acid (TETA), diethylene thamine penta-acetate (DTPA), dimercaptosuccinic acid (DMSA), tetraazacyclothdecane-N, N', N",N"'-tetraacetic acid (TRITA), and 1 ,5,9,13-tetraazacyclohexadecane-N,N',N",N'”-tetraacetic acid (HETA), hydroxyethylidene diphosphonate (HEDP), HEXA, and ethylenediaminetetraacetic acid (
- Preferred chemotherapeutic agents are those, which in the free form, demonstrate unacceptable systemic toxicity at desired doses.
- the general systemic toxicity associated with therapeutic levels of such agents is reduced by their linkage to a RAP, RAP fragment or RAP variant.
- Particularly preferred are cardiotoxic compounds that are useful therapeutics but are dose limited by cardiotoxicity.
- a classic example is adriamycin (also known as doxorubicin) and its analogs, such as daunorubicin. Linking a RAP, RAP fragment or RAP variant to such drugs decreases accumulation and associated cardiotoxicity at the heart.
- Nanoparticles are macromolecular assemblies constructed from biodegradable and non-biodegradable polymers or from other materials such as lipids. Such assemblies may be engineered to contain therapeutic molecules in cavities within the particle. Through this means, nanoparticles provide a means of altering the biodisthbution, pharmacokinetics, immunogenicity and potency of drugs. Attachment of suitable RAP, RAP fragment or RAP variants would, in turn, provide a means of increasing the specificity of tissue distribution of these molecules.
- Host cells used to produce chimeric proteins are bacterial, yeast, insect, non-mammalian vertebrate, or mammalian cells; the mammalian cells include, but are not limited to, hamster, monkey, chimpanzee, dog, cat, bovine, porcine, mouse, rat, rabbit, sheep and human cells.
- the host cells can be immortalized cells (a cell line) or non-immortalized (primary or secondary) cells and can be any of a wide variety of cell types, such as, but not limited to, fibroblasts, keratinocytes, epithelial cells (e.g., mammary epithelial cells, intestinal epithelial cells), ovary cells (e.g., Chinese hamster ovary or CHO cells), endothelial cells, glial cells, neural cells, formed elements of the blood (e.g., lymphocytes, bone marrow cells), muscle cells, hepatocytes and precursors of these somatic cell types.
- Host cells can include mutants of CHO cells that do not express LRP such as CHO13-5-1 (FitzGerald et al., J. Biol. Chem., 129(6):1533-41 , 1995).
- Cells that contain and express DNA or RNA encoding the chimeric protein are referred to herein as genetically modified cells.
- Mammalian cells that contain and express DNA or RNA encoding the chimeric protein are referred to as genetically modified mammalian cells.
- Introduction of the DNA or RNA into cells is by a known transfection method, such as electroporation, microinjection, microprojectile bombardment, calcium phosphate precipitation, modified calcium phosphate precipitation, cationic lipid treatment, photoporation, fusion methodologies, receptor mediated transfer, or polybrene precipitation.
- the DNA or RNA can be introduced by infection with a viral vector.
- a nucleic acid construct used to express the chimeric protein can be one which is expressed extrachromosomally (episomally) in the transfected mammalian cell or one which integrates, either randomly or at a pre-selected targeted site through homologous recombination, into the recipient cell's genome.
- a construct which is expressed extrachromosomally comprises, in addition to chimeric protein-encoding sequences, sequences sufficient for expression of the protein in the cells and, optionally, for replication of the construct. It typically includes a promoter, chimeric protein- encoding DNA and a polyadenylation site. The DNA encoding the chimeric protein is positioned in the construct in such a manner that its expression is under the control of the promoter.
- the construct may contain additional components such as one or more of the following: a splice site, an enhancer sequence, a selectable marker gene under the control of an appropriate promoter, and an amplifiable marker gene under the control of an appropriate promoter.
- the DNA construct integrates into the cell's genome, it need include only the chimeric protein-encoding nucleic acid sequences.
- it can include a promoter and an enhancer sequence, a polyadenylation site or sites, a splice site or sites, nucleic acid sequences which encode a selectable marker or markers, nucleic acid sequences which encode an amplifiable marker and/or DNA homologous to genomic DNA in the recipient cell to target integration of the DNA to a selected site in the genome (targeting DNA or DNA sequences).
- Mammalian cells containing the chimeric protein-encoding DNA or RNA are cultured under conditions appropriate for growth of the cells and expression of the DNA or RNA.
- Those cells which express the chimeric protein can be identified, using known methods and methods described herein, and the chimeric protein isolated and purified, using known methods and methods also described herein; either with or without amplification of chimeric protein production. Identification can be carried out, for example, through screening genetically modified mammalian cells displaying a phenotype indicative of the presence of DNA or RNA encoding the chimeric protein, such as PCR screening, screening by Southern blot analysis, or screening for the expression of the chimeric protein.
- Selection of cells having incorporated chimeric protein-encoding DNA may be accomplished by including a selectable marker in the DNA construct and culturing transfected or infected cells containing a selectable marker gene under conditions appropriate for survival of only those cells that express the selectable marker gene. Further amplification of the introduced DNA construct can be affected by culturing genetically modified mammalian cells under conditions appropriate for amplification (e.g., culturing genetically modified mammalian cells containing an amplifiable marker gene in the presence of a concentration of a drug at which only cells containing multiple copies of the amplifiable marker gene can survive).
- Mammalian cells expressing the chimeric protein can be identified, as described herein, by detection of the expression product.
- mammalian cells expressing chimeric protein in which the carrier is a RAP, RAP fragment or RAP variant can be identified by a sandwich enzyme immunoassay.
- the antibodies can be directed toward the LRP1 -binding portion or the active agent portion of the conjugate.
- RAP fragment or RAP variant polypeptides for use according to the invention include those disclosed in U.S. Patent No. 5,474,766 and International Patent Application No. PCT/US2006/36453 that is incorporated herein by reference in its entirety for the purposes of disclosing such peptides and their production for use in the compounds and compositions of the present invention.
- RAP fragment and RAP variant polypeptides are produced using any of protein preparation and purification methods known to those of skill in the art.
- the ligand is purified from a naturally occurring source of the protein, can be isolated from a recombinant host expressing the ligand, or synthesized using well known techniques in protein synthesis. A skilled artisan readily adapts a variety of such techniques in order to obtain a RAP fragment or RAP variant that contain the receptor-binding site.
- RAP variants and fragments are generated from isolated native protein which are converted by enzymatic and/or chemical cleavage to generate fragments of the whole protein.
- U.S. Patent No. 6,447,775 is herein incorporated by reference with particular reference to such methods for obtaining RAP variant polypeptides.
- the RAP fragment or RAP variant are expressed in a recombinant bacteria (Williams et al., J. Biol. Chem.
- Cell pellets are lysed in PBS with 1 % Triton X-100, 1 ⁇ M pepstatin, 2.5 ⁇ g/ml leupeptin, 0.2 mM phenylmethylsulfonyl fluoride (PMSF), and 1 ⁇ M ethylenediaminetetraacetate (EDTA).
- the lysate is sonicated with a Branson Model 450 Sonifier and the resulting membranes and other cellular debris are separated by centrifugation at 15,000 g for 15 minutes.
- the recovered supernatant is incubated overnight with agarose immobilized glutathione beads (Sigma Chemical Co.) in PBS and 0.1 % sodium azide.
- the beads are washed, and the fusion protein eluted by competition with 5 mM reduced glutathione (Sigma Chemical Co.). Following dialysis, the fusion protein is cleaved by an overnight incubation with 100 ng of activated human thrombin per 50 ⁇ g of fusion protein. The glutathione-S- transferase epitope is subsequently be removed by further incubation with agarose immobilized glutathione beads.
- RAP fragments or RAP variants also may be produced using similar techniques.
- a review of such ligands may be found in Christensen and Birn, (Am. J. Physiol. Renal Physiol., 280:F562- F573, 2001 , see particularly Table 2 and references cited therein) Techniques for making and purifying such ligands are well known to those of skill in the art.
- the RAP, RAP fragment and RAP variant- based active agent conjugate is labeled to facilitate its detection.
- a "label” or a “detectable moiety” is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means.
- labels suitable for use in the present invention include, for example, radioactive labels (e.g., 32 P), fluorophores (e.g., fluorescein), electron dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins which can be made detectable, e.g., by incorporating a radiolabel into the hapten or peptide, or used to detect antibodies specifically reactive with the hapten or peptide.
- radioactive labels e.g., 32 P
- fluorophores e.g., fluorescein
- electron dense reagents e.g., enzymes (e.g., as commonly used in an ELISA)
- enzymes e.g., as commonly used in an ELISA
- biotin e.g., digoxigenin
- haptens and proteins which can be made detectable, e.g., by incorporating a radiolabel into the hap
- the active agent, the linker or the RAP, RAP fragment or RAP variant polypeptide portion of a conjugate may be labeled.
- the particular label or detectable group used is not a critical aspect of the invention, as long as it does not significantly interfere with the biological activity of the conjugate.
- the detectable group can be any material having a detectable physical or chemical property.
- a label is any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
- labels suitable for use in the present invention include, but are not limited to, fluorescent dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, and the like), radiolabels (e.g., 3 H, 125 I, 35 S, 14 C, or 32 P), enzymes (e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic beads (e.g., polystyrene, polypropylene, latex, etc.).
- fluorescent dyes e.g., fluorescein isothiocyanate, Texas red, rhodamine, and the like
- radiolabels e.g., 3 H, 125 I, 35 S, 14 C, or 32 P
- enzymes e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA
- the label may be coupled directly or indirectly to the desired component of the assay according to methods well known in the art.
- the label in one embodiment is covalently bound to the biopolymer using an isocyanate reagent for conjugating an active agent according to the invention.
- the bifunctional isocyanate reagents of the invention can be used to conjugate a label to a biopolymer to form a label biopolymer conjugate without an active agent attached thereto.
- the label biopolymer conjugate may be used as an intermediate for the synthesis of a labeled conjugate according to the invention or may be used to detect the biopolymer conjugate.
- Non-radioactive labels are often attached by indirect means.
- a ligand molecule e.g., biotin
- the ligand binds to another molecules (e.g., streptavidin) molecule, which is either inherently detectable or covalently bound to a signal system, such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound.
- the conjugates can also be conjugated directly to signal generating compounds, e.g., by conjugation with an enzyme or fluorophore.
- Enzymes suitable for use as labels include, but are not limited to, hydrolases, particularly phosphatases, esterases and glycosidases, or oxidotases, particularly peroxidases.
- Fluorescent compounds, i.e., fluorophores, suitable for use as labels include, but are not limited to, fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, etc.
- fluorophores include, but are not limited to, eosin, TRITC-amine, quinine, fluorescein W, achdine yellow, lissamine rhodamine, B sulfonyl chloride erythroscein, ruthenium (tris, bipyridinium), Texas Red, nicotinamide adenine dinucleotide, flavin adenine dinucleotide, etc.
- Chemiluminescent compounds suitable for use as labels include, but are not limited to, luciferin and 2,3-dihydrophthalazinediones, e.g., luminol.
- Means of detecting labels are well known to those of skill in the art.
- means for detection include a scintillation counter or photographic film as in autoradiography.
- the label is a fluorescent label, it may be detected by exciting the fluorochrome with the appropriate wavelength of light and detecting the resulting fluorescence. The fluorescence may be detected visually, by the use of electronic detectors such as charge coupled devices (CCDs) or photomultipliers and the like.
- enzymatic labels may be detected by providing the appropriate substrates for the enzyme and detecting the resulting reaction product. Colorimetric or chemiluminescent labels may be detected simply by observing the color associated with the label.
- Other labeling and detection systems suitable for use in the methods of the present invention will be readily apparent to those of skill in the art.
- Such labeled modulators and ligands may be used in the diagnosis of a disease or health condition.
- the conjugates can be formulated into preparations for injection by dissolving, suspending or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other similar oils, synthetic aliphatic acid glycehdes, esters of higher aliphatic acids or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.
- the conjugates can be utilized in aerosol formulation to be administered via inhalation.
- the compounds of the present invention can be formulated into pressurized acceptable propellants such as dichlorodifluoromethane, propane, nitrogen and the like.
- Unit dosage forms for injection or intravenous administration may comprise the conjugate in a composition as a solution in sterile water, normal saline or another pharmaceutically acceptable carrier.
- the RAP, RAP fragment or RAP variant conjugate, described herein can be combined as the active ingredient in intimate admixture with a pharmaceutical carrier according to conventional pharmaceutical compounding techniques.
- the carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., oral or parenteral (including intravenous).
- transdermal routes of administration methods for transdermal administration of drugs are disclosed in Remington's Pharmaceutical Sciences, 17th Edition, (Gennaro et al. Eds. Mack Publishing Co., 1985).
- Dermal or skin patches are a preferred means for transdermal delivery of the conjugates useful in the methods of the invention. Patches preferably provide an absorption enhancer such as DMSO to increase the absorption of the compounds.
- Other methods for transdermal drug delivery are disclosed in U.S. Patents No. 5,962,012, 6,261 ,595, and 6,261 ,595. Each of which is incorporated by reference in its entirety.
- compositions such as vehicles, adjuvants, carriers or diluents, are commercially available.
- pharmaceutically acceptable auxiliary substances such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are commercially available.
- dose levels can vary as a function of the specific compound, the severity of the symptoms and the susceptibility of the subject to side effects.
- Preferred dosages for a given compound are readily determinable by those of skill in the art by a variety of means, including, but not limited to dose response and pharmacokinetic assessments conducted in patients, test animals, and in vitro.
- compositions include, but are not limited to, compositions suitable for oral, rectal, topical, parenteral (including subcutaneous, intramuscular, and intravenous), pulmonary (nasal or buccal inhalation), or nasal administration, although the most suitable route in any given case will depend in part on the nature and severity of the conditions being treated and on the nature of the active ingredient.
- routes of administration are the oral and intravenous routes.
- the compositions may be conveniently presented in unit dosage form and prepared by any of the methods well-known in the art of pharmacy.
- Compositions of the present invention may be administered encapsulated in or attached to viral envelopes or vesicles, or incorporated into cells.
- Vesicles are micellular particles which are usually spherical and which are frequently lipidic.
- Liposomes are vesicles formed from a bilayer membrane. Suitable vesicles include, but are not limited to, unilamellar vesicles and multilamellar lipid vesicles or liposomes. Such vesicles and liposomes may be made from a wide range of lipid or phospholipid compounds, such as phosphatidylcholine, phosphatidic acid, phosphatidylserine, phosphatidylethanolamine, sphingomyelin, glycolipids, gangliosides, etc. using standard techniques, such as those described in, e.g., U.S.
- Patent No. 4,394,448 Such vesicles or liposomes may be used to administer compounds intracellularly and to deliver compounds to the target organs. Controlled release of a p97-composition of interest may also be achieved using encapsulation (see, e.g., U.S. Patent No. 5,186,941 ).
- compositions are administered peripherally, most preferably intravenously or by cardiac catheter. Intrajugular and intracarotid injections are also useful. Compositions may be administered locally or regionally, such as intraperitoneally or subcutaneously on intramuscularly. In one aspect, compositions are administered with a suitable pharmaceutical diluent or carrier.
- Dosages to be administered will depend on individual needs, on the desired effect, the active agent used, the biopolymer and on the chosen route of administration.
- Preferred dosages of a conjugate range from about 0.2 pmol/kg to about 25 nmol/kg, and particularly preferred dosages range from 2-250 pmol/kg; alternatively, preferred doses of the conjugate may be in the range of 0.02 to 2000 mg/kg.
- These dosages will be influenced by the number of active agent or drug moieties associated with the biopolymer. Alternatively, dosages may be calculated based on the active agent administered.
- the conjugate comprises a RAP variant.
- doses of RAP, RAP fragment or RAP variant-adhamycin comprising from 0.005 to 100 mg/kg of adriamycin are also useful in vivo.
- Particularly preferred is a dosage of RAP, RAP fragment or RAP variant- adhamycin comprising from 0.05 mg/kg to 20 mg/kg of adriamycin.
- Those skilled in the art can determine suitable doses for compounds linked to a RAP variant based in part on the recommended dosage used for the free form of the compound. Conjugation of the active agent to a RAP variant generally reduces the amount of drug needed to obtain the same effect.
- RAP, RAP fragment or RAP variant compounds may show preferential accumulation in particular tissues.
- Preferred medical indications for diagnostic uses include, for example, any condition associated with a target organ of interest (e.g., lung, liver, kidney, spleen).
- the subject methods find use in the treatment of a variety of different disease conditions.
- of particular interest is the use of the subject methods in disease conditions where an active agent or drug having desired activity has been previously identified, but in which the active agent or drug is not adequately delivered to the target site, area or compartment to produce a fully satisfactory therapeutic result.
- the subject methods of conjugating the active agent to a RAP, RAP fragment or RAP variant can be used to enhance the therapeutic efficacy and therapeutic index of active agent or drug.
- disease conditions treatable by with the subject conjugates are as varied as the types of drug moieties that can be present in the conjugate.
- disease conditions which affect the liver and treatable by the methods of the invention include cellular proliferative diseases, such as neoplastic diseases, autoimmune diseases, hormonal abnormality diseases, degenerative diseases, diseases of aging, and the like.
- Treatment is meant to encompass any beneficial outcome to a subject associated with administration of a conjugate including a reduced likelihood of acquiring a disease, prevention of a disease, slowing, stopping or reversing, the progression of a disease or an amelioration of the symptoms associated with the disease condition afflicting the host, where amelioration or benefit is used in a broad sense to refer to at least a reduction in the magnitude of a parameter, e.g., symptom, associated with the pathological condition being treated, such as inflammation and pain associated therewith.
- a parameter e.g., symptom
- treatment also includes situations where the pathological condition, or at least symptoms associated therewith, are completely inhibited, e.g., prevented from happening, or stopped, e.g., terminated, such that the host no longer suffers from the pathological condition, or at least the symptoms that characterize the pathological condition.
- liver The majority of the liver is perfused primarily by the portal vein. Reliance of tumor on arterial blood, coupled with the efficiency of first-pass capture, should allow sparing of a significant portion of non-cancerous liver tissue after intravenous administration of RAP-conjugated chemotherapeutics.
- LRP1 LRP1-binding protein
- hepatocytes following neoplastic transformation
- others have shown that LRP1 is significantly underexpressed in noncancerous, but cirrhotic, liver tissue (24).
- Enhanced LRP1 expression on tumor cells, with diminished expression elsewhere in the diseased liver, should, like arterial delivery with first-pass capture, result in non-uniform delivery of RAP conjugates, with a preference for tumor tissue.
- Non-uniform delivery along with the generally enhanced sensitivity of rapidly proliferating tumor cells to chemotherapeutic agents, may circumvent the barrier to treatment presented by diminished liver reserve in the majority of HCC patients.
- Yttrium-90 90 Y
- 90 Y is a cancer chemotherapeutic with high antibiotic efficacy against a wide variety tumors.
- 90 Y decay produces a high- energy beta particle, making it a particularly good choice for large solid tumors like those common in HCC.
- Yttrium becomes the stable element zirconium upon decay.
- Delivery of 90 Y to hepatocellular tumors is currently achieved with the use of nuclide-containing insoluble glass beads (THERASPHERETM) administered by transarterial catheterization. This method is effective to treatment of large, well-defined tumors, but is less useful for cases involving multiple, small tumors or in cases involving metastasis.
- THERASPHERETM nuclide-containing insoluble glass beads
- Another approach would be to conjugate 90 Y or other chemotherapeutics to agents that target tumor cells selectively.
- An example of this approach can be found in the non- Hodgkin's lymphoma therapeutic ZEVALIN® (Ibritumomab tiuxetan), an anti- CD-22 monoclonal antibody with a metal chelator that is loaded with 90 Y prior to injection.
- RAP demonstrates a rapid diffusion to the liver after administration. Following intravenous bolus injection of 30 picomoles of protein, over 70% of exogenous RAP accumulates in the liver within 10 minutes (20). The circulating half-life of injected RAP is less than a minute. These pharmacokinetics are also observed at intravenous injections up to 2.5 mg/kg (60 nmol/kg) in rats (20). Similar pharmacokinetics have been reported for another high-affinity LRP1 ligand, protease-activated ⁇ -2-macroglobulin, a 725 kD tetramehc serum glycoprotein (21 ).
- RAP RAP-binding LDLR in these tissues.
- Intravenously-administered RAP has shown no measurable toxicity in rodent and feline species. Capture efficiency of RAP by the liver is enhanced by an initial, low-affinity binding step to abundant cell-surface heparin sulfate proteoglycan on hepatocytes, with subsequent high-affinity binding and endocytosis by LRP1 (1 ,22).
- RAP-, RAP fragment- or RAP variant-conjugated chemotherapeutics such as 90 Y
- RAP or RAP fragments or variants conjugated to 90 Y or other active agents provides an effective method of delivery of active agents to the liver.
- RAP conjugates While a number of factors favor selective liver tumor targeting by RAP conjugates, it is also suggested that such agents will be effective on metastasized HCC. Metastasized tumor cells tend to retain their characteristics upon migration to heterotopic sites, demonstrating undiminished expression of LRP1 in extrahepatic metastasized human HCC (25). This factor may render metastasized HCC similarly susceptible to intravenously-administered conjugates of RAP, RAP fragment and RAP variant and appropriate chemotherapeutics or other active agents.
- One aspect of the invention contemplates conjugation of chemotherapeutic drugs or other agents to RAP, RAP fragment or RAP fragments or variants to deliver therapeutic compounds to the liver for the treatment of liver disease.
- Administration of a RAP conjugate to treat liver disease would address several problems associated with treatment of liver diseases, such as clearance of the agent by the liver, or drug resistance mechanisms in the plasma membrane (MDR, P-glycoprotein).
- liver diseases contemplated by the invention include, but are not limited to, those disorders discussed below.
- Hepatocellular carcinoma, or hepatoma is the fifth most common cancer in the world and incidence rates have been climbing steadily. Tumorigenic hepatocytes retain high levels of LRP1 expression. Hepatocellular carcinoma does not respond well to chemotherapy because the tumor cells show high rates of drug resistance and because the chemotherapies used have serious toxicities, especially in the heart and kidney, due to systemic (intravenous) administration.
- Hepatitis is a generic term for inflammation of the liver. Hepatitis can be acute or chronic and includes acute or chronic liver failure, e.g., due to virus (e.g., hepatitis A, B, C, D or E or non-ABCDE, CMV, Epstein-Barr), fungal, rickettsial or parasitic infections, alcohol, chemical toxins, drugs (e.g.
- metabolic liver disease e.g., Wilson's disease, alphai - antitrypsin deficiency
- cancer e.g., Wilson's disease, alphai - antitrypsin deficiency
- cancer e.g., Wilson's disease, alphai - antitrypsin deficiency
- cirrhosis e.g. primary biliary cirrhosis
- biliary obstruction e.g., biliary obstruction.
- Infection of the liver by Hepatitis A, B and /or C virus can lead to slowly
- liver disorders or conditions contemplated that are treatable using compositions conjugated to RAP or RAP fragments or variants include hepatic steatis (U.S. patent 6,596,762), cholestasis (U.S. Pat. No. 6,069,167), liver cirrhosis, toxic liver damage, post-hepatectomy conditions, and biliary obstruction.
- Candidate drugs for conjugation to RAP or RAP fragments or variants for the treatment of liver disease include, but are not limited to: 5- fluorouracil, doxorubicin (adhamycin), mitomycin C, cisplatin, epirubicin, daunorubicin, etoposide, and other chemotherapeutic agents set out in Table 1 , adefovir, lamivudine, entecavir, ribavirin, interferon alpha, pegylated interferon alpha-2a, interferon alpha-2b and other antivirals, Vitamin E, ursodeoxycholic acid, and other agents used to treat liver disorders.
- BCNU vincristine carmustine
- CCNU vinorelbine lomustine
- Taxotere® docetaxel
- semustine methyl-CCNU
- TEM Ethylenimine/Methyl-melamine thriethylenemelamine
- Type I Topoisomerase Inhibitors oxaliplatin camptothecin Anthracenedione topotecan mitoxantrone irinotecan
- Adrenocorticosteroids/ antagonists ainoglutethimide prednisone and equiv-alents dexamethasone Cytokines ainoglutethimide interferon ( ⁇ , ⁇ , v) interleukin-2
- Antiandrogens gamma radiation flutamide visible light gonadotropin-releasing infrared radiation hormone analogs microwave radiation leuprolide
- Wild-type and LRP1 -deficient CHO-K1 cells were grown in BioWhittaker Ultra-CHO supplemented with 5% fetal bovine serum. Cells were seeded in 12-well plates 48 hours prior to the experiment. A biotinylated, internally-disulfide linked, truncated peptide corresponding to a portion of RAP d3 (mini-RAPc, Hep1 : biotin-
- GGSGGCGFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRS REKHALLEGRTKELGYTVKKHLQDLSGGC) (SEQ ID NO: 9) was combined with equimolar amounts of a conjugate between streptavidin and the bacterial toxin sapohn (ZAP, Advanced Targeting Systems, San Diego). The mixture was diluted into growth media to 100 nM and added to wells in duplicate. As controls, duplicate wells were incubated with RAP d3 peptide alone (mini- RAPc), the streptavidin-sapohn conjugate alone (ZAP), both at 100 nM concentrations, and with saporin alone at 1 ⁇ M (SAP). Cells were incubated for 48 hours at 37 0 C, 5% CO2 in a humidified chamber. Cell viability for each treatment condition was determined with an MTT assay kit (Invitrogen, San Diego).
- Figure 2 shows that peptide alone had no significant effect on cell survival.
- the streptavidin-saporin conjugate alone reduced viable cell number by approximately 10% for wild-type CHO-K1 , with no effect on LRP-deficient cells.
- the combination of peptide and cytotoxic conjugate reduced viable cell number by nearly 40% for wild-type CHO-K1 , with only a 5% loss in LRP- deficient CHO-K1.
- Saporin alone (1 ⁇ M) resulted in losses of about 55% (wild-type) and 35% (LRP-deficient).
- Infection with hepatitis B virus can produce a variety of outcomes ranging from asymptomatic infection, acute hepatitis, fulminant (rapid and severe onset) hepatitis, or development of a chronic low-level persistent infection. Between 5 and 10% of infected adults will become chronic carriers. Of those with chronic carrier status, 25-35% will eventually die from complications of the infection either from cirrhosis or hepatocellular carcinoma (HCC). The probability of developing hepatocellular carcinoma also increases with alcoholism, smoking and obesity. Prognosis for this disease is poor, with a reported 5-year median survival rate of under 5%.
- HCC is the 5th most common malignant tumor to be diagnosed, and worldwide accounts for nearly 500,000 deaths annually. Surgical removal, transplant and physical destruction of tumor tissue are first choices for treatment, but only 5 to 10% of patients present with tumors suitable for these approaches (13-15). Further, systemic chemotherapy yields low response rates of 15-20%, both because of the toxicity of chemotherapeutics and tumor cell resistance (16-17).
- doxorubicin is a cancer chemotherapeutic with high efficiency against a wide variety of tumors, and is especially toxic to cells undergoing rapid growth, including tumor cells.
- the use of doxorubicin in the treatment of hepatocellular carcinoma is limited by significant liver and heart toxicity and suppression of blood-cell production (34).
- hepatocellular carcinoma cells show high rates of conversion to drug-resistant types (35).
- An alternative approach to therapy utilizes radiation.
- a new treatment for liver cancer that is currently being tested involves injecting microscopic glass beads that have been labeled with a radioactive material ( 90 Y) into the main liver artery, from where it passes in to the small blood vessels that perfuse tumor tissue. The radiation then destroys the tumor tissue.
- a radioactive material 90 Y
- significant shunting of blood from the hepatic artery to the lungs precludes use of the glass beads in many patients.
- Significant reflux of beads into arteries feeding the gastrointestinal tract can also cause serious side-effects. Effective delivery of radiation therapy to tumor tissue therefore requires a more directed approach that does not rely on large materials that will be trapped in blood vessels.
- HCC hepatocellular carcinoma
- HCC hepatocellular carcinoma
- Woodchuck hepatitis virus and human hepatitis B virus are similar in structure, genetics, methods of transmission, course of infection and progression to hepatocellular carcinoma. There are significant similarities that underscore the importance of this model.
- RAP peptide is conjugated to 90 Y (GE Healthcare) and administered intravenously to anaesthetized, HCC- bearing woodchucks.
- the RAP peptide contains a DOTA chelating moiety at the N-terminus to allow loading with radioisotopes such as 90 Y. Modification of RAP peptide therefore allows the production of RAP peptide- 90 Y through incubation of the modified RAP peptide with Yttrium-90.
- a useful delivery compound will generally exhibit the following characteristics: 1 ) does not adversely affect the already compromised function of the liver, 2) measurable uptake by the liver and malignant liver tissue, 3) and upon uptake, is toxic to tumor cells and causes tumor regression.
- 90 Y has well-defined toxicity and carcinogenicity profiles. It is expected that the pharmacokinetic profile of the RAP peptide-DOTA- 90 Y conjugate will not be significantly different from RAP, with rapid and near quantitative liver accumulation. RAP peptide pharmacokinetics are likely to be very similar in all mammalian species since LRP1 function, sequence and expression is strongly conserved within the sub-phylum. Similarly, RAP sequence is homologous among mammalian species, although the human sequence is identical only to that of other primates.
- the serum is analyzed for viral load and baseline levels of the following molecules: alkaline phosphatase (ALP) - an enzyme related to the bile ducts; often increased when they are blocked; aspartate aminotransferase (AST) - AST is a cytoplasmic enzyme in liver released from damaged cells, highest elevations occur in viral hepatitis and hepatotoxicity alanine aminotransferase (ALT), more specific for the liver than AST, but also present in kidney and muscle.
- ALP alkaline phosphatase
- AST aspartate aminotransferase
- ALT alanine aminotransferase
- AST elevations are of liver origin (e.g., elevation of both AST and ALT strongly suggest hepatocellular injury; bilirubin, disproportionate elevation of conjugated bilirubin is seen in cholestasis and late in the course of chronic liver disease and serum bilirubin is increased in hepatocellular damage; albumin, measures the main protein made by the liver and tells whether or not the liver is making an adequate amount of this protein; gamma-glutamyl transferase (GGT), is an enzyme found in hepatic cells and highly sensitive to liver damage and repair; lactic acid dehydrogenase (LDH), found in liver cells, increases usually found upon cellular death and/or leakage from the cell due to injury; prothrombin time (PT), PT depends on the hepatic synthesis of the Vitamin-K-dependent factors: II, VII, IX and X, elevation in PT may be a sign of hepatic insufficiency, and total protein levels, to measure albumin
- the animals are anesthetized and both hind limbs are shaved and cleaned.
- the major (tarsal) vein in the leg is exposed and a catheter implanted into one leg.
- the woodchuck is then placed in a magnetic resonance imaging (MRI), 7T MRI.
- a scout image of the liver is acquired to determine the location and size of the liver.
- a multi-slice, multi-echo 12- weighted image gated to the mechanical ventilation of the woodchuck is acquired to give high quality images of the entire liver and the location of any tumors.
- a contrast agent (gadolinium) is injected through the catheter to improve the image quality of the T2 images and locate the tumor.
- the liver is also imaged using a 2D-CSI (two dimensional chemical shift imaging) phosphorus spectroscopy.
- RAP peptide- 90 Y is injected into the vein of the leg that does not have a catheter implanted in it.
- RAP- 90 Y is injected in a second pair of infected woodchucks.
- the third pair of infected woodchucks will be injected with DOTA- 90 Y. This condition serves as a negative control as the 90 Y will have no attached targeting moiety.
- the four control woodchucks will be injected with either RAP peptide- 90 Y or RAP- 90 Y dissolved in saline, to provide a comparison of the relative distribution of the two test compounds in animals with diseased and healthy livers.
- An effective dose of 100 picomol/kg (3 nmol/m2) is derived by assuming a 500 MBq dose, quantitative loading of the RAP peptide-DOTA with 90 Y and a specific activity for YCI3 of 74 petabecquerels per mole.
- administering provide a method for determining that the RAP peptide and full-length RAP protein are both effective molecules to transport active agents to the liver, and that the RAP- and RAP peptide- conjugate mimics the LRP1 -targeting behavior of full-length unconjugated RAP in vivo.
- RAP, RAP fragment or RAP variant is targeted more specifically to the liver than other tissue.
- localization and distribution of the RAP proteins and fragments conjugated to 90 Y is performed.
- the animals are also monitored for localization and distribution of control drug and tumor cells.
- Tissue sections analyzed may include adipose tissue, gastrointestinal tract, skin, kidney, spinal cord, liver, spleen, adrenal gland, tumour tissue, non-tumour tissue, thymus, bone (vertebra), lung, thyroid/parathyroid gland, bone marrow, lymph node, brain, myocardium, pancreas, stomach wall, salivary gland (parotid), and small and large Intestine.
- each animal specimen is deep frozen in CO2/hexane. Appropriate steps are taken to provide animal specimens suitable for cryosectioning which are then embedded in 2% carboxymethylcellulose (CMC) according to animal care protocols standard in the art.
- CMC carboxymethylcellulose
- Sections are freeze-dhed in the microtome cryocabinet for at least 16 hours or in the ThermoSavant freeze-dryer for approximately 30 minutes. Representatives of each section is exposed to a 14 C- imaging plate for 30 minutes, 1 , 2, 6, 12, 24, 48 and 72 hours (in a lead box and refrigerated at circa 4 0 C to minimize background radiation artifacts), in order to provide the best resolution without loss of time. Following exposure, the imaging plates are read by the Fuji BAS-2500 scanner and its Fuji Image Reader software version 1.1.
- RAP conjugates will preferentially be found in the liver of the subject animals, especially those having hepatocellular carcinoma or other liver damage.
- EXAMPLE 4 GENERATION OF MINIMIZED RAP PEPTIDES AND EVALUATION OF BINDING AFFINITY FOR LRP1
- mRAP-8c (SEQ ID NO: 10) comprises amino acid substitutions E246C ,L247G iat the N-terminal end of the fragment and substitutions L311 G, S312C at the C-terminal end.
- mRAP-14c (SEQ ID NO: 11 ) comprises amino acid substitutions F250C and L308G, Q309C.
- the sequence biotin- GGSGG (SEQ ID NO: 12) was added N-terminally to each peptide.
- LRP1 cluster Il The affinities of the mRAP-8c and MRAP-14c peptides for LRP1 cluster Il were determined by solid phase binding assay. Briefly, recombinant human LRP1 cluster Il (R&D Systems, amino acids 786-1165, with C-terminal Fc tag, 1 ⁇ g) was used to coat Nunc MAXISORPTM 96-well plates in TBS pH 8 supplemented with 5 mM CaCI 2 (TBSC) overnight at 4° C. Wells were washed with TBSC and blocked with TBSC containing 2% BSA.
- LRP1 ligands were incubated with the immobilized receptor, in the presence or absence of inhibitors, for 2 hours in the above blocking buffer supplemented with 0.05% Tween-20 at room temperature.
- all inhibitor solutions were preincubated with immobilized LRP1-C2 for one hour prior to direct addition of the RAP d3 ligand. Since the ligand binding competence of CR pairs requires calcium, identical binding reactions were done in the presence of 50 mM EDTA to provide a measure of nonspecific binding. Control wells contained no added inhibitor.
- the truncated peptide (mRAPc), derived from RAP d3 and cyclized with an intramolecular disulfide bond, was used to test the effect of multimehzation on binding to the second ligand binding domain of LRP1 (LRP1 -C2).
- LRP1 -C2 LRP1 -C2
- the peptide was fitted with an N- terminal biotin residue separated from the RAP sequence by a pentapeptide linker (GGSGG) (SEQ ID NO: 12).
- the monomeric mRAPc peptide was shown above to bind with high-affinity to LRP1 -C2.
- Results show that the degree of inhibition (EC50) for the monomeric peptide was 29 ⁇ 7 nM (Table 3).
- the streptavidin alone had no inhibitory effect.
- the multifold enhancement of inhibition seen in the presence of streptavidin is consistent with an improvement in avidity upon multimerization of the minimized RAP domain.
- Streptavidin has been reported to accumulate in kidney, but not significantly in liver following intravenous injection (Wilbur, et al., Bioconjug Chem 9:100-107, 1998; Rosebrough,et al., J Nucl Med 37:1380-1384, 1996).
- the preparation of biotinylated RAP distributed to liver at levels 2.7-fold greater than that of streptavidin alone, and at similar or lower levels in all other tissues tested (Figure 3).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Inorganic Chemistry (AREA)
- Biomedical Technology (AREA)
- Communicable Diseases (AREA)
- Cell Biology (AREA)
- Virology (AREA)
- Pathology (AREA)
- Radiology & Medical Imaging (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Botany (AREA)
- Mycology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Transplantation (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HK09111208.6A HK1132930B (en) | 2006-09-18 | 2007-09-18 | Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates |
| CA002663377A CA2663377A1 (en) | 2006-09-18 | 2007-09-18 | Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates |
| US12/441,618 US8795627B2 (en) | 2007-03-21 | 2007-09-18 | Treatment of liver disorders by administration of RAP conjugates |
| EP07842713.5A EP2063905B1 (en) | 2006-09-18 | 2007-09-18 | Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates |
| MX2009002893A MX2009002893A (es) | 2006-09-18 | 2007-09-18 | Tratamiento de trastornos hepaticos mediante la administracion de conjugados de la proteina asociada al receptor (rap). |
| JP2009528530A JP2010503710A (ja) | 2006-09-18 | 2007-09-18 | 受容体関連タンパク質(rap)結合体の投与による肝障害の処置 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| USPCT/US06/36453 | 2006-09-18 | ||
| PCT/US2006/036453 WO2007035716A2 (en) | 2005-09-16 | 2006-09-18 | Compositions comprising receptor-associated protein (rap) variants specific for cr-containing proteins and uses thereof |
| US91929507P | 2007-03-21 | 2007-03-21 | |
| US60/919,295 | 2007-03-21 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2008036682A2 true WO2008036682A2 (en) | 2008-03-27 |
| WO2008036682A3 WO2008036682A3 (en) | 2009-04-09 |
Family
ID=40590008
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2007/078792 Ceased WO2008036682A2 (en) | 2006-09-18 | 2007-09-18 | Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US8795627B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP2063905B1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2010503710A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20090071598A (cg-RX-API-DMAC7.html) |
| CN (1) | CN101594878A (cg-RX-API-DMAC7.html) |
| CA (1) | CA2663377A1 (cg-RX-API-DMAC7.html) |
| MX (1) | MX2009002893A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2008036682A2 (cg-RX-API-DMAC7.html) |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008116171A1 (en) * | 2007-03-21 | 2008-09-25 | Raptor Pharmaceutical Inc. | Cyclic receptor-associated protein (rap) peptides |
| WO2011094536A1 (en) | 2010-01-28 | 2011-08-04 | Raptor Pharmaceuticalls Inc. | Method for treating liver disorders with receptor associated protein ( irp) peptide-fucosidase inhibitor conjugates |
| JP2012503619A (ja) * | 2008-09-26 | 2012-02-09 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | Hcv感染に対する抗ウイルス治療のための標的としての宿主細胞キナーゼ |
| WO2011103465A3 (en) * | 2010-02-20 | 2012-02-23 | Alexey Gennadievich Zdanovsky | Botulinum neurotoxin antigenic compositions and methods |
| JP2012521754A (ja) * | 2009-03-27 | 2012-09-20 | ジェイダブリュ ファーマシューティカル コーポレーション | インターフェロン−アルファ及び細胞質残留性細胞膜透過ペプチドを含むIFN−α融合タンパク質 |
| US8710013B2 (en) | 2008-04-18 | 2014-04-29 | Angiochem Inc. | Pharmaceutical compositions of paclitaxel, paclitaxel analogs or paclitaxel conjugates and related methods of preparation and use |
| US20140154285A1 (en) * | 2012-12-05 | 2014-06-05 | Thevax Genetics Vaccine Co., Ltd. | Fusion proteins for use as immunogenic enhancers for inducing antigen-specific t cell responses |
| US8828925B2 (en) | 2008-10-15 | 2014-09-09 | Angiochem Inc. | Etoposide and doxorubicin conjugates for drug delivery |
| ITMI20130513A1 (it) * | 2013-04-05 | 2014-10-06 | Euroclone S P A | Metodo diagnostico per patologie autoimmuni del fegato |
| US8853353B2 (en) | 2008-12-17 | 2014-10-07 | Angiochem, Inc. | Membrane type-1 matrix metalloprotein inhibitors and uses thereof |
| US8921314B2 (en) | 2008-10-15 | 2014-12-30 | Angiochem, Inc. | Conjugates of GLP-1 agonists and uses thereof |
| EP2919798A1 (en) * | 2012-11-14 | 2015-09-23 | Sagetis Biotech, SL | Polypeptides for blood brain barrier transport |
| US9161988B2 (en) | 2009-07-02 | 2015-10-20 | Angiochem Inc. | Multimeric peptide conjugates and uses thereof |
| US9173891B2 (en) | 2009-04-20 | 2015-11-03 | Angiochem, Inc. | Treatment of ovarian cancer using an anticancer agent conjugated to an angiopep-2 analog |
| US9221867B2 (en) | 2003-01-06 | 2015-12-29 | Angiochem Inc. | Method for transporting a compound across the blood-brain barrier |
| US20160024223A1 (en) * | 2013-03-14 | 2016-01-28 | Rhode Island Hospital, A Lifespan-Partner | Treating Hepatitus B Virus Infections |
| US9365634B2 (en) | 2007-05-29 | 2016-06-14 | Angiochem Inc. | Aprotinin-like polypeptides for delivering agents conjugated thereto to tissues |
| US20160250324A1 (en) * | 2015-02-26 | 2016-09-01 | Thevax Genetics Vaccine Co., Ltd. | Vaccine composition comprising an immunogenic protein and combination adjuvants for use in eliciting antigen-specific t-cell responses |
| US9713646B2 (en) | 2005-07-15 | 2017-07-25 | Angiochem Inc. | Potentiation of anticancer agents |
| US9914754B2 (en) | 2008-12-05 | 2018-03-13 | Angiochem Inc. | Conjugates of neurotensin or neurotensin analogs and uses thereof |
| US10308718B2 (en) | 2015-04-07 | 2019-06-04 | Alector Llc | Anti-sortilin antibodies and methods of use thereof |
| US10849992B1 (en) | 2015-04-07 | 2020-12-01 | Alector Llc | Methods of screening for sortilin binding antagonists |
| US10980892B2 (en) | 2015-06-15 | 2021-04-20 | Angiochem Inc. | Methods for the treatment of leptomeningeal carcinomatosis |
| US11396546B2 (en) | 2018-07-13 | 2022-07-26 | Alector Llc | Anti-Sortilin antibodies and methods of use thereof |
| EP4362965A4 (en) * | 2021-07-02 | 2025-08-06 | Univ Westlake | USE OF AN LRP1 INHIBITOR IN THE TREATMENT OF A NOTCH SIGNALING-DEPENDENT DISEASE |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8956859B1 (en) | 2010-08-13 | 2015-02-17 | Aviex Technologies Llc | Compositions and methods for determining successful immunization by one or more vaccines |
| CA3049508A1 (en) | 2017-01-30 | 2018-08-02 | Vect-Horus | Compositions and methods for cancer imaging and radiotherapy |
| WO2025072672A2 (en) | 2023-09-27 | 2025-04-03 | Judo Bio, Inc. | Slc6a19-targeting modulatory nucleic acid agents |
Citations (919)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3624216A (en) | 1970-06-25 | 1971-11-30 | Abbott Lab | 8-substituted theophyllines as anti-inflammatory agents |
| US3624126A (en) | 1969-09-02 | 1971-11-30 | Squibb & Sons Inc | {66 {11 , {60 -adamantane acetic acid |
| US3668210A (en) | 1968-02-07 | 1972-06-06 | Yoshitomi Pharmaceutical | 3-chloro dihydrodibenzazepine derivatives |
| US3678169A (en) | 1969-02-28 | 1972-07-18 | Ciba Geigy Corp | Pyridyl-2-imidazolones as anti-inflammatory agents |
| US3691214A (en) | 1970-06-08 | 1972-09-12 | Warner Lambert Pharmaceutical | 17-valerate ester of 6alpha,9alpha-difluoroprednisolone,its compositions and use as an anti-inflammatory agent |
| US3691216A (en) | 1958-05-28 | 1972-09-12 | Sune Bergstrom | Pge2 methyl ester and pge2 methyl ester diacetate |
| US3694471A (en) | 1970-06-08 | 1972-09-26 | Warner Lambert Pharmaceutical | 17-valerate ester of 6{60 ,9{60 -difluorohydrocortisone, its compositions and use as an anti-inflammatory agent |
| US3726978A (en) | 1967-11-02 | 1973-04-10 | Sandoz Ag | Tetrahydropyridazines and pyridazinones as anti-inflammatory agents |
| US3759921A (en) | 1969-10-16 | 1973-09-18 | Lilly Co Eli | Method of suppressing immuneresponse with 1 substituted-3-(2 pyrimidyl)ureas |
| US3764676A (en) | 1970-10-28 | 1973-10-09 | Gates Rubber Co | Diethyl cyanomethyl phosphonate as an antimicrobial agent |
| US3764677A (en) | 1971-06-25 | 1973-10-09 | Gates Rubber Co | Diethyl betaaminoethylphosphonate as an antimicrobial agent |
| US3783160A (en) | 1970-10-28 | 1974-01-01 | Gates Rubber Co | Diethyl allyl phosphonate as an anti-microbial agent |
| US3789123A (en) | 1968-03-27 | 1974-01-29 | Ciba Geigy Corp | Tertiary aminoacids as anti-inflammatory agents |
| US3789121A (en) | 1971-11-26 | 1974-01-29 | Warner Lambert Co | 17{60 ,21-orthobutyrates of 6{60 , 9{60 -difluoro-hydrocortisone and 6{60 , 9{60 -difluoroprednisolone, compositions containing same and the use thereof as anti-inflammatory agents |
| US3821377A (en) | 1972-02-22 | 1974-06-28 | Squibb & Sons Inc | Anti-inflammatory agents |
| US3821401A (en) | 1971-09-13 | 1974-06-28 | Lilly Co Eli | Other publications |
| US3832470A (en) | 1968-01-29 | 1974-08-27 | H Russek | Treatment of angina pectoris with a long-acting vasodilating agent and a beta adrenergic receptor blocking agent |
| US3852468A (en) | 1967-02-27 | 1974-12-03 | Ici Ltd | Alkanolamine derivatives as {62 -adrenergic blocking agents |
| US3856962A (en) | 1973-07-10 | 1974-12-24 | R Alphin | Anti-inflammatory agents |
| US3857955A (en) | 1971-03-29 | 1974-12-31 | Lilly Co Eli | Anti-inflammatory agents |
| US3865748A (en) | 1970-09-22 | 1975-02-11 | Us Agriculture | Cinnamyl phenol antimicrobial agents |
| US3867548A (en) | 1972-05-25 | 1975-02-18 | Us Agriculture | Dihydrocinnamyl phenols useful as antimicrobial agents |
| US3867383A (en) | 1971-03-29 | 1975-02-18 | Ciba Geigy Corp | Monoanthranilatoanilino-s-triazines |
| US3873715A (en) | 1973-04-06 | 1975-03-25 | Univ Miami | Therapeutic agent for improving cardiovascular function |
| US3880834A (en) | 1971-09-10 | 1975-04-29 | Shionogi & Co | 1-Methylaziridine compounds and production thereof |
| US3883540A (en) | 1972-03-06 | 1975-05-13 | Bayer Ag | Unsymmetrical esters of N-substituted 1,4-dihydropyridine 3,5-dicarboxylic acid |
| US3886157A (en) | 1971-03-29 | 1975-05-27 | Ciba Geigy Corp | 5,6,8,8B,9-Pentaazanaphth{8 3,2,1-d,e{9 anthracene derivatives |
| US3897442A (en) | 1974-03-14 | 1975-07-29 | Syntex Inc | Thiazole cardiovascular agents |
| US3897441A (en) | 1971-10-27 | 1975-07-29 | Syntex Inc | Certain thiazole-carboxamides and acylamino-thiazoles |
| US3898210A (en) | 1968-08-21 | 1975-08-05 | Squibb & Sons Inc | 4-Azatricyclo {8 4.3.1.1{hu 3,8{b {9 undecane and related compounds |
| US3915889A (en) | 1972-05-25 | 1975-10-28 | Us Agriculture | Dihydrocinnamyl phenol antimicrobial agents |
| US3917476A (en) | 1970-10-28 | 1975-11-04 | Gates Rubber Co | Diethyl alpha phosphonate as an (antimicrobial agent) algaecide |
| US3923818A (en) | 1972-06-10 | 1975-12-02 | Bayer Ag | 1,4-Dihydropyridines |
| US3925369A (en) | 1972-11-03 | 1975-12-09 | Science Union & Cie | New tricyclic ureas processes for their production and pharmaceutical compositions |
| US3928356A (en) | 1967-10-06 | 1975-12-23 | Fujisawa Pharmaceutical Co | 10-{8 4-({107 -Hydroxy alkyl)-1-piperazimyl{9 -dibenzo (h,f) oxofins and thiepins and acetyl esters thereof |
| US3930005A (en) | 1973-06-15 | 1975-12-30 | Squibb & Sons Inc | Antiinflammatory agents and their use |
| US3934018A (en) | 1970-09-03 | 1976-01-20 | Abbott Laboratories | 4,6-Dihydro-1,3-dimethyl-8-phenylpyrazolo[4,3-e] [1,4]diazepin-5-(1H)-one and derivatives as anti-inflammatory agents |
| US3933834A (en) | 1972-03-06 | 1976-01-20 | Bayer Aktiengesellschaft | Unsymmetrical esters of N-substituted 1,4-dihydropyridine 3,5-dicarboxylic acid |
| US3936393A (en) | 1970-09-22 | 1976-02-03 | The United States Of America As Represented By The Secretary Of Agriculture | Antimicrobial agents and use thereof |
| US3936450A (en) | 1972-02-08 | 1976-02-03 | Centre Europeen de Recherches Mauvernay "C.E.R.M." | Anti-inflammatory agents and method for their preparation |
| US3939152A (en) | 1973-04-04 | 1976-02-17 | Yeda Research And Development Company Ltd. | 5-Phenyl-2,4-benzodiazepines |
| US3940407A (en) | 1974-09-16 | 1976-02-24 | Syntex (U.S.A.) Inc. | β-Adrenergic blocking agents in the 1,2,3-thiadiazole series |
| US3947475A (en) | 1975-04-28 | 1976-03-30 | Stauffer Chemical Company | 5-Furoyl-2,2,4-trimethyl-1,4-dihydro-1H-1,5-benzodiazepine as an anti-inflammatory agent |
| US3949082A (en) | 1974-07-24 | 1976-04-06 | Merck & Co., Inc. | Thiadiazoles as anti-inflammatory agents |
| US3949081A (en) | 1974-04-08 | 1976-04-06 | Ciba-Geigy Corporation | 4-Carbamoyl-1-benzazepines as antiinflammatory agents |
| US3951950A (en) | 1968-08-21 | 1976-04-20 | E. R. Squibb & Sons, Inc. | 4-Azatricyclo[4.3.1.13,8 ]undecane and related compounds |
| US3954868A (en) | 1972-03-02 | 1976-05-04 | Uniroyal, Inc. | Bis(diphenylaminomethane) antimicrobial agents |
| US3959368A (en) | 1975-04-28 | 1976-05-25 | Stauffer Chemical Company | N,N-dimethyl-N'-phenylthiocarbamyl formamidine and its use as an anti-inflammatory agent |
| US3959296A (en) | 1972-06-10 | 1976-05-25 | Bayer Aktiengesellschaft | 1,4-Dihydropyridines |
| US3966944A (en) | 1975-05-19 | 1976-06-29 | Abbott Laboratories | 10 (N-methyl-4-piperidylidene)-10H[1]-benzopyrano[3,2-b]-pyridine as an analgesic, anti-inflammatory and agent against type III hypersensitivity disease |
| US3966968A (en) | 1973-01-26 | 1976-06-29 | Henkel & Cie G.M.B.H. | N,N'-disubstituted thioureas, their process of production and use as antimicrobial agents |
| US3968125A (en) | 1973-11-05 | 1976-07-06 | Eli Lilly And Company | Dihydroxyhexahydrodibenzo[b,d]pyrans |
| US3968224A (en) | 1975-04-28 | 1976-07-06 | Stauffer Chemical Company | 3-(4'-Chlorophenyl)-5-methyl-4,5-dihydro-1,2,4-oxadiazole, its use as an anti-inflammatory agent |
| US3968117A (en) | 1972-06-10 | 1976-07-06 | Bayer Aktiengesellschaft | 1,4-Dihydropyridines |
| US3975543A (en) | 1974-07-05 | 1976-08-17 | Eli Lilly And Company | Ethyl- and vinylbenzenes as anti-inflammatory agents |
| US3978219A (en) | 1975-07-25 | 1976-08-31 | Stauffer Chemical Company | Nicotinamidoxime as an anti-inflammatory agent |
| US3978227A (en) | 1975-04-28 | 1976-08-31 | Stauffer Chemical Company | 5-furoyl-2,2,4-trimethyl-1,4-dihydro-1h-1,5-benzodiazepine as an anti-inflammatory agent |
| US3978202A (en) | 1975-07-25 | 1976-08-31 | Stauffer Chemical Company | ο-Chlorobenzamidoxime as an anti-inflammatory agent |
| US3980652A (en) | 1970-11-11 | 1976-09-14 | A. Christiaens Societe Anonyme | 2-(4-Methyl-piperazino)-3 or 5 cyano pyridine |
| US3982010A (en) | 1971-10-27 | 1976-09-21 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US3984405A (en) | 1971-06-28 | 1976-10-05 | E. R. Squibb & Sons, Inc. | Anti-inflammatory agents |
| US3991201A (en) | 1974-06-27 | 1976-11-09 | Janssen Pharmaceutica N.V. | 1-(β-Aryl-β-R-ethyl)imidazoles as antimicrobial agents |
| US3991057A (en) | 1970-11-11 | 1976-11-09 | A. Christiaens Societe Anonyme | C-Piperazino-pyridine sulfonamides |
| US3991212A (en) | 1973-12-26 | 1976-11-09 | Eli Lilly And Company | Anti-inflammatory agents |
| US3993639A (en) | 1974-02-08 | 1976-11-23 | Roland Yves Mauvernay | Heptaminol adenosine-5'-monophosphate |
| US3993763A (en) | 1969-03-18 | 1976-11-23 | Ciba-Geigy Corporation | Tertiary aminoacids as anti-inflammatory agents |
| US3994898A (en) | 1975-10-16 | 1976-11-30 | E. R. Squibb & Sons, Inc. | 1,2,4-Triazolo (4,3-b) pyridazin-3-ones |
| US3998954A (en) | 1971-02-05 | 1976-12-21 | Pfizer Inc. | 1,3(2H,4H)-Dioxoisoquinoline-4-carboxamides used as anti-inflammatory agents |
| US3998970A (en) | 1975-04-28 | 1976-12-21 | Stauffer Chemical Company | N,N-dimethyl-N'-phenylthiocarbamyl formamidine and its use as an anti-inflammatory agent |
| US4000275A (en) | 1969-11-24 | 1976-12-28 | Eli Lilly And Company | Immunosuppressants |
| US4001421A (en) | 1971-10-27 | 1977-01-04 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4002775A (en) | 1973-07-09 | 1977-01-11 | Kabara Jon J | Fatty acids and derivatives of antimicrobial agents |
| US4011321A (en) | 1973-12-19 | 1977-03-08 | Smith Kline & French Laboratories Limited | Pharmaceutical compositions and methods of inhibiting β-adrenergic receptors |
| US4011326A (en) | 1975-07-29 | 1977-03-08 | Merck & Co., Inc. | 2-Substituted oxazolo[4,5-b]pyridine anti-inflammatory agents |
| US4012527A (en) | 1975-09-15 | 1977-03-15 | Stauffer Chemical Company | N,N-Dimethyl-N'-phenylthiocarbamyl formamidine hydrochloride and its use as an anti-inflammatory agent |
| US4012448A (en) | 1976-01-15 | 1977-03-15 | Stanford Research Institute | Synthesis of adriamycin and 7,9-epiadriamycin |
| US4013672A (en) | 1976-03-15 | 1977-03-22 | E. R. Squibb & Sons, Inc. | 2,5,7,8-Tetrahydro-1,2,4,5,6-pentaazabenzo[6,7]-cyclohepta[1,2,3-cd]-as-indacenes |
| US4018895A (en) | 1974-01-10 | 1977-04-19 | Eli Lilly And Company | Aryloxyphenylpropylamines in treating depression |
| US4018923A (en) | 1976-03-10 | 1977-04-19 | Eli Lilly And Company | 5,6-Diaryl-1,2,4-triazines as topically-active anti-inflammatory agents |
| US4018779A (en) | 1976-03-25 | 1977-04-19 | E. R. Squibb & Sons, Inc. | Derivatives of 10,11-dihydrobenzo[4,5]cyclohepta[1,2-b]-pyrazolo[4,3-e]pyridine-5(1H)ones |
| US4020072A (en) | 1976-05-04 | 1977-04-26 | E. R. Squibb & Sons, Inc. | 5-Aminomethyl-1H-pyrazolo[3,4-b]pyridines |
| US4021550A (en) | 1975-06-18 | 1977-05-03 | John Wyeth & Brother Limited | Hexahydroazepines as antiinflammatory agents |
| US4021553A (en) | 1976-03-10 | 1977-05-03 | Eli Lilly And Company | 5,6-Diaryl-1,2,4-triazines as topically-active anti-inflammatory agents |
| US4022836A (en) | 1972-12-06 | 1977-05-10 | Pfizer Inc. | 2-Aminomethyleneindanone analgesic agents |
| US4024284A (en) | 1975-06-09 | 1977-05-17 | Eli Lilly And Company | Ethyl- and vinylbenzenes as anti-inflammatory agents |
| US4027031A (en) | 1975-04-28 | 1977-05-31 | Stauffer Chemical Company | 2-Cyclopropanecarboxamido-S-halothiazole as anti-inflammatory agents |
| US4029661A (en) | 1971-10-04 | 1977-06-14 | Pcr, Inc. | Process for producing 5-fluorouracil and derivatives thereof in acid and/or alcohol solvents |
| US4031226A (en) | 1975-08-13 | 1977-06-21 | Janssen Pharmaceutica N.V. | N-[(1-piperidinyl)alkyl]arylcarboxamide derivatives |
| US4044139A (en) | 1974-02-08 | 1977-08-23 | Uniroyal, Inc. | Bis(diphenylaminomethane) antimicrobial agents |
| US4049665A (en) | 1975-12-24 | 1977-09-20 | Colgate-Palmolive Company | Unsymmetrical disulfides as antimicrobial agents |
| US4055655A (en) | 1975-07-21 | 1977-10-25 | National Research Laboratories | Complexes of heavy metal ions and polyfunctional organic ligands used as antimicrobial agents |
| US4056673A (en) | 1976-07-16 | 1977-11-01 | Hoffmann-La Roche Inc. | Phosphonoacetic acid derivatives of nucleosides |
| US4058620A (en) | 1974-07-19 | 1977-11-15 | Hoffmann-La Roche Inc. | Therapeutic agents for improving cardiovascular function |
| US4062858A (en) | 1976-12-22 | 1977-12-13 | E. R. Squibb & Sons, Inc. | Derivatives of 5,6-dihydrobenzo[5,6]cyclohepta[1,2-b]pyrazolo[4,3-e]pyridin-11(1H)-ones and 11(1H)-imines |
| US4064259A (en) | 1976-07-19 | 1977-12-20 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4064257A (en) | 1976-07-19 | 1977-12-20 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4064258A (en) | 1976-07-19 | 1977-12-20 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4069341A (en) | 1976-10-18 | 1978-01-17 | The Dow Chemical Company | Oxybis(4,1-phenylene(2-oxo-2,1-ethanediyl)) thiocyanate and its use as an antimicrobial agent |
| US4076834A (en) | 1974-07-19 | 1978-02-28 | Hoffmann-La Roche Inc. | Therapeutic agents for improving cardiovascular function |
| US4082843A (en) | 1975-11-26 | 1978-04-04 | Smith Kline & French Laboratories Limited | 3-(3-(3-Substituted amino-2-hydroxypropoxy)phenyl)-6-hydrazino pyridazines and their use as vasodilators and β-adrenergic blocking agents |
| US4083968A (en) | 1974-07-19 | 1978-04-11 | Hoffmann-La Roche | Therapeutic agent for improving cardiovascular function |
| US4089977A (en) | 1976-11-24 | 1978-05-16 | Kewanee Industries | Polymeric anti-microbial agent |
| US4089900A (en) | 1967-09-13 | 1978-05-16 | Pfizer Inc. | Antimicrobial agents |
| US4117012A (en) | 1972-12-06 | 1978-09-26 | Pfizer Inc. | 2-aminomethyleneindanone analgesic agents |
| US4117135A (en) | 1974-10-11 | 1978-09-26 | Schering, A.G. | Novel 5,6,7,8-tetrahydro-5-quinolines and their use as anti-inflammatory agents |
| US4123550A (en) | 1977-10-31 | 1978-10-31 | Syntex (U.S.A.) Inc. | Bicyclo[3.1.0]hexylethylaminocarbonyl-substituted heteroaryl cardiovascular agents |
| US4124707A (en) | 1976-12-22 | 1978-11-07 | Schering Corporation | 7α-Halogeno-3,20-dioxo-1,4-pregnadienes, methods for their manufacture, their use as anti-inflammatory agents, and pharmaceutical formulations useful therefor |
| US4124713A (en) | 1975-08-26 | 1978-11-07 | American Hoechst Corporation | Oxopyridobenzoxepin-acetic acids and derivatives thereof useful as antiinflammatory and analgesic agents |
| US4124726A (en) | 1976-01-01 | 1978-11-07 | Kaken Chemical Co., Ltd. | Anti-inflammatory agent of benzoyl derivative |
| US4125612A (en) | 1977-06-20 | 1978-11-14 | Schering Corporation | N-1-(p-Biphenylalkyl)piperazines and their use as anti-inflammatory agents |
| US4128664A (en) | 1977-05-16 | 1978-12-05 | Riker Laboratories, Inc. | Substituted benzamides as anti-inflammatory agents |
| US4130664A (en) | 1976-02-13 | 1978-12-19 | Uniroyal, Inc. | (Bis(diphenylaminomethane) antimicrobial agents |
| US4133819A (en) | 1977-06-17 | 1979-01-09 | Pfizer Inc. | Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents |
| US4139535A (en) | 1974-12-16 | 1979-02-13 | Merck & Co., Inc. | 3-Cyano-2-pyridinyloxymethyl-oxazolidine derivatives |
| US4141981A (en) | 1976-07-06 | 1979-02-27 | Bayer Aktiengesellschaft | Antimicrobial agent |
| US4143054A (en) | 1977-11-04 | 1979-03-06 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane- and 7-oxabicycloheptene compounds |
| US4145550A (en) | 1975-08-07 | 1979-03-20 | Merck Sharp & Dohme (I.A.) Corp. | 2-(4-Substituted-1,2,5-thiadiazole-3-yloxy)-acetaldehydes |
| US4145425A (en) | 1976-06-15 | 1979-03-20 | Merck & Co., Inc. | Substituted (3-loweralkylamino-2-R1 0-propoxy)pyridines, their preparation and use |
| US4145443A (en) | 1977-10-31 | 1979-03-20 | Syntex (U.S.A.) Inc. | Bicyclo 3.1.0!hexylethylaminocarbonyl-substituted naphthyloxy cardiovascular agents |
| US4145444A (en) | 1976-01-01 | 1979-03-20 | Kaken Chemical Co., Ltd. | Anti-inflammatory agent of benzoyl derivative |
| US4147798A (en) | 1977-08-02 | 1979-04-03 | W. R. Grace & Co. | Antineoplastic agent |
| US4147872A (en) | 1977-09-13 | 1979-04-03 | Pfizer Inc. | 3-[2-Hydroxy-4-(substituted)-phenyl]azacycloalkanes and derivatives thereof as analgesic agents and intermediates therefor |
| US4148796A (en) | 1971-03-15 | 1979-04-10 | Sumitomo Chemical Company, Limited | γ-Piperidinobutyrophenones |
| US4150231A (en) | 1976-04-06 | 1979-04-17 | Politechnika Gdanska | 1-Nitro-9-dialkylaminoisoalkylaminoacridines or their salts |
| US4151297A (en) | 1977-10-31 | 1979-04-24 | Syntex (U.S.A.) Inc. | Bicyclo [3.1.0] hexyl-substituted ethylamino carbonyl phenoxy cardiovascular agents |
| US4164514A (en) | 1972-12-06 | 1979-08-14 | Pfizer Inc. | 2-Aminomethyleneindanone analgesic agents |
| US4164586A (en) | 1974-07-19 | 1979-08-14 | Hoffmann-La Roche Inc. | Therapeutic agent for improving cardiovascular function |
| US4166122A (en) | 1977-03-15 | 1979-08-28 | Bayer Aktiengesellschaft | Bis-(5,5-dimethyl-1,3-oxazolidin-3-yl) methane as an antimicrobial agent |
| US4173634A (en) | 1979-02-23 | 1979-11-06 | E. R. Squibb & Sons, Inc. | Basically-substituted tricyclic pyrazoles useful as antiinflammatory agents |
| US4173650A (en) | 1978-11-03 | 1979-11-06 | American Cyanamid Company | Cis-2-benzoyl-3-hydroxy-2-alkenonitriles as anti-inflammatory agents |
| US4177280A (en) | 1978-07-03 | 1979-12-04 | Syntex (U.S.A.) Inc. | Bicyclo[3.1.0]hexyl-substituted carbonylaminophenoxy cardiovascular agents |
| US4180588A (en) | 1977-03-09 | 1979-12-25 | Mitsubishi Chemical Industries, Ltd. | Immunosuppressant |
| US4181720A (en) | 1978-04-05 | 1980-01-01 | Syntex (U.S.A.) Inc. | Corticosteroid antiinflammatory agents |
| US4188388A (en) | 1977-04-28 | 1980-02-12 | Albert Rolland S.A. | Phenoxy pyridazinones and anorexigenic use thereof |
| US4190587A (en) | 1973-08-06 | 1980-02-26 | Hoffmann-La Roche Inc. | 4-(3-Oxo-4-trifluoromethyl-1-octenyl)-2-oxo-2H-cyclopenta[b]furans |
| US4194009A (en) | 1974-01-10 | 1980-03-18 | Eli Lilly And Company | Aryloxyphenylpropylamines for obtaining a psychotropic effect |
| US4201778A (en) | 1977-11-08 | 1980-05-06 | Schering Corporation | 6-Acyloxy-1,4,6-pregnatrienes, their use as anti-inflammatory agents, methods for their manufacture, and 6-oxo-1,4-pregnadiene intermediates |
| US4209520A (en) | 1977-06-17 | 1980-06-24 | Pfizer Inc. | Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents |
| US4214089A (en) | 1978-07-18 | 1980-07-22 | American Home Products Corporation | Thiazolo[3,2-a]benzimidazoles, imidazo [2,1-b]thiazoles, and related compounds as antineoplastic agents, and enhancers of the immune response |
| US4215131A (en) | 1976-08-07 | 1980-07-29 | Bayer Aktiengesellschaft | Antimicrobial agents |
| US4220594A (en) | 1977-11-04 | 1980-09-02 | E. R. Squibb & Sons, Inc. | Hexa- and octahydro-4,7-epoxyisobenzofuran-1-ol and hexa- and octahydro-5,8-epoxy-1H-2-benzopyran-3-ol |
| US4226887A (en) | 1979-04-16 | 1980-10-07 | Eli Lilly And Company | Anti-inflammatory agents |
| US4231930A (en) | 1978-03-09 | 1980-11-04 | Shionogi & Co., Ltd. | 1-Substituted thiomethyltriazolobenzodiazepines |
| US4233311A (en) | 1977-05-10 | 1980-11-11 | Bayer Aktiengesellschaft | Antimicrobial agents and their use |
| US4234593A (en) | 1979-03-20 | 1980-11-18 | Stauffer Chemical Company | 3-(N-Alkylcarbamyl)-5-(carboalkoxy)-1,3,4-oxadiazole-2-thiones and their use as anti-inflammatory agents |
| US4235908A (en) | 1978-05-24 | 1980-11-25 | John Wyeth & Brother Limited | 4-Aminoquinoline derivatives, useful as anti-inflammatory agents |
| US4244955A (en) | 1979-04-30 | 1981-01-13 | Richardson-Merrell Inc. | 2,4a-Ethanobenz[g]isoquinolin-5(1H)-ones and their use as anti-fertility and analgesic agents |
| US4244963A (en) | 1979-09-27 | 1981-01-13 | Merck & Co., Inc. | 1-[2-(Alkyl and arylsulfonyl)-2-propenyl and propyl] substituted piperidines useful as antimicrobial and antiinflammatory agents |
| US4246411A (en) | 1977-03-14 | 1981-01-20 | Pcr Incorporated | 5,5-Difluorouracil |
| US4247710A (en) | 1978-02-08 | 1981-01-27 | Hoffmann-La Roche Inc. | Intermediate in the production of adrenergic blocking agents |
| US4251530A (en) | 1980-02-19 | 1981-02-17 | Merck & Co., Inc. | 2-{[4-(6-Substituted-2-pyrazinyl)-1-piperazinyl]alkyl}-5-substituted-1,2,4-triazolo[4,3-a]pyridin-3(2H)-one analgesic agents |
| US4252815A (en) | 1977-04-21 | 1981-02-24 | Mead Johnson & Company | Methods of treating cardiovascular diseases with phenyltetrazolyloxy propanolamines |
| US4252816A (en) | 1979-12-03 | 1981-02-24 | Merck & Co., Inc. | Tetrahydro-1H-1,4-diazepino(1,7-a)benzimidazoles useful as analgesic agents |
| US4260634A (en) | 1979-06-18 | 1981-04-07 | International Minerals & Chemical Corp. | Antimicrobial agents |
| US4267328A (en) | 1978-08-01 | 1981-05-12 | Synthelabo | 1-Phenylpiperazines |
| US4275064A (en) | 1976-02-06 | 1981-06-23 | Interx Research Corporation | Transient pro-drug forms of xanthine derivatives and their use as topical anti-inflammatory agents |
| US4277476A (en) | 1978-07-28 | 1981-07-07 | Synthelabo | Derivatives of fluorenes and fluoranthenes and process for their preparation |
| US4278608A (en) | 1979-09-06 | 1981-07-14 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4281189A (en) | 1979-09-06 | 1981-07-28 | Hoffmann-La Roche Inc. | Sulfonamide intermediates for adrenergic blocking agents |
| US4283394A (en) | 1979-08-06 | 1981-08-11 | Research Corporation | Cytotoxic nucleoside-corticosteroid phosphodiesters |
| US4285873A (en) | 1979-09-06 | 1981-08-25 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4294828A (en) | 1978-01-20 | 1981-10-13 | Societe D'etudes Scientifiques Et Industrielles De L'ile De-France | New derivatives of 4-amino-5-alkyl sulphonyl orthoanisamides, methods of preparing them and their application as psychotropic agents |
| US4294763A (en) | 1980-03-05 | 1981-10-13 | University Of Rochester | Intermediates for the production of picropodophyllin and related compounds and processes for the preparation and use thereof |
| US4296117A (en) | 1976-10-05 | 1981-10-20 | Boehringer Ingelheim Gmbh | 1-Aryloxy-2-hydroxy-3-[(Benzimidazolinone-substituted alkyl)-amino]propanes and salts thereof |
| US4304910A (en) | 1978-05-04 | 1981-12-08 | Kewanee Industries, Inc. | Quarnary ammonium polymeric anti-microbial agent |
| US4304721A (en) | 1979-09-06 | 1981-12-08 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4306097A (en) | 1977-09-13 | 1981-12-15 | Pfizer Inc. | 3-[2-Hydroxy-4-(substituted)phenyl]-cycloalkanol analgesic agents |
| US4308283A (en) | 1979-06-18 | 1981-12-29 | International Minerals & Chemical Corp. | Antimicrobial agents |
| US4311708A (en) | 1975-11-06 | 1982-01-19 | Synthelabo | Phenol ethers |
| US4311709A (en) | 1979-12-26 | 1982-01-19 | Merck & Co., Inc. | Loweralkyl substituted diphenyl polyamine as an antimicrobial agent |
| US4313896A (en) | 1974-01-10 | 1982-02-02 | Eli Lilly And Company | Aryloxyphenylpropylamines |
| US4314081A (en) | 1974-01-10 | 1982-02-02 | Eli Lilly And Company | Arloxyphenylpropylamines |
| US4314943A (en) | 1977-07-13 | 1982-02-09 | Mead Johnson & Company | Heterocyclic substituted aryloxy 3-indolyl-tertiary butylaminopropanols |
| US4317825A (en) | 1979-08-08 | 1982-03-02 | Sumitomo Chemical Company, Limited | Antitumor and immunosuppressive 4-carbamoyl imidazolium-5-olate derivatives |
| US4322420A (en) | 1978-09-11 | 1982-03-30 | Sankyo Company Limited | Method of using 4-anilinoquinazoline derivatives as analgesic and anti-inflammatory agents |
| US4324787A (en) | 1977-12-23 | 1982-04-13 | Troponwerke Gmbh & Co., Kg | 2-Oxo-1-pyrrolidineacetic acid compounds and their medicinal use |
| US4329289A (en) | 1978-02-08 | 1982-05-11 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4335141A (en) | 1979-12-26 | 1982-06-15 | Merck & Co., Inc. | 2-Substituted-aminopropene-and propanenitrile antimicrobial and anti-inflammatory agents |
| US4337199A (en) | 1978-11-01 | 1982-06-29 | Sanraku-Ocean Co., Ltd. | Antibiotic β-lactam compounds, production thereof, and their use as antimicrobial agent |
| US4342769A (en) | 1978-10-02 | 1982-08-03 | Schering Corporation | 2-[(Methylsulfinyl)acetyl]-3-heterocyclicindoles and derivatives thereof as immunosuppressants |
| US4346096A (en) | 1979-09-20 | 1982-08-24 | Sumitomo Chemical Company, Limited | Antitumor and immunosuppressive 4-carbamoyl imidazolium-5-olate derivatives and pharmaceutical composition thereof |
| US4355034A (en) | 1979-02-07 | 1982-10-19 | Merck & Co., Inc. | Ethenyl derivatives of mercaptoalkylpyridines as anti-inflammatory agents |
| US4358451A (en) | 1979-04-26 | 1982-11-09 | Synthelabo | Pyrimido- and imidazo-pyridoindole derivatives |
| US4361583A (en) | 1980-08-19 | 1982-11-30 | Synthelabo | Analgesic agent |
| US4363808A (en) | 1980-02-11 | 1982-12-14 | Berlex Laboratories, Inc. | N-(3-Phenoxy-2-hydroxypropyl)benzimidazole-1-alkanamines |
| US4370484A (en) | 1981-03-12 | 1983-01-25 | The Regents Of The University Of California | Sceptrin an antimicrobial agent from Agelas sceptrum |
| US4374139A (en) | 1981-11-09 | 1983-02-15 | Hoffmann-La Roche Inc. | Levorotatory N-substituted acylmorphinans useful as analgesic agents |
| US4383994A (en) | 1982-01-19 | 1983-05-17 | Mccully Kilmer S | Homocysteine thiolactone salts and use thereof as anti-neoplastic agents |
| US4391982A (en) | 1980-03-05 | 1983-07-05 | The University Of Rochester | Intermediates for the production of picropodophyllin and related compounds and processes for the preparation and use thereof |
| US4391827A (en) | 1980-09-08 | 1983-07-05 | Pfizer Inc. | 3-(2-Hydroxy-4-(substituted)phenyl)-cycloalkanone and cycloalkanol analgesic agents and intermediates therefor |
| US4395559A (en) | 1979-12-07 | 1983-07-26 | Hoffmann-La Roche Inc. | 2,3-Indoledione derivatives |
| US4395402A (en) | 1980-09-24 | 1983-07-26 | Zaidan Hojin Biseibutsu Kagaku Kankyu Kai | Analgesic agent |
| US4397853A (en) | 1979-11-28 | 1983-08-09 | Yoshitomi Pharmaceutical Industries Ltd. | Isoxazole derivatives |
| US4399283A (en) | 1980-03-11 | 1983-08-16 | Warner Lambert Company | Pharmaceutical salts of 4'-(9-acridinylamino)-methanesulfon-m-anisidide |
| US4400534A (en) | 1980-12-23 | 1983-08-23 | Sankyo Company, Limited | Analgesic and anti-inflammatory agents |
| US4410696A (en) | 1981-09-24 | 1983-10-18 | Sumitomo Chemical Company, Limited | Antitumor and immunosuppressive 4-carbamoylimidazolium-5-olate derivatives |
| US4412995A (en) | 1981-02-19 | 1983-11-01 | Sterling Drug Inc. | Pentacyclic phenylpyrazole compounds as anti-inflammatory agents |
| US4416896A (en) | 1982-05-17 | 1983-11-22 | E. R. Squibb & Sons, Inc. | 7-Oxabicyclopheptane substituted amino prostaglandin analogs useful in the treatment of thrombolytic disease |
| US4418076A (en) | 1982-05-03 | 1983-11-29 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane hydrazone prostaglandin analogs useful in treating thrombolytic diseases |
| US4424202A (en) | 1982-06-11 | 1984-01-03 | The Vinoxen Company, Inc. | Azelaaldehydates as psychotropic agents |
| US4427694A (en) | 1982-06-11 | 1984-01-24 | The Vinoxen Company, Inc. | Sesamin as a psychotropic agent |
| US4434175A (en) | 1981-08-10 | 1984-02-28 | Merck & Co., Inc. | Nonsteroidal compounds as anti-inflammatory and analgesic agents |
| US4435420A (en) | 1982-04-12 | 1984-03-06 | Merrell Dow Pharmaceuticals | Anti-inflammatory agents and antiasthmatic agents |
| US4440779A (en) | 1981-06-30 | 1984-04-03 | Merck & Co., Inc. | Tricyclic derivatives of substituted pyrrole acids as analgesic and anti-inflammatory agents |
| US4440781A (en) | 1982-06-11 | 1984-04-03 | The Vinoxen Company, Inc. | Oxyoctadecanoates as psychotropic agents |
| US4440763A (en) | 1981-03-18 | 1984-04-03 | Block Drug Company, Inc. | Use of 4-aminosalicyclic acid as an anti-inflammatory agent |
| US4443451A (en) | 1981-07-15 | 1984-04-17 | Janssen Pharmaceutica N.V. | Bicyclic pyrimidin-5-one derivatives |
| US4446128A (en) | 1978-02-24 | 1984-05-01 | Ciba-Geigy Corporation | Antigen derivatives and processes for their preparation |
| US4450159A (en) | 1979-08-08 | 1984-05-22 | The Upjohn Company | Carbamic acid derivatives as selective immunosuppresive agents |
| US4456616A (en) | 1982-12-27 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4456617A (en) | 1983-01-12 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4456615A (en) | 1982-10-25 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4459306A (en) | 1980-04-10 | 1984-07-10 | Science Union Et Cie | Tricyclic ethers, their process of preparation and their use as medicines |
| US4463015A (en) | 1982-08-18 | 1984-07-31 | E. R. Squibb & Sons, Inc. | Aryl substituted 7-oxabicycloheptane compounds, useful in inhibiting platelet aggregation |
| US4465687A (en) | 1982-05-24 | 1984-08-14 | Merck & Co., Inc. | Thienamycin derivatives as anti-inflammatory agents |
| US4466979A (en) | 1983-01-21 | 1984-08-21 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted carbamate prostaglandin analogs useful in treating platelet aggregation and bronchoconstriction |
| US4469690A (en) | 1981-12-08 | 1984-09-04 | Smithkline Beckman Corporation | Synergistic compositions of renal dopaminergic agent and β-blocker |
| US4470994A (en) | 1981-02-07 | 1984-09-11 | Bayer Aktiengesellschaft | Antimicrobial agents and their use |
| US4472411A (en) | 1982-04-22 | 1984-09-18 | Taisho Pharmaceutical Co., Ltd. | 1,4-Dihydropyridine derivatives and use as vasodilators |
| US4474806A (en) | 1982-05-10 | 1984-10-02 | Merck & Co., Inc. | Sulfonyl or carbonyl inositol derivatives useful as anti-inflammatory/analgesic agents |
| US4474807A (en) | 1982-05-06 | 1984-10-02 | Henkel Kommandigesellschaft Auf Aktien | 2-(3-Iodo-2-propynyloxy)-ethyl carbamates, the preparation thereof, and their use as antimicrobial agents |
| US4474803A (en) | 1983-03-14 | 1984-10-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thio prostaglandin analogs useful in treating platelet aggregation and bronchoconstriction |
| US4474804A (en) | 1983-09-19 | 1984-10-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicyclo substituted prostaglandin phenyl carboxylic acid derivatives useful as cardiovascular agents |
| US4477448A (en) | 1979-02-16 | 1984-10-16 | Sandoz Ltd. | Cephalosporin derivatives and use as antimicrobial agents |
| US4479953A (en) | 1983-08-25 | 1984-10-30 | Merck & Co., Inc. | Pyrazine aldimine compounds as antimicrobial agents |
| US4482562A (en) | 1980-02-13 | 1984-11-13 | Kowa Company, Ltd. | Aromatic aminoethanol compounds, and utilization thereof as cardiovascular agents |
| US4487776A (en) | 1982-02-11 | 1984-12-11 | Bayer Aktiengesellschaft | Azolyl-phenoxy-tetrahydrofuran-2-ylidene-methanes, a process for their preparation, and antimicrobial agents which contain these substances |
| US4489085A (en) | 1979-08-04 | 1984-12-18 | Bayer Aktiengesellschaft | Antimicrobial agents and their use employing imidazolyl-enal ethers |
| US4489098A (en) | 1982-09-28 | 1984-12-18 | The Dow Chemical Company | 2,2,3-Trihalopropionaldehydes as antimicrobial agents |
| US4490540A (en) | 1981-09-14 | 1984-12-25 | Janssen Pharmaceutica N.V. | (2-Aryl-4-phenylthioalkyl-1,3-dioxolan-2-ylmethyl)azole derivatives |
| US4492700A (en) | 1983-10-24 | 1985-01-08 | Merck & Co., Inc. | 3-Halo-2-thiopyrazines as antimicrobial agents |
| US4493839A (en) | 1982-05-24 | 1985-01-15 | Merck & Co., Inc. | 1-Carbapenem-3-carboxylic esters as anti-inflammatory agents |
| US4495197A (en) | 1982-05-24 | 1985-01-22 | Merck & Co., Inc. | N-Carboxyl-thienamycin esters and analogs thereof as anti-inflammatory agents |
| US4501755A (en) | 1981-05-01 | 1985-02-26 | Pennwalt Corporation | Isoflavones useful as anti-inflammatory agents |
| US4511724A (en) | 1982-06-10 | 1985-04-16 | Merck & Co., Inc. | 5-(Pyrrol-2-oyl)-1,2-dihydro-3H-pyrrolo [1,2-a]pyrrole derivatives as anti-inflammatory and analgesic agents |
| US4512990A (en) | 1982-02-18 | 1985-04-23 | Syntex (U.S.A.), Inc. | Benzthiazine analogs as antiinflammatory agents |
| US4514415A (en) | 1981-10-28 | 1985-04-30 | Ciba Geigy Corporation | Benzofuran-2(3H)-ones used as anti-inflammatory agents |
| US4517188A (en) | 1983-05-09 | 1985-05-14 | Mead Johnson & Company | 1-Pyrimidinyloxy-3-hetaryl-alkylamino-2-propanols |
| US4518608A (en) | 1979-09-27 | 1985-05-21 | Medimpex Gyogyszerkuelkereskedelmi Vaallalat | Watersoluble derivatives of non-steroidal anti-inflammatory agents and a process for the production thereof |
| US4520026A (en) | 1981-02-06 | 1985-05-28 | S. A. Labaz N.V. | Indolizine derivatives and use as cardiovascular agents |
| US4521539A (en) | 1984-05-10 | 1985-06-04 | E. R. Squibb & Sons, Inc. | Tetrahydrofuranyl substituted ethers |
| US4522949A (en) | 1983-10-20 | 1985-06-11 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin interphenylene analogs useful as cardiovascular agents |
| US4524147A (en) | 1981-03-24 | 1985-06-18 | Mitsui Toatsu Chemicals, Incorporated | Uracil derivatives, process for preparing same, and pharmaceutical compositions comprising same |
| US4524151A (en) | 1983-11-14 | 1985-06-18 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane thio ethers useful as cardiovascular agents |
| US4525479A (en) | 1983-08-29 | 1985-06-25 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thiocarbamate prostaglandin analogs useful as cardiovascular agents |
| US4526901A (en) | 1984-01-26 | 1985-07-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxamide prostaglandin analogs and their use in treating thrombolytic disease |
| US4526900A (en) | 1984-01-26 | 1985-07-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4529727A (en) | 1982-04-21 | 1985-07-16 | Janssen Pharmaceutical, N.V. | Pyrimido[2,1-b][1,3]-thiazines |
| US4532327A (en) | 1983-12-28 | 1985-07-30 | The United States Of America As Represented By The Secretary Of Agriculture | Sesbanimide and the use thereof in treating leukemic tumors |
| US4533673A (en) | 1984-01-26 | 1985-08-06 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted enaminone prostaglandin analogs and their use in treatment of thrombolytic disease |
| US4533671A (en) | 1982-10-08 | 1985-08-06 | Merck & Co., Inc. | 5-(2,3-Dihydro-1H-pyrrolizin-5-oyl)-2-alkanoic or carboxylic acids and analogs as anti-inflammatory and analgesic agents |
| US4536513A (en) | 1984-03-14 | 1985-08-20 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin interphenylene analogs useful in the treatment of thrombolytic disease |
| US4536503A (en) | 1981-12-14 | 1985-08-20 | Syntex (U.S.A.) Inc. | Naphthoxyalkylamines and related compounds as antiinflammatory agents |
| US4536512A (en) | 1982-10-08 | 1985-08-20 | Merck & Co., Inc. | 5-(2,3-Dihydro-1H-pyrrolizin-5-oyl)-2,3-dihydro-1H-pyrrolizine-1-alkanoic or carboxylic acids and use thereof as anti-inflammatory and analgesic agents |
| US4536514A (en) | 1984-04-06 | 1985-08-20 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombolytic disease |
| US4537904A (en) | 1982-05-17 | 1985-08-27 | E. R. Squibb & Sons, Inc. | Compositions of 7-oxabicycloheptane and 7-oxabicycloheptene compounds and a method for their use in inhibiting bronchoconstriction |
| US4537903A (en) | 1983-10-12 | 1985-08-27 | Merck & Co., Inc. | Substituted cinnamyl-2,3-dihydrobenzofuran and analogs useful as anti-inflammatory agents |
| US4537981A (en) | 1981-11-09 | 1985-08-27 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane and 7-oxabicycloheptene compounds |
| US4539326A (en) | 1982-08-20 | 1985-09-03 | Takeda Chemical Industries, Ltd. | 5-Oxo-5H-(1)benzopyrano(2,3-b)pyridine derivatives, their production and use as anti-inflammatory agents |
| US4539312A (en) | 1984-07-11 | 1985-09-03 | E. R. Squibb & Sons, Inc. | Use of diamino ketones as analgesic agents |
| US4542155A (en) | 1984-04-02 | 1985-09-17 | E. R. Squibb & Sons, Inc. | Tetrahydrofuranyl substituted prostaglandin analogs |
| US4542151A (en) | 1984-12-17 | 1985-09-17 | E. R. Squibb & Sons, Inc. | Tetrahydrothienyl substituted ethers |
| US4542156A (en) | 1984-04-26 | 1985-09-17 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin alcohols and their use in the treatment of thrombolytic disease |
| US4542157A (en) | 1984-04-27 | 1985-09-17 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4542160A (en) | 1984-07-30 | 1985-09-17 | E. R. Squibb & Sons, Inc. | Method of use of bicycloheptane substituted prostaglandin analogs as cardiovascular agents |
| US4541956A (en) | 1983-07-28 | 1985-09-17 | Unique Technologies, Inc. | Tin steroids and their use as antineoplastic agents |
| US4544501A (en) | 1982-04-12 | 1985-10-01 | The Research Foundation Of State University Of New York | Bis(2,2-dimethyl-1-aziridinyl)phosphinic amides for use in the treatment of tumors |
| US4548938A (en) | 1981-07-15 | 1985-10-22 | Janssen Pharmaceutica N.V. | 5-H-1,3,4-thiadiazolo[3,2-a]pyrimidin-5-one compounds |
| US4550186A (en) | 1983-07-11 | 1985-10-29 | Duke University | Binuclear copper (II) carboxylates formed from amine-carboxyboranes |
| US4550187A (en) | 1984-04-12 | 1985-10-29 | The Research Foundation Of State University Of New York | Synthesis of platinum (IV) antineoplastic agents |
| US4550120A (en) | 1984-04-30 | 1985-10-29 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted ethers and their use in treating thrombolytic disease |
| US4552866A (en) | 1984-07-05 | 1985-11-12 | E. R. Squibb & Sons, Inc. | Use of diamino alcohols as analgesic agents |
| US4552882A (en) | 1983-07-06 | 1985-11-12 | Provesan, Sa | 7-(1-Pyrrolyl) derivatives of 1-ethyl-1,4-dihydro-4-oxoquinoline-3-carboxylic acids and 1-ethyl-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylic acids and their use as antimicrobial agents |
| US4555571A (en) | 1983-09-29 | 1985-11-26 | Ortho Pharmaceutical Corporation | Substituted 2(1H)-quinazolinone-1-alkanoic acids and esters |
| US4555570A (en) | 1983-09-29 | 1985-11-26 | Ortho Pharmaceutical Corporation | Substituted 4-alkyl-2-(1H) quinazolinone-1-alkanoic acid derivatives |
| US4555523A (en) | 1984-06-04 | 1985-11-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thio prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4556675A (en) | 1982-05-17 | 1985-12-03 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane and 7-oxabicycloheptene compounds |
| US4556669A (en) | 1981-04-10 | 1985-12-03 | Kumiai Kagaku Kogyo Kabushiki Kaisha | 2,-3-Di-substituted-5,6-dihydroimidazo [2,1-b] thiazole, its salts, production thereof and anti-inflammatory agent containing the same |
| US4556672A (en) | 1984-03-19 | 1985-12-03 | Pfizer Inc. | 3-Substituted 2-oxindole-1-carboxamides as analgesic and anti-inflammatory agents |
| US4556739A (en) | 1983-09-29 | 1985-12-03 | Ortho Pharmaceutical Corporation | 3,4-Dialkoxy-2-alkylcarbonyl analino compounds |
| US4558067A (en) | 1984-03-01 | 1985-12-10 | Merck & Co., Inc. | Phenylthiomethyl-6-hydroxy-2,3-dihydrobenzo-pyran and analogs thereof useful as anti-inflammatory agents |
| US4559348A (en) | 1983-03-09 | 1985-12-17 | Beecham Group, P.L.C. | 5- And/or 7-substituted pyrazolo-[4,3-b]-pyridines and their use as antiinflammatory agents |
| US4560698A (en) | 1984-06-04 | 1985-12-24 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thio prostaglandin analogs and their use in the treatment in thrombolytic disease |
| US4560684A (en) | 1982-12-21 | 1985-12-24 | Shionogi & Co., Ltd. | 1,4-Benzodiazepine derivatives |
| US4563476A (en) | 1983-11-21 | 1986-01-07 | Merck & Co., Inc. | Substituted 5-hydroxy-2,3-dihydrobenzofurans and analogs thereof useful as anti-inflammatory agents |
| US4567201A (en) | 1981-11-25 | 1986-01-28 | Takeda Chemical Industries, Ltd. | Diphenoxypropane derivatives and compositions of antiasthmatic and antiinflammatory agents thereof |
| US4568679A (en) | 1980-12-23 | 1986-02-04 | Merck & Co., Inc. | Aralkylaminoethanol heterocyclic compounds |
| US4568762A (en) | 1981-07-01 | 1986-02-04 | Hoffmann-La Roche Inc. | 4-Methyl-2-oxo-cyclopentylidene acetic acid and esters thereof |
| US4569942A (en) | 1984-05-04 | 1986-02-11 | Pfizer Inc. | N,3-Disubstituted 2-oxindole-1-carboxamides as analgesic and antiinflammatory agents |
| US4575512A (en) | 1984-11-01 | 1986-03-11 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their anti-thrombotic compositions and methods |
| US4578390A (en) | 1981-12-14 | 1986-03-25 | Merck & Co., Inc. | Hydroxybenzylamino derivatives as anti-inflammatory agents |
| US4579866A (en) | 1984-05-29 | 1986-04-01 | Usv Pharmaceutical Corp. | Phenylacetamides as anti-allergy, anti-asthma and anti-inflammatory agents |
| US4579867A (en) | 1984-04-09 | 1986-04-01 | American Hospital Supply Corporation | Stable pharmaceutical compositions of short-acting β-adrenergic receptor blocking agents |
| US4582854A (en) | 1983-03-14 | 1986-04-15 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted oxa prostaglandin analgos useful in the treatment of thrombolytic disease |
| US4585755A (en) | 1985-04-29 | 1986-04-29 | Merck & Co., Inc. | Cyclic and bridged cyclic somatostatin analogs useful as local anti-inflammatory agents |
| US4588743A (en) | 1985-01-22 | 1986-05-13 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane-substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4588742A (en) | 1985-02-20 | 1986-05-13 | E. R. Squibb & Sons, Inc. | Thiabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4588741A (en) | 1985-02-28 | 1986-05-13 | E. R. Squibb & Sons, Inc. | Platelet aggregation inhibiting and bronchoconstriction inhibiting thiabicycloheptane substituted amino prostaglandin analog derivatives, compositions, and method of use therefor |
| US4590180A (en) | 1980-05-21 | 1986-05-20 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Use of adenosine derivatives as psychopharmacological agents |
| US4591603A (en) | 1985-02-25 | 1986-05-27 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4593042A (en) | 1985-10-18 | 1986-06-03 | G. D. Searle & Co. | Bicyclo-substituted phenylacetonitrile derivatives |
| US4593029A (en) | 1984-02-15 | 1986-06-03 | Syntex (U.S.A.) Inc. | Novel ω-(N-imidazolyl)alkyl ethers of 1,2,3,5-tetrahydroimidazo[2,1-b]quinazolin-2-ones |
| US4594357A (en) | 1983-07-05 | 1986-06-10 | Troponwerke Gmbh & Co. | Depot antiinflammatory agents |
| US4594188A (en) | 1984-07-11 | 1986-06-10 | E. R. Squibb & Sons, Inc. | Use of diamino ketones as analgesic agents |
| US4595692A (en) | 1985-05-17 | 1986-06-17 | E. R. Squibb & Sons, Inc. | 7-thiabicycloheptane substituted ethers |
| US4595694A (en) | 1983-08-24 | 1986-06-17 | Kotobuki Seiyaku Co. Ltd. | Azulene derivatives, processes of their synthesis and their uses as anti-ulcerative and anti-inflammatory agents |
| US4595686A (en) | 1983-04-21 | 1986-06-17 | Hexachimie | Niflumic acid morpholinoethyl ester diniflumate, use as analgesic and anti-inflammatory agents and compositions |
| US4596828A (en) | 1985-03-28 | 1986-06-24 | Merck & Co., Inc. | [(2-hydroxy-5-alkoxyphenyl)methylthio]phenylmethanol and derivatives thereof useful as anti-inflammatory agents |
| US4599360A (en) | 1983-08-10 | 1986-07-08 | Sankyo Company Limited | Ophthalmic anti-inflammatory agents |
| US4599228A (en) | 1981-01-19 | 1986-07-08 | Vipont Laboratories, Inc. | Antimicrobial agent |
| US4607049A (en) | 1985-04-22 | 1986-08-19 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted thio prostaglandin analogs useful in the treatment of thrombolytic disease |
| US4607048A (en) | 1985-05-16 | 1986-08-19 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted aryl amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4608386A (en) | 1985-04-26 | 1986-08-26 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane ethers useful in the treatment of thrombotic diseases |
| US4608374A (en) | 1983-11-07 | 1986-08-26 | Hoechst-Roussel Pharmaceuticals Inc. | 11-substituted 5H,11H-pyrrolo[2,1-c][1,4]benzoxazepines as antipsychotic and analgesic agents |
| US4609671A (en) | 1985-06-27 | 1986-09-02 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted amino prostaglandin analogs useful in the treatment of thrombotic disease |
| US4611006A (en) | 1985-06-28 | 1986-09-09 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted ethers useful in the treatment of thrombotic disease |
| US4611007A (en) | 1985-04-22 | 1986-09-09 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4611066A (en) | 1984-08-10 | 1986-09-09 | Arizona State University | Bryostatins 4 to 8 |
| US4611005A (en) | 1985-05-21 | 1986-09-09 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4613600A (en) | 1983-09-30 | 1986-09-23 | Mead Johnson & Company | Antidepressant 1,2,4-triazolone compounds |
| US4614825A (en) | 1982-05-17 | 1986-09-30 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane and 7-oxabicycloheptene compounds |
| US4614741A (en) | 1983-07-05 | 1986-09-30 | Troponwerke Gmbh & Co., Kg | Depot antiinflammatory agents |
| US4617314A (en) | 1983-04-08 | 1986-10-14 | Yoshitomi Pharmaceutical Industries Ltd. | Benzofuran- and benzopyran-carboxamide derivatives |
| US4618685A (en) | 1985-12-18 | 1986-10-21 | Mccully Kilmer S | N-homocysteine thiolactonyl retinamide and use thereof as an antineoplastic agent |
| US4622326A (en) | 1985-12-23 | 1986-11-11 | Hoechst-Roussel Pharmaceuticals Inc. | 6H-isoxazolo(5,4-d)pyrazolo(3,4-b)pyridines, and their use as antihypertensive and analgesic agents |
| US4623648A (en) | 1981-09-25 | 1986-11-18 | Lacer, S.A. | 1-azaxanthone for use as therapeutic agent as an antipyretic, analgesic, anti-inflammatory and bronchodilator |
| US4626548A (en) | 1985-08-19 | 1986-12-02 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted prostaglandin compounds useful in the treatment of thrombotic disease |
| US4628095A (en) | 1985-06-05 | 1986-12-09 | G. D. Searle & Co. | Substituted N-benzyl-4-(benzhydryl) piperidines |
| US4631285A (en) | 1984-05-15 | 1986-12-23 | Schering Aktiengesellschaft | β-Carboline-3-carboxylic acid derivatives, and their use as psychotropic agents |
| US4631283A (en) | 1982-09-30 | 1986-12-23 | Ortho Pharmaceutical Corporation | Ortho substituted dihydroxy-2(1H)quinazolinone-1-alkanoic acids |
| US4632931A (en) | 1985-09-25 | 1986-12-30 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide-sulfonamide prostaglandin analogs useful in the treatment of thrombotic disease |
| US4632923A (en) | 1984-08-15 | 1986-12-30 | Schering Corporation | Substituted hetero spiro pyridine derivatives as anti-allergy and anti-inflammatory agents |
| US4634708A (en) | 1984-01-25 | 1987-01-06 | Sandoz Ltd. | Indolophenanthridines useful as dopaminergic and analgesic agents |
| US4638011A (en) | 1984-12-17 | 1987-01-20 | E. R. Squibb & Sons, Inc. | Tetrahydrothienyl substituted prostaglandin analogs |
| US4638012A (en) | 1985-11-05 | 1987-01-20 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane α-substituted ketone prostaglandin analogs useful in the treatment of thrombotic disease |
| US4639461A (en) | 1985-10-28 | 1987-01-27 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted keto-amide prostaglandin analogs useful in the treatment of thrombotic disease |
| US4644005A (en) | 1984-10-31 | 1987-02-17 | Pfizer Inc. | Oxindole antiinflammatory agents |
| US4645836A (en) | 1983-09-12 | 1987-02-24 | Ortho Pharmaceutical Corporation | Process for the preparation of 6,7-dihydroxy-4-alkyl-2(1H) quinazolinone-1-propionic acids |
| US4645773A (en) | 1984-05-15 | 1987-02-24 | Schering Aktiengesellschaft | β-carboline-3-oxadiazolyl derivatives, and their use as psychotropic agents |
| US4647565A (en) | 1984-06-07 | 1987-03-03 | Pfizer Inc. | 2-(2-quinazolinylaminoalkoxymethyl)-1,4-dihydropyridine derivatives as cardiovascular agents |
| US4647585A (en) | 1984-11-08 | 1987-03-03 | E. R. Squibb & Sons, Inc. | Bicycloheptane substituted ethers |
| US4647573A (en) | 1985-11-22 | 1987-03-03 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted thioamide-amide prostaglandin analogs |
| US4647561A (en) | 1985-08-05 | 1987-03-03 | E. R. Squibb & Sons, Inc. | 1,5-benzodiazepine compounds |
| US4649139A (en) | 1983-10-27 | 1987-03-10 | Burroughs Wellcome Co. | 1,2,4-triazines |
| US4650874A (en) | 1984-11-26 | 1987-03-17 | G. D. Searle & Co. | N-(aralkoxybenzyl)-4(benzhydryl) piperidines |
| US4650797A (en) | 1986-07-18 | 1987-03-17 | E. R. Squibb & Sons, Inc. | Substituted 1,5-benzodiazepine compounds |
| US4652576A (en) | 1985-10-18 | 1987-03-24 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide-carbamate prostaglandin analogs |
| US4652564A (en) | 1983-12-14 | 1987-03-24 | Schering Corporation | Substituted spiro pyridine derivatives as anti-allergy and antiinflammatory agents |
| US4652578A (en) | 1986-02-24 | 1987-03-24 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide prostaglandin analogs |
| US4654356A (en) | 1985-08-01 | 1987-03-31 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted diacid diamide prostaglandin analogs |
| US4654355A (en) | 1985-08-01 | 1987-03-31 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide-thioamide prostaglandin analogs |
| US4654357A (en) | 1985-08-09 | 1987-03-31 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted sulfonamide prostaglandin analogs |
| US4654335A (en) | 1985-07-11 | 1987-03-31 | E. R. Squibb & Sons, Inc. | Antihypertensive 1,5-benzothiazepine derivatives, compositions, and method of use therefor |
| US4656267A (en) | 1983-09-29 | 1987-04-07 | Ortho Pharmaceutical Corporation | Substituted 2(1H)-quinazolinone-1-alkanoic acids and esters |
| US4656185A (en) | 1985-12-05 | 1987-04-07 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted aminoalkyl amide prostaglandin analogs |
| US4658037A (en) | 1984-02-07 | 1987-04-14 | Pfizer Inc. | Intermediates for 1,3-disubstituted 2-oxindoles as analgesic and antiinflammatory agents |
| US4661506A (en) | 1984-11-30 | 1987-04-28 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted ox prostaglandin analogs |
| US4663336A (en) | 1985-07-01 | 1987-05-05 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted diamide and its congener prostaglandin analogs useful in the treatment of thrombotic disease |
| US4663337A (en) | 1986-04-18 | 1987-05-05 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amides useful in the treatment of thrombotic disease |
| US4667039A (en) | 1983-11-07 | 1987-05-19 | Hoechst-Roussel Pharmaceuticals Inc. | 11-substituted 5H,11H-pyrrolo(2,1-C) (1,4)benzoxazepines as antipsychotic and analgesic agents |
| US4668787A (en) | 1985-12-20 | 1987-05-26 | Ortho Pharmaceutical Corporation | 5,6-dialkoxy-4-imino-2(1H)quinazolinone derivatives |
| US4670453A (en) | 1986-05-08 | 1987-06-02 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amido-carbamoyl prostaglandin analogs useful in the treatment of thrombotic disease |
| US4670541A (en) | 1984-07-05 | 1987-06-02 | E. R. Squibb & Sons, Inc. | Use of diamino alcohols as analgesic agents |
| US4670560A (en) | 1986-04-28 | 1987-06-02 | Ortho Pharmaceutical Corporation | Thienopyrimidine-2,4-dione derivatives and intermediates thereof |
| US4678802A (en) | 1985-07-09 | 1987-07-07 | Pfizer Inc. | 1-acylcarbamoyloxindole-3-carboxamides as antiinflammatory agents |
| US4680298A (en) | 1983-05-31 | 1987-07-14 | Schering Corporation | Tricyclic anti-allergy and use as anti-inflammatory agents |
| US4681879A (en) | 1983-11-07 | 1987-07-21 | Hoechst-Roussel Pharmaceuticals Inc. | 11-substituted 5H,11H-pyrrolo[2,1-c][1,4]benzoxazepines as antipsychotic and analgesic agents |
| US4681882A (en) | 1984-10-19 | 1987-07-21 | Godecke Aktiengesellschaft | 4-alkoxy-pyrido[2,3-d]pyrimidine derivatives |
| US4684747A (en) | 1984-12-20 | 1987-08-04 | Yale University | N,N'-bis(sulfonyl)hydrazines having antineoplastic activity |
| US4686224A (en) | 1984-10-31 | 1987-08-11 | Pfizer Inc. | Oxindole antiinflammatory agents |
| US4686235A (en) | 1983-10-12 | 1987-08-11 | Merck & Co., Inc. | Substituted cinnamyl-2,3-dihydrobenzofuran and analogs useful as anti-inflammatory agents |
| US4686221A (en) | 1985-10-01 | 1987-08-11 | Kanebo, Ltd. | Quinolinecarboxylic acid compounds and antimicrobial agent containing the same |
| US4690930A (en) | 1984-11-05 | 1987-09-01 | Shionogi & Co., Ltd | Pyrazolo[4,3-c]quinoline-3-one and imidazo[4,3-c]cinnolin-3-one derivatives and their use as psychotropic agents |
| US4695571A (en) | 1984-08-24 | 1987-09-22 | Pfizer Inc. | Tricyclic oxindole antiinflammatory agents |
| US4703120A (en) | 1986-04-28 | 1987-10-27 | Ortho Pharmaceutical Corporation | Furo(3,4-d)pyrimidine-2,4-dione derivatives and intermediates thereof |
| US4704382A (en) | 1985-07-29 | 1987-11-03 | G. D. Searle & Co. | Phenylpiperazine phosphonates |
| US4707550A (en) | 1986-04-28 | 1987-11-17 | Ortho Pharmaceutical Corporation | N-(substituted thienyl)-N'-(substituted piperazinyl)-ureas |
| US4708966A (en) | 1986-06-27 | 1987-11-24 | The Procter & Gamble Company | Novel anti-inflammatory agents, pharmaceutical compositions and methods for reducing inflammation |
| US4710508A (en) | 1986-12-08 | 1987-12-01 | Warner-Lambert Company | O-substituted tetrahydropyridine oxime cholinergic agents |
| US4713393A (en) | 1985-04-25 | 1987-12-15 | Merck & Co., Inc. | Phenylpropyl-2,3-dihydrobenzofurans useful as anti-inflammatory agents |
| US4719231A (en) | 1984-05-25 | 1988-01-12 | Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai | 3-[N-(mercaptoacyl)]amino-4-arylbutanoic acid derivatives and an analgesic agent comprising the same |
| US4720484A (en) | 1985-01-07 | 1988-01-19 | Adir S.A.R.L. | Peptide compounds having a nitrogenous polycyclic structure |
| US4721796A (en) | 1983-08-05 | 1988-01-26 | Hayward Lloyl D | Nitrates of D-isoidide |
| US4721712A (en) | 1984-06-12 | 1988-01-26 | Pfizer Inc. | 1,3-disubstituted 2-oxindoles as analgesic and anti-inflammatory agents |
| US4722899A (en) | 1980-04-11 | 1988-02-02 | Toshiyuki Hamaoka | Producing highly specific, low cross-reactive antibody by immunizing with copolymer of D-glutamic acid and lysine |
| US4727072A (en) | 1986-02-12 | 1988-02-23 | Mcneilab, Inc. | 3-alkoxy-2-aminopropylamines compositions and use as cardiovascular agents |
| US4730052A (en) | 1984-07-13 | 1988-03-08 | Taisho Pharmaceutical Co., Ltd. | Method for preparing unsymmetrical 1,4-dihydropyridine-3,5-dicarboxylic acid diesters |
| US4734424A (en) | 1986-09-24 | 1988-03-29 | E. R. Squibb & Sons, Inc. | Bicycloheptane substituted diamide and its congener prostaglandin analogs |
| US4734425A (en) | 1986-10-17 | 1988-03-29 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted hydroxamic acid prostaglandin analogs |
| US4734426A (en) | 1986-09-24 | 1988-03-29 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted diamide prostaglandin analogs |
| US4735962A (en) | 1986-10-06 | 1988-04-05 | E. R. Squibb & Sons, Inc. | 7-thiabicycloheptane substituted diamide and its congener prostaglandin analogs |
| US4737493A (en) | 1985-07-01 | 1988-04-12 | Warner-Lambert Company | 7-((substituted)amino)-8-((substituted)carbonyl)-methylamino)-1-oxaspiro(4,5)decanes as analgesic agents |
| US4738978A (en) | 1986-11-10 | 1988-04-19 | E. R. Squibb & Sons, Inc. | Bisthioamide-7-oxabicycloheptane prostaglandin analogs |
| US4745123A (en) | 1986-02-18 | 1988-05-17 | Warner-Lambert Company | Substituted tetrahydro-3-pyridine-carboxylic acid, ester, and amide cholinergic agents |
| US4746504A (en) | 1986-03-14 | 1988-05-24 | Bio-Technology General Corp. | Heavy metal salts of hyaluronic acid and their use as antimicrobial agents |
| US4748153A (en) | 1985-04-29 | 1988-05-31 | Merck & Co., Inc. | Compounds having somatostatin-like activity useful as local anti-inflammatory agents |
| US4748018A (en) | 1984-02-07 | 1988-05-31 | Stolle Research & Development Corp. | Method of passive immunization of mammals using avian antibody |
| US4749792A (en) | 1984-09-26 | 1988-06-07 | E. R. Squibb & Sons, Inc. | Diamino ketones and alcohols as analgesic agents |
| US4749715A (en) | 1987-03-02 | 1988-06-07 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amino prostaglandin analogs |
| US4752616A (en) | 1987-06-29 | 1988-06-21 | E. R. Squibb & Sons, Inc. | Arylthioalkylphenyl carboxylic acids, compositions containing same and method of use |
| US4753951A (en) | 1985-10-18 | 1988-06-28 | Shionogi & Co., Ltd. | Condensed imidazopyridine derivatives useful as psychotropic agents |
| US4753946A (en) | 1987-04-08 | 1988-06-28 | E. R. Squibb & Sons, Inc. | Pyrimidinecarboxylic acid derivatives |
| US4760051A (en) | 1985-01-24 | 1988-07-26 | Pickart Loren R | Use of GHL-Cu as a wound-healing and anti-inflammatory agent |
| US4764525A (en) | 1987-02-25 | 1988-08-16 | Warner-Lambert Company | N-1H-tetrazol-5-ylbenzamides having use as antiallergy and antiinflammatory agents |
| US4767776A (en) | 1987-02-20 | 1988-08-30 | Warner-Lambert Company | N-1H-tetrazol-5-yl-2-naphthalene carboxamides and their use as antiallergy and antiinflammatory agents |
| US4767756A (en) | 1987-07-17 | 1988-08-30 | E. R. Squibb & Sons, Inc. | 3-substituted benzazepines |
| US4769371A (en) | 1987-05-01 | 1988-09-06 | E. R. Squibb & Sons, Inc. | Dihydropyrimidine carboxylic acid esters |
| US4771047A (en) | 1987-07-27 | 1988-09-13 | E. R. Squibb & Sons, Inc. | Benzazepine derivatives |
| US4772703A (en) | 1986-01-27 | 1988-09-20 | American Home Products Corporation | 2-(phenoxymethyl)-quinazolines as antiallergic and antiinflammatory agents |
| US4774239A (en) | 1987-08-26 | 1988-09-27 | E. R. Squibb & Sons, Inc. | Benzazepine derivatives |
| US4774256A (en) | 1983-10-03 | 1988-09-27 | E. R. Squibb & Sons, Inc. | Use of enkephalinase inhibitors as analgesic agents |
| US4775679A (en) | 1985-04-25 | 1988-10-04 | Merck & Co., Inc. | Certain heterocyclic-ethyl-2,3-dihydrobenzofurans useful as anti-inflammatory agents |
| US4775757A (en) | 1986-09-22 | 1988-10-04 | Ortho Pharmaceutical Corporation | Thienopyridines useful as cardiovascular agents |
| US4778818A (en) | 1983-10-12 | 1988-10-18 | Merck & Co., Inc. | Substituted 2-(heteroaryl-2-propenyl)phenols useful as anti-inflammatory agents |
| US4778800A (en) | 1985-11-13 | 1988-10-18 | Schering Aktiengesellschaft | 3-oxadiazole and 3-carboxylic acid beta-carboline derivatives, and their use as psychotropic agents |
| US4780538A (en) | 1986-02-12 | 1988-10-25 | Merck & Co., Inc. | Process for 1,4-dihydropyridine compounds using a titanamine catalyst |
| US4782071A (en) | 1986-11-03 | 1988-11-01 | Warner-Lambert Company | Tetrasubstituted urea cholinergic agents |
| US4785085A (en) | 1986-11-21 | 1988-11-15 | Bristol-Myers Company | Rebeccamycin analogs |
| US4784991A (en) | 1986-03-14 | 1988-11-15 | Bio-Technology General Corp. | Heavy metal salts of hyaluronic acid and their use as antimicrobial agents |
| US4786648A (en) | 1986-12-08 | 1988-11-22 | Warner-Lambert Company | O-substituted tetrahydropyridine oxime cholinergic agents |
| US4788188A (en) | 1985-05-06 | 1988-11-29 | Sanofi (S.A.) | Quinolylglycinamide derivatives, the process for preparation thereof and their therapeutic application as psychotropic drugs |
| US4788205A (en) | 1986-08-29 | 1988-11-29 | Pfizer Inc. | Dihydropyridine anti-allergic and antiinflammatory agents |
| US4791129A (en) | 1987-01-20 | 1988-12-13 | Pfizer Inc. | 1,3-dicarboxamidooxindoles as analgesic and antiinflammatory agents |
| US4794110A (en) | 1987-07-20 | 1988-12-27 | Hoechst-Roussel Pharmaceuticals, Inc. | 5-Aryl-11-substituted-5H,11H-pyrrolo[2,1-c][1,4]benzoxazepined as analgesic and hypotensive agents |
| US4798841A (en) | 1987-03-31 | 1989-01-17 | Warner-Lambert Company | Tetrahydropyridine oxime cholinergic agents and method of treatment |
| US4801598A (en) | 1986-11-07 | 1989-01-31 | Pfizer Inc. | Dihydropyridine anti-allergic and anti-inflammatory agents |
| US4803216A (en) | 1986-05-07 | 1989-02-07 | Fisons Plc | Pyrazole-3-amines as anti-inflammatory agents |
| US4810692A (en) | 1986-05-22 | 1989-03-07 | Rhone-Poulenc Sante | Immunosuppressant substances, process for their preparation and pharmaceutical compositions containing them |
| US4824955A (en) | 1985-11-15 | 1989-04-25 | Nippon Kayaku Kabushiki Kaisha | Selenium oxy chloride-pyridine or bipyridine complexes |
| US4824831A (en) | 1987-12-21 | 1989-04-25 | E. R. Squibb & Sons, Inc. | 4,5-dihydro-1H-benzazepine-3-carboxylic acid esters which are useful as anti-hypertensive agents |
| US4826990A (en) | 1987-09-30 | 1989-05-02 | American Home Products Corporation | 2-aryl substituted heterocyclic compounds as antiallergic and antiinflammatory agents |
| US4829086A (en) | 1984-03-14 | 1989-05-09 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US4833145A (en) | 1986-06-30 | 1989-05-23 | The Trustees Of Princeton University | 4(3H)-oxo-5,6,7,8-tetrahydropyrido[2,3-d]pyrimidine derivatives |
| US4835157A (en) | 1988-03-15 | 1989-05-30 | Ortho Pharmaceutical Corporation | Thieno- and furopyrimidine-2,4-dione piperidine derivatives as serotonin antagonists and alpha adrenergic blocking agents |
| US4835166A (en) | 1986-06-09 | 1989-05-30 | Pfizer Inc. | Antiallergy and antiinflammatory agents |
| US4844907A (en) | 1985-08-28 | 1989-07-04 | Euroceltique, S.A. | Pharmaceutical composition comprising analgesic and anti-inflammatory agent |
| US4845216A (en) | 1985-03-08 | 1989-07-04 | The Trustees Of Princeton University | Pyrido [2,3,d]pyrimidine derivatives |
| US4845242A (en) | 1987-04-28 | 1989-07-04 | Georgia Tech Research Corporation | Isocoumarins with basic substituents as serine proteases inhibitors, anticoagulants and anti-inflammatory agents |
| US4847379A (en) | 1987-11-30 | 1989-07-11 | E. R. Squibb & Sons, Inc. | 3,6-dihydro-1,5(2H)-pyrimidinecarboxylic acid esters |
| US4847290A (en) | 1987-08-17 | 1989-07-11 | Sumner Burstein | Delta 1-thc-7-oic acid and analgesic and anti-inflammatory agents |
| US4847303A (en) | 1987-11-23 | 1989-07-11 | The Procter & Gamble Company | Tert-butylphenyl compounds useful as anti-inflammatory agents |
| US4849563A (en) | 1986-01-21 | 1989-07-18 | Yale University | Novel 1-alkyl-1-arenesulfonyl-2-alkoxycarbonylsulfenylhydrazines having antineoplastic activity |
| US4851412A (en) | 1987-05-30 | 1989-07-25 | Pfizer Inc. | Dihydropyridine antiallergic and antiinflammatory agents |
| US4853392A (en) | 1987-07-17 | 1989-08-01 | Pfizer Inc. | Fused 1,4-dihydropyridines as antiallergy and antiinflammatory agents |
| US4853391A (en) | 1984-06-30 | 1989-08-01 | Guy Nadler | Pyrido[1,2-a]indoles and their use as cardiovascular |
| US4855318A (en) | 1985-03-21 | 1989-08-08 | Bayer Aktiengesellschaft | Iodopropargyl ethers useful as antimicrobial agents |
| US4857644A (en) | 1988-06-09 | 1989-08-15 | American Home Products Corporation | Aryl sulfonopiperazines as anti-inflammatory agents |
| US4859686A (en) | 1988-02-19 | 1989-08-22 | Pfizer Inc. | Dihydropyridine anti-allergic and anti-inflammatory agents |
| US4863955A (en) | 1985-06-06 | 1989-09-05 | Eli Lilly And Company | Scytophycins |
| US4870210A (en) | 1987-12-18 | 1989-09-26 | American Home Products Corporation | Aminoguanidine derivative as anti-inflammatory agents |
| US4870093A (en) | 1980-05-16 | 1989-09-26 | Bayer Aktiengesellschaft | Antimicrobial agents and their use |
| US4871746A (en) | 1988-05-31 | 1989-10-03 | The Trustees Of Princeton University | N-[N-(tetrahydropyrido[2,3-D]pyrimidinylmethyl)-aminomethylbenzoyl]glutamic acid derivatives as neoplastic growth inhibitors |
| US4874760A (en) | 1987-01-09 | 1989-10-17 | Toa Eiyo, Ltd. | 4,7-dihydroisothiazolo(5,4-b)pyridine derivatives and cardiovascular treating agents containing said derivatives |
| US4877619A (en) | 1986-08-25 | 1989-10-31 | Vestar, Inc. | Liposomal vesicles for intraperitoneal administration of therapeutic agents |
| US4882334A (en) | 1988-05-25 | 1989-11-21 | The Trustees Of Princeton University | N-(5,6,7,8-tetrahydropyrido]2,3-d]pyrimidin-6-ylethl-thineyl-and furylcarbonyl)-glutamic acid derivatives |
| US4882333A (en) | 1988-05-25 | 1989-11-21 | The Trustess Of Princeton University | N-(5,6,7,8-tetrahydropyrido[2,3-d]pyrimidin-6-yl-alkanoyl)-glutamic acid derivatives |
| US4883811A (en) | 1988-11-17 | 1989-11-28 | Misra Raj N | 7-Oxabicycloheptane imino interphenylene substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4883872A (en) | 1987-11-25 | 1989-11-28 | E. R. Squibb & Sons, Inc. | 3-oxo-1,2,4-triazolo(4,3-A) pyrimidine-6-carboxylic acid esters |
| US4886790A (en) | 1982-04-12 | 1989-12-12 | The Research Foundation Of State University Of New York | Novel bis(2,2-dimethyl-1-aziridinyl) phosphinic amides for use in the treatment of tumors |
| US4888434A (en) | 1987-05-26 | 1989-12-19 | Dow Corning K.K. | Antimicrobial agent |
| US4888335A (en) | 1988-07-25 | 1989-12-19 | Mcneilab, Inc. | 3-alkoxy-2-aminopropyl heterocyclic amines and their use as cardiovascular agents |
| US4889866A (en) | 1987-06-11 | 1989-12-26 | Syntex (U.S.A.) Inc. | Arylsulfonyl dihydropyridine derivatives |
| US4889859A (en) | 1988-02-05 | 1989-12-26 | The Trustees Of Princeton University | Pyrido[2,3-d]pyrimidine derivatives |
| US4891370A (en) | 1981-12-14 | 1990-01-02 | Merck & Co., Inc. | Cephalosporin derivatives as anti-inflammatory agents |
| US4892887A (en) | 1984-12-20 | 1990-01-09 | Yale University | N,N'-bis(sulfonyl)hydrazines having antineoplastic activity |
| US4895953A (en) | 1987-09-30 | 1990-01-23 | American Home Products Corporation | 2-Aryl substituted heterocyclic compounds as antiallergic and antiinflammatory agents |
| US4897397A (en) | 1988-12-16 | 1990-01-30 | Schering Corporation | Aryl-alkynoic, alkenoic or alkanoic compounds and compositions useful as antiallergy and anti-inflammatory agents |
| US4900748A (en) | 1988-03-04 | 1990-02-13 | The United States Of America As Represented By The Department Of Health And Human Services | Carbamates related to (-)-physostigmine as cholinergic agents |
| US4904663A (en) | 1987-07-15 | 1990-02-27 | Shionogi & Co., Ltd. | N-(2-oxpyrrolidin-1-yl-)acetyl)piperazine derivatives and drug for senile dementia |
| US4904674A (en) | 1989-08-16 | 1990-02-27 | Hoechst-Roussel Pharmaceuticals Inc. | 1-(Benzo[b]thienyl)-2-(thienyl)ethenes and related compounds useful as anti-inflammatory agents |
| US4904786A (en) | 1986-01-27 | 1990-02-27 | American Home Products Corporation | Quinoline compounds as antiallergic and antiinflammatory agents |
| US4904671A (en) | 1988-02-25 | 1990-02-27 | Pfizer Inc. | Dihydropyridine antiallergic and antiinflammatory agents |
| US4906634A (en) | 1988-03-08 | 1990-03-06 | Schering A.G. | Novel N-[4-(aminosubstituted)phenyl]methanesulfonamides and their use as cardiovascular agents |
| US4906655A (en) | 1989-01-24 | 1990-03-06 | Warner-Lambert Company | Novel 1,2-cyclohexylaminoaryl amides useful as analgesic agents |
| US4910192A (en) | 1987-12-04 | 1990-03-20 | Sri International | Topically active steroidal anti-inflammatory agents |
| US4912248A (en) | 1987-05-18 | 1990-03-27 | The Procter & Gamble Company | Novel anti-inflammatory agents, pharmaceutical compositions and methods for reducing inflammation |
| US4916156A (en) | 1987-04-10 | 1990-04-10 | Sanofi | Aromatic derivatives, their preparation and their use as antimicrobial agents |
| US4927828A (en) | 1985-03-08 | 1990-05-22 | The Trustees Of Princeton University | Diastereoisomeric tetrahydropyrido-(2,3,d) pyrimidine derivatives |
| US4927835A (en) | 1988-03-04 | 1990-05-22 | Nippon Shinyaku Co., Ltd. | Acylphenol derivatives, useful as anti-inflammatory agents and pain suppressants |
| US4931457A (en) | 1989-06-28 | 1990-06-05 | Hoechst-Roussel Pharmaceuticals Inc. | Naphthylamino-and naphthyloxy-pyridinamine comounds useful as topical antiinflammatory agents for the treatment of skin disorders |
| US4939137A (en) | 1989-06-28 | 1990-07-03 | Ortho Pharmaceutical Corporation | Ring-fused thienopyrimidinedione derivatives |
| US4942236A (en) | 1987-09-30 | 1990-07-17 | American Home Products Corporation | 2-aryl substituted pyridyl-containing phenyl sulfonamido compounds as antiallergic and antiinflammatory agents |
| US4945099A (en) | 1987-01-12 | 1990-07-31 | Eli Lilly And Company | Anti-inflammatory agents |
| US4952692A (en) | 1989-04-04 | 1990-08-28 | E. R. Squibb & Sons, Inc. | Benzazepine derivatives |
| US4954519A (en) | 1987-04-28 | 1990-09-04 | Georgia Tech Research Corporation | Isocoumarins with basic substituents as serine proteases inhibitors, anticoagulants and anti-inflammatory agents |
| US4954526A (en) | 1989-02-28 | 1990-09-04 | The United States Of America As Represented By The Department Of Health And Human Services | Stabilized nitric oxide - primary amine complexes useful as cardiovascular agents |
| US4959378A (en) | 1989-10-24 | 1990-09-25 | Hoechst-Roussel Pharmaceuticals Inc. | Aminopyridinylaminophenol compounds useful as topical antiinflammatory agents for the treatment of skin disorders |
| US4959383A (en) | 1988-10-31 | 1990-09-25 | E. R. Squibb & Sons, Inc. | Phenylsulfone alkenoic acids, derivatives thereof, compositions containing same and method of use |
| US4962119A (en) | 1989-06-09 | 1990-10-09 | Warner-Lambert Company | Triazole derivatives of fenamates as antiinflammatory agents |
| US4962114A (en) | 1986-01-21 | 1990-10-09 | Yale University | 1-alkyl-1-sulfonyl-2-alkoxycarbonylsulfenylhydrazines having antineoplastic activity |
| US4966967A (en) | 1989-09-15 | 1990-10-30 | Berlex Laboratories, Inc. | 3,4,5,6-tetrahydro-2H-1,7,4-benzodioxazonines as cardiovascular agents |
| US4968800A (en) | 1988-02-04 | 1990-11-06 | Kanebo Limited | Novel platinum complex, antineoplastic agent containing the same, and intermediate therefor |
| US4970226A (en) | 1989-10-03 | 1990-11-13 | Harbor Branch Oceanographic Institution, Inc. | Bis-indole imidazole compounds which are useful antitumor and antimicrobial agents |
| US4970318A (en) | 1988-05-24 | 1990-11-13 | Pfizer Inc. | Aromatic and heterocyclic carboxamide derivatives as antineoplastic agents |
| US4971984A (en) | 1986-12-11 | 1990-11-20 | Beehringer Biochemia Robin S.P.A. | 2-methylthiomethyl-dihydropyridines and pharmaceutical compositions containing them |
| US4977144A (en) | 1988-08-02 | 1990-12-11 | Ciba-Geigy Corporation | Imidazo[4,5-b]pyridine derivatives as cardiovascular agents |
| US4977167A (en) | 1987-08-19 | 1990-12-11 | Shionogi & Co., Ltd. | Carbamoylpyrolidone derivatives and drugs for senile dementia |
| US4980365A (en) | 1987-07-13 | 1990-12-25 | Hoechst-Roussel Pharmaceuticals Inc. | N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents |
| US4981843A (en) | 1988-04-07 | 1991-01-01 | E. R. Squibb & Sons, Inc. | N-heterocyclic alcohol derivatives |
| US4981792A (en) | 1988-06-29 | 1991-01-01 | Merck & Co., Inc. | Immunosuppressant compound |
| US4981865A (en) | 1989-05-26 | 1991-01-01 | Warner-Lambert Co. | N-hydroxyamide, N-hydroxythioamide, hydroxyurea, and N-hydroxythiourea derivatives of selected nsaids as antiinflammatory agents |
| US4988710A (en) | 1989-08-25 | 1991-01-29 | Washington University | Aryl-cycloalkyl-alkanolamines for treatment of cholinergic neurotoxins |
| US4988733A (en) | 1987-07-15 | 1991-01-29 | Burroughs Wellcome Co. | N-[1-(3-phenoxyphenyl)ethyl]acetohydroxamic acid compounds which are useful anti-inflammatory agents |
| US4988728A (en) | 1989-11-03 | 1991-01-29 | Alcon Laboratories, Inc. | Suprofen esters and amides as ophthalmic anti-inflammatory agents |
| US4992448A (en) | 1989-10-24 | 1991-02-12 | Hoechst-Roussel Pharmaceuticals Inc. | Benzocycloalkylaminopyridinamines and related compounds as topical antiinflammatory agents for the treatment of skin disorders |
| US4994450A (en) | 1988-02-12 | 1991-02-19 | Dr. Lo. Zambeletti S.P.A. | Azacyclic compounds and their use as analgesic agents |
| US4996206A (en) | 1989-12-11 | 1991-02-26 | The Trustees Of Princeton University | N-(pyrrolo[2,3-d]pyrimidin-3-ylacyl)-glutamic acid derivatives |
| US4996229A (en) | 1985-06-06 | 1991-02-26 | University Of Hawaii | Scytophycins |
| US4998931A (en) | 1985-07-05 | 1991-03-12 | Puget Sound Blood Center | Method of reducing immunogenicity and inducing immunologic tolerance |
| US5002955A (en) | 1987-04-23 | 1991-03-26 | Hoechst-Roussel Pharmaceuticals Inc. | Fused heteroalkylene quinolinamines and use as cholinergic agents |
| US5006542A (en) | 1988-10-31 | 1991-04-09 | E. R. Squibb & Sons, Inc. | Arylthioalkylphenyl carboxylic acids, derivatives thereof, compositions containing same and method of use |
| US5008264A (en) | 1987-07-13 | 1991-04-16 | Hoechst-Roussel Pharmaceuticals Inc. | N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents |
| US5010109A (en) | 1988-06-30 | 1991-04-23 | Chisso Corporation | Antimicrobial agent composition |
| US5011931A (en) | 1987-11-18 | 1991-04-30 | The Boots Company Plc | Process for the preparation of 1-methyl-3-methylthio-4-quinolone and the sulfinyl, and sulfonyl analogs thereof |
| US5013850A (en) | 1990-03-30 | 1991-05-07 | Allergan, Inc. | 4-ethyl and 4-ethenyl-5-hydroxy-2(5H)-furanones substituted on alpha carbon of the ethyl or ethenyl side chain with a long chain alkyl group and on the beta carbon with a polar group, as anti-inflammatory agents |
| US5013736A (en) | 1988-12-27 | 1991-05-07 | Kaken Pharmaceutical Co., Ltd. | Azaazulene compounds which are useful as antiallergic and antiinflammatory agents |
| US5013751A (en) | 1989-01-10 | 1991-05-07 | Alcon Laboratories, Inc. | (+) Suprofen esters and amides as opthalmic anti-inflammatory agents |
| US5017618A (en) | 1987-03-16 | 1991-05-21 | University Of Florida | Labile derivatives of ketone analogs of 3-substituted-1-alkylamino-2-propanols and their use as beta-adrenergic blockers |
| US5017578A (en) | 1989-06-09 | 1991-05-21 | Hoechst-Roussel Pharmaceuticals Inc. | N-heteroaryl-purin-6-amines useful as analgesic and anticonvulsant agents |
| US5019390A (en) | 1987-05-29 | 1991-05-28 | Research Corporation Technologies, Inc. | Anticancer agent--IMIC |
| US5026712A (en) | 1985-06-05 | 1991-06-25 | Schering Ag | Novel imidazo[1,5-a]pyridines, useful as cardiovascular and CNS agents |
| US5030639A (en) | 1987-07-13 | 1991-07-09 | Hoechst-Roussel Pharmaceuticals Inc. | N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents |
| US5036088A (en) | 1986-06-09 | 1991-07-30 | Pfizer Inc. | Antiallergy and antiinflammatory agents, compositions and use |
| US5036070A (en) | 1990-06-13 | 1991-07-30 | American Home Products Corporation | Polycyclic phenalkyl amines as psychotropic agents |
| US5036065A (en) | 1988-10-20 | 1991-07-30 | Taiho Pharmaceutical Company, Limited | Benzothiadiazepine derivatives |
| US5036077A (en) | 1987-09-17 | 1991-07-30 | Sanofi | 1-(benzylpiperidino)propan-2-ol derivatives, their preparation, their use as antimicrobial agents and the products in which they are present |
| US5037835A (en) | 1989-10-24 | 1991-08-06 | Hoechst-Roussel Pharmaceuticals Inc. | Benzocycloalkylaminopyridinamines and related compounds as topical antiinflammatory agents for the treatment of skin disorders |
| US5037809A (en) | 1987-07-10 | 1991-08-06 | Fujisawa Pharmaceutical Co., Ltd. | Antimicrobial agent, FR109615 and production thereof |
| US5037811A (en) | 1990-04-17 | 1991-08-06 | Allergan, Inc. | 4-(oxygen, sulfur or nitrogen substituted)-methyl 5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5043457A (en) | 1990-04-17 | 1991-08-27 | Allergan, Inc. | 2(5H)-furanones substituted in the 3 position, as Ca2+ channel antagonists and anti-inflammatory agents |
| US5049387A (en) | 1987-03-09 | 1991-09-17 | Alza Corporation | Inducing skin tolerance to a sensitizing drug |
| US5051423A (en) | 1988-07-13 | 1991-09-24 | Schering Ag | Derivatized alkanolamines as cardiovascular agents |
| US5055290A (en) | 1985-12-18 | 1991-10-08 | Boehringer Mannehim Gmbh | Ciamexone as a selective immunosuppressant |
| US5055466A (en) | 1987-11-23 | 1991-10-08 | E. R. Squibb & Sons, Inc. | N-morpholino derivatives and their use as anti-hypertensive agents |
| US5059602A (en) | 1990-08-27 | 1991-10-22 | Hoechst-Roussel Pharmaceuticals Inc. | 4-substituted dihydropyrido(4,3-d)pyrimidines as analgesics and topical antiinflammatory agents for the treatment of skin disorders |
| US5061728A (en) | 1989-03-07 | 1991-10-29 | Pfizer Inc. | Use of 4-phenyl-1,2,3,4-tetrahydro-1-naphthalenamine derivatives in the treatment of inflammation and as immunosuppressants |
| US5061702A (en) | 1988-09-02 | 1991-10-29 | Meiji Seika Kabushiki Kaisha | Cephem compound as an antimicrobial agent |
| US5061813A (en) | 1990-04-02 | 1991-10-29 | E. R. Squibb & Sons, Inc. | Substituted cyanoimino benzopyranes |
| US5064835A (en) | 1990-03-01 | 1991-11-12 | Merck & Co., Inc. | Hydroxymacrolide derivatives having immunosuppressive activity |
| US5066493A (en) | 1978-11-03 | 1991-11-19 | American Home Products Corporation | Rapamycin in treatment of tumors |
| US5066668A (en) | 1989-06-09 | 1991-11-19 | Warner-Lambert Co. | Triazole derivatives of fenamates as antiinflammatory agents |
| US5068323A (en) | 1989-04-21 | 1991-11-26 | Merck & Co., Inc. | Thermally re-arranged FK-506 derivatives having immunosuppressant activity |
| US5068247A (en) | 1989-07-07 | 1991-11-26 | Yoshitomi Pharmaceutical Industries, Ltd. | 2-aminopentanoic acid compounds and their use as immunosuppressants |
| US5070099A (en) | 1988-10-31 | 1991-12-03 | E. R. Squibb & Sons, Inc. | Arylthioalkylphenyl carboxylic acids, derivatives thereof, compositions containing same method of use |
| US5071848A (en) | 1989-10-23 | 1991-12-10 | Abbott Laboratories | Tricyclic quinoline antineoplastic agents |
| US5073560A (en) | 1990-07-20 | 1991-12-17 | Fisons Corporation | Spiro-isoxazolidine derivatives as cholinergic agents |
| US5073570A (en) | 1988-09-14 | 1991-12-17 | Lonza Inc. | Mono-iodopropargyl esters of dicarboxylic anhydrides and their use as antimicrobial agents |
| US5075330A (en) | 1989-05-26 | 1991-12-24 | Warner-Lambert Co. | N-hydroxyamide, N-hydroxythioamide, N-hydroxyurea, and N-hydroxythiourea derivatives of selected NSAIDS as antiinflammatory agents |
| US5077404A (en) | 1989-08-29 | 1991-12-31 | Piper James R | Cyclized 5,10-dideazaaminopterin compounds |
| US5079247A (en) | 1990-03-14 | 1992-01-07 | American Cyanamid Company | N1 -substituted benz(cd)indol-2-imine compounds as cardiovascular agents |
| US5081261A (en) | 1990-03-23 | 1992-01-14 | Allergan, Inc. | 4-(1-hydroxy-2-N-substituted sulfonamido) ethyl-5-hydroxy-2(5H)-furanones and 4-(N-substituted sulfonamido)-2-ethenyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5081147A (en) | 1990-03-15 | 1992-01-14 | Allergan, Inc. | 4-(1-hydroxy-2-substituted amino)ethyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5081126A (en) | 1987-05-19 | 1992-01-14 | Fujisawa Pharmaceutical Co., Ltd. | Quinolyl- and isoquinolyl-methoxyphenyl-dithioacetyl derivatives useful as antiinflammatory agents |
| US5084281A (en) | 1989-02-14 | 1992-01-28 | Dillon Richard S | Method and solution for treating tissue wounds |
| US5086064A (en) | 1990-03-27 | 1992-02-04 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl thiazolyl, oxazolyl, and imidazolyl methanones and related compounds as antiinflammatory agents |
| US5091389A (en) | 1991-04-23 | 1992-02-25 | Merck & Co., Inc. | Lipophilic macrolide useful as an immunosuppressant |
| US5091528A (en) | 1990-09-12 | 1992-02-25 | Allergan, Inc. | 6- or 7- (2-imino-2-imidazolidine)-1,4-benzoxazines as α adrenergic agents |
| US5093342A (en) | 1989-02-09 | 1992-03-03 | Aktiebolaget Hassle | Use of omeprazole as an antimicrobial agent |
| US5093338A (en) | 1991-04-23 | 1992-03-03 | Merck & Co., Inc. | Lipophilic macrolide useful as an immunosuppressant |
| US5095037A (en) | 1989-12-21 | 1992-03-10 | Nissho Corporation | Combined anti-inflammatory agent |
| US5095019A (en) | 1990-08-27 | 1992-03-10 | Hoechst-Roussel Pharmaceuticals Inc. | 4-substituted dihydropyrido(4,3-D)pyrimidines as analgesics and topical antiinflammatory agents for the treatment of skin disorders |
| US5096700A (en) | 1990-09-28 | 1992-03-17 | The Procter & Gamble Company | Halogenated aminohexanoates and aminobutyrates antimicrobial agents |
| US5098613A (en) | 1987-01-12 | 1992-03-24 | Eli Lilly And Company | Anti-inflammatory agents |
| US5101072A (en) | 1989-09-06 | 1992-03-31 | Yale University | Sulfonylhydrazines and their use as antineoplastic agents and as antitrypanosomal agents |
| US5104656A (en) | 1989-06-16 | 1992-04-14 | Seth Pyare L | Percutaneous treatment with a high potency non-steroidal anti-inflammatory agent |
| US5106996A (en) | 1985-12-05 | 1992-04-21 | Bristol-Myers Company | Process for the preparation of podophyllotoxin |
| US5109024A (en) | 1987-02-03 | 1992-04-28 | Merrell Dow Pharmaceuticals Inc. | Polyamine derivatives as antineoplastic agents |
| US5112846A (en) | 1989-05-26 | 1992-05-12 | Warner-Lambert Company | N-hydroxyamide, N-hydroxythioamide, hydroxyurea, and N-hydroxythiourea derivatives of selected nsaids as antiinflammatory agents |
| US5114958A (en) | 1991-05-09 | 1992-05-19 | Warner-Lambert Company | 1,2,4-oxadiazole and 1,2,4-thiadiazole derivatives of fenamates as antiinflammatory agents |
| US5116867A (en) | 1989-06-30 | 1992-05-26 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | D-propranolol as a selective adenosine antagonist |
| US5116861A (en) | 1989-08-07 | 1992-05-26 | Takeda Chemical Industries, Ltd. | Nitrosothiol derivatives and their use |
| US5118509A (en) | 1987-03-09 | 1992-06-02 | Alza Corporation | Inducing skin tolerance to a sensitizing drug |
| US5124455A (en) | 1990-08-08 | 1992-06-23 | American Home Products Corporation | Oxime-carbamates and oxime-carbonates as bronchodilators and anti-inflammatory agents |
| US5124347A (en) | 1991-07-31 | 1992-06-23 | Warner-Lambert Co. | 3-5-ditertiarybutylphenyl-4-hydroxymethylidene derivatives of 1,3-dihydro-2H-indole-2-ones as antiinflammatory agents |
| US5128349A (en) | 1989-10-30 | 1992-07-07 | Laboratoire L. Lafon | 1-(4-aminophenyl)-2-piperidinopropanone derivatives, preparation process and use in therapeutics |
| US5135926A (en) | 1984-03-14 | 1992-08-04 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US5138051A (en) | 1991-08-07 | 1992-08-11 | American Home Products Corporation | Rapamycin analogs as immunosuppressants and antifungals |
| US5140031A (en) | 1989-05-31 | 1992-08-18 | E. R. Squibb & Sons, Inc. | Pyranyl cyanoguanidine derivatives |
| US5143918A (en) | 1990-10-11 | 1992-09-01 | Merck & Co., Inc. | Halomacrolides and derivatives having immunosuppressive activity |
| US5143927A (en) | 1991-05-09 | 1992-09-01 | Warner-Lambert Company | 3-(thiazolidone, oxazolidinone, imidazolidinone)-indoles as antiinflammatory agents |
| US5143928A (en) | 1990-03-27 | 1992-09-01 | Warner-Lambert Company | 3,5-di-tertiarybutyl-4-hydroxyphenylmethylene derivatives of 2-substituted thiazolidinones, oxazolidinones, and imidazolidinones as antiinflammatory agents |
| US5143929A (en) | 1991-05-09 | 1992-09-01 | Warner-Lambert Company | 2-substituted thiazolidinone, oxazolidinone, and imidazolidinone derivatives of fenamates as antiinflammatory agents |
| US5147877A (en) | 1991-04-18 | 1992-09-15 | Merck & Co. Inc. | Semi-synthetic immunosuppressive macrolides |
| US5149701A (en) | 1991-08-01 | 1992-09-22 | Merck & Co., Inc. | C-31 methylated FR-900520 cyclic hemiketal immunosuppressant agents |
| US5151413A (en) | 1991-11-06 | 1992-09-29 | American Home Products Corporation | Rapamycin acetals as immunosuppressant and antifungal agents |
| US5152980A (en) | 1988-05-19 | 1992-10-06 | The Beth Israel Hospital Association | Induction of tolerance to a foreign antigen IL-2 receptor-binding substances |
| US5155122A (en) | 1988-11-29 | 1992-10-13 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxy-phenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents |
| US5157051A (en) | 1992-03-05 | 1992-10-20 | The Dow Chemical Company | Composition and use of 3-thiocyano-2-halo-2-propenenitriles as antimicrobial agents |
| US5162334A (en) | 1991-05-13 | 1992-11-10 | Merck & Co., Inc. | Amino O-alkyl, O-alkenyl and O-alkynlmacrolides having immunosuppressive activity |
| US5169851A (en) | 1991-08-07 | 1992-12-08 | American Home Products Corporation | Rapamycin analog as immunosuppressants and antifungals |
| US5169963A (en) | 1991-08-30 | 1992-12-08 | Allergan, Inc. | Di-(5-hydroxy-2(5H)2-oxo-4-furyl)alkylmethyl-alpha,omega alkanedioates and N,N-bis-(5-hydroxy-2(5H)2-oxo-4-furyl)alkylmethyl-alpha,omega-dialkanoic acid amides as anti-inflammatory agents |
| US5171864A (en) | 1991-08-30 | 1992-12-15 | Allergan, Inc. | Di-(5-hydroxy-2(5H)-2-oxo-4-furyl)methyl-alpha,omega alkane-dioates and N,N-bis-(5-hydroxy-2(5H)-2-oxo-4-furyl)methyl-alpha,omega-dialkanoic acid amides as anti-inflammatory agents |
| US5175160A (en) | 1988-08-09 | 1992-12-29 | Daiichi Pharmaceutical Co., Ltd. | Antimicrobial agent for animals |
| US5177079A (en) | 1991-01-31 | 1993-01-05 | Warner-Lambert Company | 2-substituted-4,6-di-tertiarybutyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5183906A (en) | 1991-04-30 | 1993-02-02 | Allergan, Inc. | 2- and 5-alkyl and phenyl substituted 4-(1-hydroxy, 1-acyloxy or 1-carbamoyloxy)-5-hydroxy-2 (5h)-furanones as anti-inflammatory agents |
| US5185326A (en) | 1990-06-14 | 1993-02-09 | Bayer Aktiengesellschaft | Efomycins a, e and g as antiinflammatory agents |
| US5185362A (en) | 1988-09-14 | 1993-02-09 | Mcneilab, Inc. | Diphenylamine cardiovascular agents, compositions and use |
| US5187175A (en) | 1992-03-06 | 1993-02-16 | Warner-Lambert Company | 2-carbonyl substituted-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents |
| US5189042A (en) | 1991-08-22 | 1993-02-23 | Merck & Co. Inc. | Fluoromacrolides having immunosuppressive activity |
| US5189036A (en) | 1990-06-20 | 1993-02-23 | Schering Ag | Imidazolylbenzoyl substituted heterocycles |
| US5190961A (en) | 1990-08-03 | 1993-03-02 | Terumo Kabushiki Kaisha | Thiourea derivatives and antimicrobial agent and antulcer agent containing the same |
| US5191084A (en) | 1991-05-01 | 1993-03-02 | American Home Products Corporation | Phenyl pyrazolidinones as bronchodilators and anti-inflammatory agents |
| US5192799A (en) | 1987-12-11 | 1993-03-09 | Mitsui Petrochemical Industries, Ltd. | Coumaran group containing amine compounds and their acid addition salts and quaternary ammonium salts and the use thereof as anti arrhythmic agents and as psychotropic agents |
| US5192773A (en) | 1990-07-02 | 1993-03-09 | Vertex Pharmaceuticals, Inc. | Immunosuppressive compounds |
| US5196424A (en) | 1992-03-24 | 1993-03-23 | Eli Lilly And Company | N-[2-amino-4-substituted[[(pyrrollo or pyrido)[2,3-d]pyrimidinyl]-alkyl]benzoyl]-L-glutamic acids |
| US5196441A (en) | 1990-10-20 | 1993-03-23 | Bayer Aktiengesellschaft | Compounds useful as antimicrobial agents |
| US5196431A (en) | 1992-02-24 | 1993-03-23 | Warner-Lambert Company | 2-substituted amino-4, 6-di-tertiary-buthyl-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents |
| US5198449A (en) | 1990-04-27 | 1993-03-30 | A. H. Robins Company Incorporated | N-substituted alpha-arylazacycloalkylmethanamines and their use as cardiovascular agents |
| US5202347A (en) | 1984-03-14 | 1993-04-13 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US5202330A (en) | 1985-06-03 | 1993-04-13 | E. R. Squibb & Sons, Inc. | 2-thio or oxo-4-aryl or heterocyclo-1,5(2H)-pyrimidinedicarboxylic acid diesters and 3-acyl-5-pyrimidinecarboxylic acids and esters |
| US5202350A (en) | 1991-08-29 | 1993-04-13 | Bristol-Myers Squibb Co. | Furanone anti-inflammatory agents |
| US5202332A (en) | 1991-08-07 | 1993-04-13 | American Home Products Corporation | Rapamycin analog as immunosuppressant |
| US5204365A (en) | 1990-05-25 | 1993-04-20 | Sociedad Espanola De Especialidades Farmaco-Terapeuticas S.A. | Substituted diphenylmethane derivatives as analgesic or anti-inflammatory agents |
| US5208245A (en) | 1990-05-07 | 1993-05-04 | Wakunaga Seiyaku Kabushiki Kaisha | Dihydropyridine derivative |
| US5208228A (en) | 1989-11-13 | 1993-05-04 | Merck & Co., Inc. | Aminomacrolides and derivatives having immunosuppressive activity |
| US5208241A (en) | 1991-09-09 | 1993-05-04 | Merck & Co., Inc. | N-heteroaryl, n-alkylheteroaryl, n-alkenylheteroaryl and n-alkynylheteroarylmacrolides having immunosuppressive activity |
| US5208250A (en) | 1988-05-25 | 1993-05-04 | Warner-Lambert Company | Known and selected novel arylmethylenyl derivatives of thiazolidinones, imidazolidinones and oxazolidinones useful as antiallergy agents and anti-inflammatory agents |
| US5209930A (en) | 1990-12-10 | 1993-05-11 | Rohm And Haas Company | Preparation and use of n-iodopropargyl oxycarbonyl amino acid esters and derivatives as antimicrobial agents |
| US5212189A (en) | 1991-12-17 | 1993-05-18 | Warner-Lambert Company | Thiadiazole or oxadiazole analogs of fenamic acids containing substituted hydroxamate side chains as antiinflammatory agents |
| US5212172A (en) | 1990-03-15 | 1993-05-18 | Allergan, Inc. | 4-(1-hydroxy-2-substituted amino)ethyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5214068A (en) | 1989-09-06 | 1993-05-25 | Yale University | Sulfonylhydrazines and their use as antineoplastic agents and as antitrypanosomal agents |
| US5216165A (en) | 1990-10-03 | 1993-06-01 | American Home Products Corporation | N-substituted aminoquinolines as analgesic agents |
| US5217958A (en) | 1988-03-03 | 1993-06-08 | E. R. Squibb & Sons, Inc. | 1,2-hydroxy phosphonates and derivatives thereof |
| US5219873A (en) | 1987-04-24 | 1993-06-15 | Roussel Uclaf | Compounds of 1,2,5,6-tetrahydropyridine which are useful as cholinergic agents |
| US5220025A (en) | 1992-02-24 | 1993-06-15 | Warner-Lambert Company | 2-substituted amino-4, 6-di-tertiary-butyl-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents |
| US5219884A (en) | 1988-09-14 | 1993-06-15 | Taito Co., Ltd. | Immunosuppressant |
| US5219872A (en) | 1986-02-27 | 1993-06-15 | Roussel Uclaf | Compounds of 1,2,5,6-tetrahydropyridin-3-carboxaldehyde oxime which are useful as cholinergic agents |
| US5223503A (en) | 1991-04-29 | 1993-06-29 | Eli Lilly And Company | 6-substituted pyrido[2,3-d]pyrimidines as antineoplastic agents |
| US5223516A (en) | 1990-03-22 | 1993-06-29 | E. R. Squibb & Sons, Inc. | 3,3,3-trifluoro-2-mercaptomethyl-N-tetrazolyl substituted propanamides and method of using same |
| US5225418A (en) | 1991-12-17 | 1993-07-06 | Du Pont Merck Pharmaceutical Company | 5H-(1,2)benzisothiazolo[2,3-a]quinoline-5-ones and analogs as antiinflammatory agents |
| US5225571A (en) | 1991-04-30 | 1993-07-06 | Allergan, Inc. | Substituted dihydroxy-bis-[5-hydroxy-2(5H)-furanone-4-yl]-alkanes as anti-inflammatory agents |
| US5232939A (en) | 1988-07-26 | 1993-08-03 | Sankyo Company Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US5234939A (en) | 1990-03-27 | 1993-08-10 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl imidazolyl methanones and related compounds as antiinflammatory agents |
| US5234937A (en) | 1990-03-27 | 1993-08-10 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxphenyl oxazolyl methanones and related compounds as antiinflammatory agents |
| US5238689A (en) | 1992-01-07 | 1993-08-24 | Procept, Inc. | Use of ruthenium red as immunosuppressive agents |
| US5240929A (en) | 1992-08-03 | 1993-08-31 | Warner-Lambert Company | 2-heterocyclic-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5244917A (en) | 1992-06-02 | 1993-09-14 | The Dupont Merck Pharmaceutical Company | Substituted naphthofurans as anti-inflammatory agents |
| US5244896A (en) | 1990-09-14 | 1993-09-14 | Marion Merrell Dow Inc. | Carbocyclic adenosine analogs useful as immunosuppressants |
| US5247076A (en) | 1991-09-09 | 1993-09-21 | Merck & Co., Inc. | Imidazolidyl macrolides having immunosuppressive activity |
| US5248682A (en) | 1991-01-31 | 1993-09-28 | Warner-Lambert Company | 2-substituted-4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5250700A (en) | 1991-05-01 | 1993-10-05 | American Home Products Corporation | Phenyl pyrazolidinones as bronchodilators and anti-inflammatory agents |
| US5250552A (en) | 1991-05-09 | 1993-10-05 | Warner-Lambert Company | 3-[thiazolidinone, oxazolidinone, imidazolidinone]-indoles as antiinflammatory agents |
| US5250678A (en) | 1991-05-13 | 1993-10-05 | Merck & Co., Inc. | O-aryl, O-alkyl, O-alkenyl and O-alkynylmacrolides having immunosuppressive activity |
| US5252732A (en) | 1991-09-09 | 1993-10-12 | Merck & Co., Inc. | D-heteroaryl, O-alkylheteroaryl, O-alkenylheteroaryl and O-alkynylheteroarylmacrolides having immunosuppressive activity |
| US5252745A (en) | 1989-08-25 | 1993-10-12 | Rohm And Haas Company | Preparation and use of iodopropargyl esters of α-amino acid derivatives as antimicrobial agents |
| US5254685A (en) | 1990-08-09 | 1993-10-19 | Wakunaga Seiyaku Kabushiki Kaisha | Tricyclic compound or salts thereof, method for producing the same and antimicrobial agent containing the same |
| US5256680A (en) | 1988-11-29 | 1993-10-26 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxy-phenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents |
| US5256416A (en) | 1989-07-28 | 1993-10-26 | Merck Patent Gmbh | Extracts of the Acanthospermum hispidum plant |
| US5256664A (en) | 1992-04-28 | 1993-10-26 | Bristol-Myers Squibb Company | Antidepressant 3-halophenylpiperazinylpropyl derivatives of substituted triazolones and triazoldiones |
| US5260300A (en) | 1992-11-19 | 1993-11-09 | American Home Products Corporation | Rapamycin carbonate esters as immuno-suppressant agents |
| US5260444A (en) | 1990-05-07 | 1993-11-09 | Wakunaga Seiyaku Kabushiki Kaisha | Dihydropyridine derivative |
| US5262533A (en) | 1991-05-13 | 1993-11-16 | Merck & Co., Inc. | Amino O-aryl macrolides having immunosuppressive activity |
| US5266562A (en) | 1987-11-19 | 1993-11-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Anti-inflammatory agents |
| US5266567A (en) | 1991-10-24 | 1993-11-30 | Rohm And Haas Company | Halopropargylated cyclic quaternary ammonium compounds as antimicrobial agents |
| US5270319A (en) | 1991-09-09 | 1993-12-14 | Warner-Lambert Company | 5-hydroxy-2-pyrimidinylmethylene derivatives useful as antiinflammatory agents |
| US5273979A (en) | 1991-08-01 | 1993-12-28 | Merck & Co., Inc. | C-31 desmethyl FR-900520 cyclic hemiketal immunosuppressant agent |
| US5280045A (en) | 1991-10-16 | 1994-01-18 | The Procter & Gamble Company | 4(3,5-bis(1,1-dimethylethyl-4-hydroxyphenyl)-4-oxobutanamide compound useful as an anti-inflammatory agent |
| US5284840A (en) | 1992-06-12 | 1994-02-08 | Merck & Co., Inc. | Alkylidene macrolides having immunosuppressive activity |
| US5284877A (en) | 1992-06-12 | 1994-02-08 | Merck & Co., Inc. | Alkyl and alkenyl macrolides having immunosuppressive activity |
| US5288693A (en) | 1993-06-25 | 1994-02-22 | Rohm And Haas Company | 2-(3-oxoalk(en)yl)-3-isothiazolones and derivatives as antimicrobial agents |
| US5290772A (en) | 1988-06-29 | 1994-03-01 | Merck & Co., Inc. | Immunosuppressant agent |
| US5290783A (en) | 1990-03-16 | 1994-03-01 | Beth Israel Hospital Association | Use of spiperone derivatives as immunosuppressant agents |
| US5290788A (en) | 1990-10-03 | 1994-03-01 | Pfizer Inc. | Indole derivatives as antiallergy and antiinflammatory agents |
| US5292736A (en) | 1993-02-26 | 1994-03-08 | Sterling Winthrop Inc. | Morpholinoalkylindenes as antiglaucoma agents |
| US5298633A (en) | 1987-06-08 | 1994-03-29 | Allergan, Inc. | Intermediates and processes for preparing 4-substituted 2-5(H)-furanones as anti-inflammatory agents |
| US5298498A (en) | 1990-12-07 | 1994-03-29 | The Upjohn Company | Phosphonic acid derivatives useful as anti-inflammatory agents |
| US5298522A (en) | 1993-01-22 | 1994-03-29 | Pfizer Inc. | 6-chloro-5-fluoro-3-(2-thenoyl)-2-oxindole-1-carboxamide as an analgesic and anti-inflammatory agent while maintaining a normal urine protein/creatinine ratio |
| US5302592A (en) | 1990-08-17 | 1994-04-12 | Rohm And Haas Company | Use of substituted 3-thioacryloyl compounds as antimicrobial agents |
| US5308837A (en) | 1990-08-22 | 1994-05-03 | Merrell Dow Pharmaceuticals Inc. | 5'-amine substituted adenosine analogs as immunosuppressants |
| US5310731A (en) | 1984-06-28 | 1994-05-10 | Whitby Research, Inc. | N-6 substituted-5'-(N-substitutedcarboxamido)adenosines as cardiac vasodilators and antihypertensive agents |
| US5319099A (en) | 1991-01-21 | 1994-06-07 | Shionogi Seiyaku Kabushiki Kaisha | 3-benzylidene-1-carbamoyl-2-pyrrolidone compounds useful as antiinflammatory agents |
| US5318978A (en) | 1991-10-15 | 1994-06-07 | Warner-Lambert Company | Azabicyclo oxime and amine cholinergic agents and methods of treatment |
| US5318965A (en) | 1990-08-24 | 1994-06-07 | Abbott Laboratories | Quinobenzoxazine, antineoplastic agents |
| US5318971A (en) | 1989-11-13 | 1994-06-07 | Schering Corporation | 3-Substituted-1-aryl-2(1H)-quinolones useful as anti-allergy and anti-inflammatory agents |
| US5324648A (en) | 1987-04-28 | 1994-06-28 | Georgia Tech Research Corporation | Substituted isocoumarins as serine protease inhibitors and anti-inflammatory agents |
| US5332737A (en) | 1989-12-05 | 1994-07-26 | Imperial Chemical Industries Plc | Amino-1,3,5-triazines and their anhydrobase derivatives as agents for cardiovascular system |
| US5334601A (en) | 1984-03-14 | 1994-08-02 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US5338753A (en) | 1992-07-14 | 1994-08-16 | Sumner H. Burstein | (3R,4R)-Δ6 -tetrahydrocannabinol-7-oic acids useful as antiinflammatory agents and analgesics |
| US5346913A (en) | 1992-05-26 | 1994-09-13 | Rohm And Haas Company | N-iodopropargyl hydantoin compounds, compositions, preparation, and use as antimicrobial agents |
| US5347029A (en) | 1991-06-19 | 1994-09-13 | The Upjohn Company | Dialkyl (dialkoxyphosphinyl)methyl phosphates as anti-inflammatory agents |
| US5346911A (en) | 1990-03-06 | 1994-09-13 | Warner-Lambert Company | Azabicyclo and azacyclo oxime and amine cholinergic agents and methods of treatment |
| US5354768A (en) | 1988-07-26 | 1994-10-11 | Sankyo Company, Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US5356803A (en) | 1989-10-27 | 1994-10-18 | Genencor International, Inc. | Antimicrobial composition containing Type II endoglycosidase and antimicrobial agent |
| US5358952A (en) | 1990-03-13 | 1994-10-25 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | O6 -substituted guanine compounds and methods for depleting O6 -alkylguanine-DNA alkyltransferase levels |
| US5359066A (en) | 1991-02-28 | 1994-10-25 | Wakunaga Pharmaceutical Co., Ltd. | Certain tricyclic pyrido[3,2,1-ij]cinnoline-8-carboxylates, useful as antimicrobial agents |
| US5360811A (en) | 1990-03-13 | 1994-11-01 | Hoechst-Roussel Pharmaceuticals Incorporated | 1-alkyl-, 1-alkenyl-, and 1-alkynylaryl-2-amino-1,3-propanediols and related compounds as anti-inflammatory agents |
| US5362902A (en) | 1989-11-23 | 1994-11-08 | Pfizer Inc. | N-(1-(2-carboxyethyl35cloalkylcarbonyl)-beta-alanine derivatives for pharmaceutical use |
| US5378723A (en) | 1991-09-26 | 1995-01-03 | The United States Of America As Represented By The Secretary Of The Dept. Of Health And Human Services | Carbamate analogs of thiaphysovenine and method for inhibiting cholinesterases |
| US5380738A (en) | 1993-05-21 | 1995-01-10 | Monsanto Company | 2-substituted oxazoles further substituted by 4-fluorophenyl and 4-methylsulfonylphenyl as antiinflammatory agents |
| US5385902A (en) | 1993-09-01 | 1995-01-31 | Rohm And Haas Company | Iodopropargylated oxalic derivatives as antimicrobial agents |
| US5385918A (en) | 1993-02-09 | 1995-01-31 | Miles Inc. | Aminomethylene-peptides as immunosuppressants |
| US5387586A (en) | 1993-03-05 | 1995-02-07 | Adir Et Compagnie | (Aryl(alkyl)carbonyl)-heterocyclic compounds, compositions and use |
| US5387593A (en) | 1991-12-13 | 1995-02-07 | Briston-Myers Squibb | Piperazinyl-and piperidinyl-cyclohexanols |
| US5389675A (en) | 1992-03-27 | 1995-02-14 | The United States Of America As Represented By The Department Of Health And Human Services | Mixed ligand metal complexes of nitric oxide-nucleophile adducts useful as cardiovascular agents |
| US5391544A (en) | 1993-03-04 | 1995-02-21 | Kagome Kabushiki Kaisha | Cyathane derivatives and antimicrobial agents containing same |
| US5393771A (en) | 1993-05-12 | 1995-02-28 | Brisol-Myers Squibb Company | 4-substituted benzopyran and related compounds |
| US5399553A (en) | 1990-08-09 | 1995-03-21 | Wakunaga Seiyaku Kabushiki Kaisha | Tricyclic compound or salts thereof, method for producing the same and anti-microbial agent containing the same |
| US5401758A (en) | 1993-10-07 | 1995-03-28 | Bristol-Myers Squibb Company | Pyridinyl cyanoguanidine compounds |
| US5409893A (en) | 1989-05-05 | 1995-04-25 | Boehringer Mannheim Italia, S.P.A. | Ruthenium(III) complexes as antineoplastic agents |
| US5424396A (en) | 1991-04-24 | 1995-06-13 | Morinaga Milk Industry Co., Ltd. | Antimicrobial peptide and antimicrobial agent |
| US5424301A (en) | 1993-02-01 | 1995-06-13 | Warner-Lambert Company | Starch stabilized o-substituted tetrahydropyridine oxime cholinergic agents |
| US5428016A (en) | 1991-03-13 | 1995-06-27 | Morinaga Milk Industry Co., Ltd. | Antimicrobial peptide and antimicrobial agent |
| US5432181A (en) | 1991-01-31 | 1995-07-11 | Warner-Lambert Company | Substituted heteroaryl analogs of 4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5431896A (en) | 1989-03-15 | 1995-07-11 | Merck & Co., Inc. | Microbial immunoregulant |
| US5432183A (en) | 1991-05-31 | 1995-07-11 | Pfizer Inc. | Use of rapamycin prodrugs as immunosuppressant agents |
| US5436265A (en) | 1993-11-12 | 1995-07-25 | Merck Frosst Canada, Inc. | 1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents |
| US5438064A (en) | 1991-12-23 | 1995-08-01 | American Home Products Corporation | Derivatives of 4-anilinoquinoline-3-carboxamide as analgesic agents |
| US5444043A (en) | 1994-02-18 | 1995-08-22 | The Regents Of The University Of California | Cyclic heptapeptide anti-inflammatory agent |
| US5451686A (en) | 1994-04-15 | 1995-09-19 | Allergan, Inc. | 3 and 5 alkyl and phenyl 4-(hydroxy or acyloxy)-alkyl substituted 2(5H)-furanones as anti-inflammatory agents |
| WO1995025536A1 (en) | 1994-03-21 | 1995-09-28 | Washington University | Methods and compositions for inhibition of hepatic clearance of tissue factor pathway inhibitor |
| US5455230A (en) | 1993-02-23 | 1995-10-03 | Aktiebolaget Astra | Delta opioid receptor antagonists and their use as analgesic agents |
| US5457118A (en) | 1991-04-04 | 1995-10-10 | Pfizer Inc. | Pyridine derived agents for cardiovascular diseases |
| US5459151A (en) | 1993-04-30 | 1995-10-17 | American Home Products Corporation | N-acyl substituted phenyl piperidines as bronchodilators and antiinflammatory agents |
| US5461062A (en) | 1992-02-12 | 1995-10-24 | Shionogi & Co., Ltd. | Condensed imidazopyridine derivatives |
| US5463181A (en) | 1993-02-23 | 1995-10-31 | Merrell Dow Pharmaceuticals Inc. | Farnesyl: protein transferase inhibitors as anticancer agents |
| US5462952A (en) | 1989-06-09 | 1995-10-31 | Warner-Lambert Company | Fenamate 1,3,4-thiadiazoles and 1,3,4-oxadiazoles as antiinflammatory agents |
| US5464856A (en) | 1988-05-25 | 1995-11-07 | Warner-Lambert Company | Arylmethylenyl derivatives of imidazolidinones useful as antiinflammatory agents |
| US5464849A (en) | 1991-01-09 | 1995-11-07 | Pfizer Inc. | N-hydroxyurea derivatives as antiallergy and antiinflammatory agents |
| US5464615A (en) | 1988-08-31 | 1995-11-07 | Behringwerke Aktiengesellschaft | Use of transglutaminases as immunosuppressants |
| US5468729A (en) | 1993-10-26 | 1995-11-21 | Alpha 1 Biomedicals | Method for treatment of autoimmune hepatitis |
| US5470857A (en) | 1990-09-14 | 1995-11-28 | Marion Merrell Dow Inc. | Carbocyclic nucleoside analogs useful as immunosuppressants |
| US5470885A (en) | 1993-09-29 | 1995-11-28 | The Research Foundation Of The State University Of New York | Fluorocarbons as anti-inflammatory agents |
| US5470842A (en) | 1990-07-30 | 1995-11-28 | Glycomed, Incorporated | Carbohydrate-based anti-inflammatory agents |
| US5472973A (en) | 1991-12-12 | 1995-12-05 | Scios Nova Inc. | Fluorenyl derivatives as anti-inflammatory agents |
| US5476876A (en) | 1994-05-24 | 1995-12-19 | The Procter & Gamble Company | Di-tert-butylphenol compounds useful as anti-inflammatory agents |
| US5482938A (en) | 1990-03-06 | 1996-01-09 | Warner-Lambert Company | Azabicyclo and azacyclo oxime and amine cholinergic agents and methods of treatment |
| US5482925A (en) | 1994-03-17 | 1996-01-09 | Comedicus Incorporated | Complexes of nitric oxide with cardiovascular amines as dual acting cardiovascular agents |
| US5484788A (en) | 1993-03-26 | 1996-01-16 | Beth Israel Hospital Association | Buspirone as a systemic immunosuppressant |
| US5494895A (en) | 1993-07-22 | 1996-02-27 | Merck & Co., Inc. | Scorpion peptide margatoxin with immunosuppressant activity |
| US5498405A (en) | 1994-08-29 | 1996-03-12 | The Regents Of The University Of California | Indole alkaloids useful as UV protective and anti-inflammatory agents |
| US5500417A (en) | 1992-09-23 | 1996-03-19 | The Upjohn Company | Arylmethylphosphonates and phosphonic acids useful as anti-inflammatory agents |
| US5506228A (en) | 1995-02-23 | 1996-04-09 | Merck & Co., Inc. | 2,6-diaryl pyridazinones with immunosuppressant activity |
| US5506233A (en) | 1992-03-02 | 1996-04-09 | Pfizer Inc. | Desosamino derivatives of macrolides as immunosuppressants and antifungal agents |
| US5508277A (en) | 1992-12-11 | 1996-04-16 | Adir Et Compagnie | Bicyclic pyrimidines |
| US5508417A (en) | 1994-02-23 | 1996-04-16 | Rohm And Haas Company | Broad-spectrum isothiazole antimicrobial agents |
| US5510361A (en) | 1994-10-20 | 1996-04-23 | The Procter & Gamble Company | Di-tert-butylphenol compounds with heterocyclic moiety, useful as anti-inflammatory agents |
| US5510376A (en) | 1993-01-29 | 1996-04-23 | American Cyanamid Company | Aminocycloalkanobenzodioxoles as beta-3 selective adrenergic agents |
| US5512687A (en) | 1994-10-28 | 1996-04-30 | Procept, Inc. | Compounds for inhibiting immune response |
| US5512678A (en) | 1993-09-14 | 1996-04-30 | Merrell Pharmaceuticals Inc. | 5-(1-fluoro-vinyl)-1H-pyrimidine-2,4-dione derivatives useful as antineoplastic agents |
| US5514688A (en) | 1990-09-14 | 1996-05-07 | Merrell Dow Pharmaceuticals Inc. | Carbocyclic adenosine analogs useful as immunosuppressants |
| US5516764A (en) | 1991-03-07 | 1996-05-14 | Mect Corporation | Anti-inflammatory agent |
| US5525633A (en) | 1993-09-24 | 1996-06-11 | Merrell Dow Pharmaceuticals Inc. | Triaryl-ethylene derivatives |
| US5525606A (en) | 1994-08-01 | 1996-06-11 | The United States Of America As Represented By The Department Of Health And Human Services | Substituted 06-benzylguanines and 6(4)-benzyloxypyrimidines |
| US5527820A (en) | 1992-06-23 | 1996-06-18 | Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai | Antibiotics having immunosuppressive activity, delaminomycins and processes for the production of the same |
| US5530026A (en) | 1993-03-03 | 1996-06-25 | Universite Laval | Certain aryl-ureido anti-cancer agents |
| US5532248A (en) | 1991-05-13 | 1996-07-02 | Merck Co., Inc. | O-aryl,O-alkyl, and O-alkenyl-macrolides having immunosuppressive activity |
| US5534508A (en) | 1993-07-29 | 1996-07-09 | Katayama Seiyakusyo Co., Ltd. | Cephem compounds and antimicrobial agents |
| US5534546A (en) | 1993-03-31 | 1996-07-09 | Kagome Kabushiki Kaisha | Indene derivatives and antimicrobial agents containing same |
| US5540931A (en) | 1989-03-03 | 1996-07-30 | Charles W. Hewitt | Methods for inducing site-specific immunosuppression and compositions of site specific immunosuppressants |
| US5541233A (en) | 1992-12-01 | 1996-07-30 | Minnesota Mining And Manufacturing Company | Durable anti-microbial agent |
| US5545734A (en) | 1994-10-25 | 1996-08-13 | Merck & Co., Inc. | Aryl and heteroaryl macrolides having immunosuppressive activity |
| US5547966A (en) | 1993-10-07 | 1996-08-20 | Bristol-Myers Squibb Company | Aryl urea and related compounds |
| US5550233A (en) | 1994-06-21 | 1996-08-27 | Merck & Co., Inc. | Aryl, alkyl, alkenyl and alkynylmacrolides having immunosuppressive activity |
| US5552424A (en) | 1992-11-20 | 1996-09-03 | Pfizer Inc. | Isoxazolines as antiinflammatory agents |
| US5552422A (en) | 1995-01-11 | 1996-09-03 | Merck Frosst Canada, Inc. | Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents |
| US5552397A (en) | 1992-05-18 | 1996-09-03 | E. R. Squibb & Sons, Inc. | Substituted azepinone dual inhibitors of angiotensin converting enzyme and neutral exdopeptidase |
| US5552411A (en) | 1995-05-26 | 1996-09-03 | Warner-Lambert Company | Sulfonylquinolines as central nervous system and cardiovascular agents |
| US5554789A (en) | 1992-11-10 | 1996-09-10 | Laboratorios Menarini S.A. | Arylpropionic derivative, a process for the preparation and the use thereof as an analgesic agent |
| US5554373A (en) | 1993-11-05 | 1996-09-10 | Seabrook; Samuel G. | Compositions containing anti-microbial agents and methods for making and using same |
| US5574041A (en) | 1990-03-16 | 1996-11-12 | Beth Israel Hospital Association | Use of spiperone derivatives as immunosuppressant agents |
| US5576341A (en) | 1993-04-16 | 1996-11-19 | Nippon Chemiphar Co., Ltd. | 2-[[2-(N-isobutyl-N-methyl)amino]benzylsulfinyl]-benzimidazole as antimicrobial agent |
| US5580888A (en) | 1992-12-23 | 1996-12-03 | Celltech Therapeutics Limited | Styryl derivatives as anti-inflammatory agents |
| US5580892A (en) | 1993-10-22 | 1996-12-03 | Allergan | Method for using 2-(2-alkylphenylamino)-oxazolines as adrenergic agents |
| US5583139A (en) | 1993-11-19 | 1996-12-10 | Abbott Laboratories | Marcolide immunomodulators |
| US5595742A (en) | 1992-10-06 | 1997-01-21 | Toyo Seiyaku Kabushiki Kaisha | Antimicrobial agent for staphylococcus |
| US5597831A (en) | 1991-08-29 | 1997-01-28 | Vufb A.S | 6-[X-(2-hydroxyethyl) aminoalkyl]-5,11-dioxo-5,6-dihydro-11-H-indeno[1,2-c]isoquinolines and their use as antineoplastic agents |
| US5604234A (en) | 1991-09-05 | 1997-02-18 | Abbott Laboratories | Substituted thiol macrolactam immunomodulators |
| US5604229A (en) | 1992-10-21 | 1997-02-18 | Yoshitomi Pharmaceutical Industries, Ltd. | 2-amino-1,3-propanediol compound and immunosuppressant |
| US5604262A (en) | 1995-03-22 | 1997-02-18 | Research Corporation Technologies, Inc. | Topical antimicrobial agents |
| US5608056A (en) | 1992-04-13 | 1997-03-04 | Fujisawa Pharmaceutical Co., Ltd. | Substituted 3-pyrrolidinylthio-carbapenems as antimicrobial agents |
| US5607959A (en) | 1993-02-09 | 1997-03-04 | Pfizer Inc. | Oxindole 1-[N-(alkoxycarbonyl) ] carboxamides and 1-(N-carboxamido) carboxamides as antiinflammatory agents |
| US5610292A (en) | 1990-03-13 | 1997-03-11 | Acic (Canada) Inc. | Process for producing 2,2'-o-cyclonucleosides nucleosides, and analogs thereof |
| US5612060A (en) | 1995-05-25 | 1997-03-18 | Alexander; J. Wesley | Enhancement of transplant graft survival through nutritional immunomodulation and immunosuppressive therapy |
| US5612350A (en) | 1993-11-30 | 1997-03-18 | Abbott Laboratories | Macrocyclic immunomodulators with novel cyclohexyl ring replacements |
| US5612370A (en) | 1995-06-07 | 1997-03-18 | Bristol-Myers Squibb Company | Phenylglycine and phenylalaninen amido benzopyran derivatives |
| US5612323A (en) | 1995-06-07 | 1997-03-18 | Bristol-Myers Squibb Company | Phosphinic ester substituted benzopyran derivatives |
| US5618813A (en) | 1995-05-26 | 1997-04-08 | Abbott Laboratories | Benzo[5.6]pyrano[2.3.4-ij]quinolizine and benzo[5.6]thiopyrano[2.3.4-ij]quinolizine derivatives as antibacterial and antineoplastic agents |
| US5618835A (en) | 1996-02-01 | 1997-04-08 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5622948A (en) | 1994-12-01 | 1997-04-22 | Syntex (U.S.A.) Inc. | Pyrrole pyridazine and pyridazinone anti-inflammatory agents |
| US5631283A (en) | 1994-02-02 | 1997-05-20 | The United States Of America As Represented By The Secretary Of The Army | Use of sialic acid or antibodies to sialidase as anti-infectious agents and anti-inflammatory agents |
| US5631251A (en) | 1995-06-07 | 1997-05-20 | Merck & Co., Inc. | 5-cyclopropyl-1,4 benzodiazepine-2-ones |
| US5633277A (en) | 1993-02-09 | 1997-05-27 | Miles Inc. | Sulfonamide aminomethylene derivatives as immunosuppressants |
| US5635516A (en) | 1994-06-28 | 1997-06-03 | Adir Et Compagnie | (Thia) cycloalkyl[B]indole compounds as anti-inflammatory agents |
| US5637586A (en) | 1994-08-11 | 1997-06-10 | Kureha Chemical Industry Co., Ltd. | Benzimidazolesulfonamide derivatives and pharmaceutical composition |
| US5639455A (en) | 1993-02-17 | 1997-06-17 | Ajinomoto Co., Inc. | Immunosuppressant |
| US5643950A (en) | 1995-06-02 | 1997-07-01 | Ortho Pharmaceutical Corporation | Triphenylalkyl antimicrobial agents |
| US5646276A (en) | 1992-05-13 | 1997-07-08 | Bristol-Myers Squibb Co. | Diazepine containing dual action inhibitors |
| US5648376A (en) | 1995-01-19 | 1997-07-15 | Pharmagenesis, Inc. | Immunosuppressant diterpene compound |
| US5654484A (en) | 1987-10-08 | 1997-08-05 | Merrell Pharmaceuticals Inc. | Polyamine derivatives as antineoplastic agents |
| US5656591A (en) | 1992-01-23 | 1997-08-12 | Morinaga Milk Industry Co., Ltd. | Antimicrobial agents and method for treating products therewith |
| US5656661A (en) | 1994-07-27 | 1997-08-12 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5658564A (en) | 1992-02-19 | 1997-08-19 | The General Hospital Corporation | Xenograft thymus |
| US5661129A (en) | 1993-06-26 | 1997-08-26 | Schwarz Pharma Ag | Organic nitrates containing a disulfide group as cardiovascular agents |
| US5665772A (en) | 1992-10-09 | 1997-09-09 | Sandoz Ltd. | O-alkylated rapamycin derivatives and their use, particularly as immunosuppressants |
| US5665752A (en) | 1988-07-26 | 1997-09-09 | Sankyo Company, Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US5665715A (en) | 1993-02-23 | 1997-09-09 | Merrell Pharmaceuticals Inc. | Farnesyl:protein transferase inhibitors as anticancer agents |
| US5670504A (en) | 1995-02-23 | 1997-09-23 | Merck & Co. Inc. | 2,6-diaryl pyridazinones with immunosuppressant activity |
| US5672620A (en) | 1996-02-01 | 1997-09-30 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5674912A (en) | 1991-03-01 | 1997-10-07 | Warner-Lambert Company | Sunscreen-wound healing compositions and methods for preparing and using same |
| US5677318A (en) | 1996-07-11 | 1997-10-14 | Merck Frosst Canada, Inc. | Diphenyl-1,2-3-thiadiazoles as anti-inflammatory agents |
| US5679640A (en) | 1991-02-12 | 1997-10-21 | Cytel Corporation | Immunosuppressant peptides |
| US5679672A (en) | 1993-11-22 | 1997-10-21 | Merck & Co., Inc. | Benzodiazepines |
| US5679705A (en) | 1995-10-31 | 1997-10-21 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5681571A (en) | 1993-10-08 | 1997-10-28 | Duotol Ab | Immunological tolerance-inducing agent |
| US5683709A (en) | 1994-05-05 | 1997-11-04 | Ciba Vision Corporation | Poly(benzalkonium salt) as an anti-microbial agent for aqueous drug compositions |
| US5684041A (en) | 1996-02-01 | 1997-11-04 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5684002A (en) | 1994-09-07 | 1997-11-04 | The Procter & Gamble Company | Dihydorbenzofuran and related compounds useful as anti-inflammatory agents |
| US5684004A (en) | 1993-09-24 | 1997-11-04 | Merrell Pharmaceuticals, Inc. | Triaryl-ethylene derivatives |
| US5684204A (en) | 1995-11-15 | 1997-11-04 | The Procter & Gamble Company | Sulfur containing di-tert-butylphenol compounds useful as anti-inflammatory agents |
| US5684031A (en) | 1996-02-01 | 1997-11-04 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5684042A (en) | 1997-01-10 | 1997-11-04 | Medlogic Global Corporation | Cyanoacrylate compositions comprising an antimicrobial agent |
| US5686434A (en) | 1993-11-26 | 1997-11-11 | Pfizer Inc. | 3-aryl-2-isoxazolines as antiinflammatory agents |
| US5686471A (en) | 1996-02-01 | 1997-11-11 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5686488A (en) | 1995-08-25 | 1997-11-11 | Alcon Laboratories, Inc. | Polyethoxylated castor oil products as anti-inflammatory agents |
| US5686482A (en) | 1994-04-28 | 1997-11-11 | Yamanouchi Pharmaceutical Co., Ltd. | N-(3-pyrrolidinyl) benzamide derivative |
| US5686469A (en) | 1993-02-09 | 1997-11-11 | Miles Inc. | Aminomethylene derivaties as immunosuppressants |
| US5686424A (en) | 1992-04-08 | 1997-11-11 | Miles Inc. | 2-oxoethyl derivatives as immunosuppressants |
| US5688825A (en) | 1996-05-31 | 1997-11-18 | University Of Connecticut | Anandamide amidase inhibitors as analgesic agents |
| US5688949A (en) | 1991-04-22 | 1997-11-18 | Otsuka Pharmaceutical Factory, Inc. | Pyrazolo 1,5-A!pyrimidine derivatives and anti-inflammatory agent containing the same |
| US5691346A (en) | 1988-08-10 | 1997-11-25 | The Australian National University | Castanospermine as an anti-inflammatory and immunosuppressant agent |
| US5691332A (en) | 1995-06-07 | 1997-11-25 | Merck & Co., Inc. | N-(2,4-dioxo-2,3,4,5-tetrahydro-1H-1,5-benzodiazepin-3-yl)-3-amides |
| US5693645A (en) | 1992-12-23 | 1997-12-02 | Beth Israel Deaconess Medical Center, Inc. | Use of spiperone or spiperone derivatives as immunosuppressant agents |
| US5693648A (en) | 1994-09-30 | 1997-12-02 | Merck & Co., Inc. | O-aryl, O-alkyl, O-alkenyl and O-alkynyl-macrolides having immunosuppressive activity |
| US5696111A (en) | 1993-11-22 | 1997-12-09 | Merck & Co., Inc. | 3-acylaminobenzazepines |
| US5696156A (en) | 1995-10-31 | 1997-12-09 | Merck & Co. Inc. | Triterpene derivatives with immunosuppressant activity |
| US5696117A (en) | 1995-11-07 | 1997-12-09 | Ortho Pharmaceutical Corporation | Benzoxazine antimicrobial agents |
| US5698529A (en) | 1992-10-08 | 1997-12-16 | Supratek Pharma, Inc. | Chemotherapeutic compositions |
| US5702688A (en) | 1986-12-23 | 1997-12-30 | Tristrata Technology, Inc. | Amphoteric compositions and polymeric forms of alpha hydroxyacids, and their therapeutic use |
| US5707990A (en) | 1996-01-30 | 1998-01-13 | Ortho Pharmaceutical Corporation | 2-substituted amino and thio alkyl benzoxazine antimicrobial agents |
| US5708002A (en) | 1991-09-05 | 1998-01-13 | Abbott Laboratories | Macrocyclic immunomodulators |
| US5709870A (en) | 1994-10-18 | 1998-01-20 | Rengo Co., Ltd. | Antimicrobial agent |
| US5716967A (en) | 1993-11-26 | 1998-02-10 | Pfizer Inc. | Isoxazoline compounds as antiinflammatory agents |
| US5723466A (en) | 1991-12-06 | 1998-03-03 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5723718A (en) | 1994-12-20 | 1998-03-03 | St. Joseph's Hospital And Medical Center | Induction of immune tolerance to tumor cells |
| US5726171A (en) | 1995-06-07 | 1998-03-10 | Merck & Co Inc | N-(1-alkyl-5-phenyl-2,3,4,5-tetrahydro-1H-benzo B! 1,4!diazepin-3yl)-acetamides |
| US5731322A (en) | 1993-08-06 | 1998-03-24 | Smithkline Beecham S.P.A. | Octahydro-1H-pyrrolo 3,2-g!and 2,3-g!isoquinoline derivatives |
| US5736143A (en) | 1992-10-02 | 1998-04-07 | Alberta Research Council | Anti-inflammatory, tolerogenic and immunoinhibiting properties of carbohydrate binding-peptides |
| US5739279A (en) | 1992-07-31 | 1998-04-14 | Pfizer Inc. | Peptidyl 4-amino-2,2-difluoro-3-oxo-1,6-hexanedioic acid derivatives as antiinflammatory agents |
| US5739169A (en) | 1996-05-31 | 1998-04-14 | Procept, Incorporated | Aromatic compounds for inhibiting immune response |
| US5741798A (en) | 1996-06-03 | 1998-04-21 | Boehringer Ingelheim Pharmaceuticals, Inc. | 2-benzyl-4-sulfonyl-4H-isoquinolin-1,3-diones and their use as antiinflammatory agents |
| US5741526A (en) | 1994-03-25 | 1998-04-21 | Kabushiki Kaisha Kaisui Kagaku Kenkyujo | Antimicrobial agent |
| US5744495A (en) | 1995-07-13 | 1998-04-28 | Smithkline Beecham Corporation | N, N-diethyl-8, 8-dipropyl-2-azaspiro 4.5! decane-2-propanamine |
| US5750543A (en) | 1996-02-01 | 1998-05-12 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5753715A (en) | 1995-06-02 | 1998-05-19 | Ortho Pharmaceutical Corporation | 2-disubstituted cyclohexenyl and cyclohexyl antimicrobial agents |
| US5753687A (en) | 1995-06-19 | 1998-05-19 | Ontogen Corporation | Modulators of proteins with phosphotryrosine recognition units |
| US5760041A (en) | 1996-02-05 | 1998-06-02 | American Cyanamid Company | 4-aminoquinazoline EGFR Inhibitors |
| US5760002A (en) | 1992-12-22 | 1998-06-02 | The Proctor & Gamble Company | Diflouro pentapeptide derivative anti-inflammatory agents |
| US5763478A (en) | 1996-10-16 | 1998-06-09 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5770201A (en) | 1994-12-23 | 1998-06-23 | Rijsuniversiteit Te Leiden | HA-2 antigenic peptide |
| US5770612A (en) | 1993-12-21 | 1998-06-23 | Eli Lilly And Company | Methods of treating menstrual symptoms and compositions there for |
| US5773469A (en) | 1996-06-18 | 1998-06-30 | Ortho Pharmaceutical Corporation | Diaryl antimicrobial agents |
| US5776974A (en) | 1993-07-02 | 1998-07-07 | The University Of Nottingham | Immunosuppressant compounds |
| US5776946A (en) | 1995-08-28 | 1998-07-07 | Mcgeer; Patrick L. | Peripheral benzodiazepine receptor ligands as antiinflammatory agents |
| US5780026A (en) | 1993-08-09 | 1998-07-14 | Nippon Zoki Pharmaceutical Co., Ltd. | Immunomodulating and antiinflammatory agent |
| US5786344A (en) | 1994-07-05 | 1998-07-28 | Arch Development Corporation | Camptothecin drug combinations and methods with reduced side effects |
| US5786350A (en) | 1993-05-24 | 1998-07-28 | Gruppo Lepetit S.P.A. | 36-derivatives of rifamycins and their use as antimicrobial agents |
| US5801193A (en) | 1997-04-15 | 1998-09-01 | Immune Modulation, Inc. | Compositions and methods for immunosuppressing |
| US5807889A (en) | 1992-12-09 | 1998-09-15 | H. Lundbeck A/S | Aminomethylindans, -benzofuranes and -benzothiophenes |
| US5814648A (en) | 1994-05-19 | 1998-09-29 | Pfizer Inc. | N-hydroxyureas as antiinflammatory agents |
| US5817660A (en) | 1991-12-06 | 1998-10-06 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5817661A (en) | 1991-12-06 | 1998-10-06 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5817672A (en) | 1991-12-06 | 1998-10-06 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5821250A (en) | 1996-02-01 | 1998-10-13 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5827837A (en) | 1993-08-20 | 1998-10-27 | The Regents Of The University Of California | Polyanion anti-inflammatory agents |
| US5837702A (en) | 1993-10-07 | 1998-11-17 | Bristol-Myers Squibb Co. | 4-arylamino-benzopyran and related compounds |
| US5837735A (en) | 1994-10-05 | 1998-11-17 | Helsinn Healthcare S.A. | Antiinflammatory agent for external use |
| US5843452A (en) | 1992-11-09 | 1998-12-01 | Pharmagenesis, Inc. | Immunotherapy composition and method |
| US5856320A (en) | 1995-10-17 | 1999-01-05 | Katayama Seiyakusyo Co., Ltd. | Cephem compounds, their preparation and their use as antimicrobial agents |
| US5856364A (en) | 1991-03-01 | 1999-01-05 | Warner Lambert Company | Therapeutic antiviral-wound healing compositions and methods for preparing and using same |
| US5859027A (en) | 1996-02-26 | 1999-01-12 | Chektec Corporation | Antimicrobial agent |
| US5863938A (en) | 1991-03-01 | 1999-01-26 | Warner Lambert Company | Antibacterial-wound healing compositions and methods for preparing and using same |
| US5869057A (en) | 1995-06-07 | 1999-02-09 | Rock; Edwin P. | Recombinant vaccines to break self-tolerance |
| US5869478A (en) | 1995-06-07 | 1999-02-09 | Bristol-Myers Squibb Company | Sulfonamido substituted benzopyran derivatives |
| US5872109A (en) | 1995-02-07 | 1999-02-16 | Shiseido Company, Ltd. | Anti-inflammatory agent |
| US5874479A (en) | 1991-03-01 | 1999-02-23 | Warner-Lambert Company | Therapeutic permeation enhanced-wound healing compositions and methods for preparing and using same |
| US5874594A (en) | 1996-10-16 | 1999-02-23 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5874476A (en) | 1997-07-14 | 1999-02-23 | Rohm And Haas Company | Dihaloformaldoxime carbamates as antimicrobial agents |
| US5877184A (en) | 1996-08-06 | 1999-03-02 | Merck & Co., Inc. | Macrolides having immunosuppressive activity |
| US5877206A (en) | 1994-10-03 | 1999-03-02 | Mars, Incorporated | Methods for inhibiting topoisomerase using procyanidin oligomers |
| US5880280A (en) | 1994-06-15 | 1999-03-09 | Merck & Co., Inc. | Aryl, alkyl, alkenyl and alkynylmacrolides having immunosuppressive activity |
| US5880161A (en) | 1993-11-05 | 1999-03-09 | The United States Of America As Represented By The Department Of Health And Human Services | Therapeutic polyamines |
| US5883119A (en) | 1995-10-31 | 1999-03-16 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5891653A (en) | 1995-12-29 | 1999-04-06 | Attfield; Derrick Cecil | Method of suppressing graft rejection by means of stress proteins |
| US5939455A (en) | 1997-03-11 | 1999-08-17 | Beacon Laboratories, Inc. | Therapeutic augmentation of oxyalkylene diesters and butyric acid derivatives |
| US5948407A (en) | 1997-03-19 | 1999-09-07 | Shire Laboratories Inc. | Oral induction of tolerance to parenterally administered non-autologous polypeptides |
| US6006752A (en) | 1996-05-09 | 1999-12-28 | The General Hospital Corporation | Mixed chimerism and tolerance |
| US6024957A (en) | 1993-06-02 | 2000-02-15 | Research Corporation Technologies, Inc. | Immunomodulators and methods for the prevention and reversal of organ transplant rejection using same |
| US6030624A (en) | 1996-08-16 | 2000-02-29 | Uab Research Foundation | Mucosal immunogens for novel vaccines |
| US6037372A (en) | 1996-03-15 | 2000-03-14 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Use of an alkanoyl-L-carnitine for the treatment of glutamate mediated diseases |
| US6037373A (en) | 1996-07-05 | 2000-03-14 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Use of L-acetylcarnitine, L-isovalerylcarnitine, L-propionylcarnitine for increasing the levels of IGF-1 |
| US6043247A (en) | 1996-04-19 | 2000-03-28 | Novo Nordisk A/S | Modulators of molecules with phosphotyrosine recognition units |
| WO2000024782A2 (en) | 1998-10-23 | 2000-05-04 | Amgen Inc. | Modified peptides, comprising an fc domain, as therapeutic agents |
| US6060049A (en) | 1993-05-24 | 2000-05-09 | Ximerex, Inc. | Surrogate tolerogenesis for the development of tolerance to xenografts |
| US6087096A (en) | 1995-11-13 | 2000-07-11 | Dau; Peter C. | Method of intrafamily fragment analysis of the T cell receptor α and β chain CDR3 regions |
| US6096315A (en) | 1988-06-14 | 2000-08-01 | Cel Sci Corporation | Heterofunctional cellular immunological reagents, vaccines containing same and methods for the use of same |
| US6103235A (en) | 1995-10-30 | 2000-08-15 | The United States Of America As Represented By The Department Of Health And Human Services | Methods of inducing immune tolerance using immunotoxins |
| US6124495A (en) | 1997-03-11 | 2000-09-26 | Beacon Laboratories, Inc. | Unsaturated oxyalkylene esters and uses thereof |
| US6153203A (en) | 1993-10-08 | 2000-11-28 | Duotol Ab | Immunological tolerance-inducing agent |
| US6169087B1 (en) | 1997-09-23 | 2001-01-02 | Novo Nordisk A/S | Modulators of protein tyrosine phosphatases (PTPases) |
| US6255278B1 (en) | 1994-11-10 | 2001-07-03 | Cellena Ag | Composition containing pooled transferrins as an active principle for the induction of immune tolerance against antigens |
| US6262044B1 (en) | 1998-03-12 | 2001-07-17 | Novo Nordisk A/S | Modulators of protein tyrosine phosphatases (PTPASES) |
| US6290950B1 (en) | 1996-10-04 | 2001-09-18 | Igor Dimitrievich Poliakov | Mycosis vaccines |
| US6306651B1 (en) | 1991-11-22 | 2001-10-23 | The General Hospital Corporation | Specific tolerance in transplantation |
| US6329153B1 (en) | 1998-06-22 | 2001-12-11 | Vanderbilt University | Method for evaluating immunosuppressive regimens |
| US6344476B1 (en) | 1997-05-23 | 2002-02-05 | Bayer Corporation | Inhibition of p38 kinase activity by aryl ureas |
| US6352698B1 (en) | 1996-10-22 | 2002-03-05 | Johnson & Johnson Consumer France, Sas, Roc Division | Use of complexes for the preparation of compositions for the treatment of sensitive skin, preparation process and hypoallergenic compositions |
| US6379668B1 (en) | 1993-06-02 | 2002-04-30 | Research Corporation Technologies, Inc. | Use of anti-CD45 leukocyte antigen antibodies for immunomodulation |
| US6391303B1 (en) | 1996-11-18 | 2002-05-21 | Emisphere Technologies, Inc. | Methods and compositions for inducing oral tolerance in mammals |
| US6395767B2 (en) | 2000-03-10 | 2002-05-28 | Bristol-Myers Squibb Company | Cyclopropyl-fused pyrrolidine-based inhibitors of dipeptidyl peptidase IV and method |
| US6403555B1 (en) | 1999-12-08 | 2002-06-11 | Xcyte Therapies, Inc. | Depsipeptide and congeners thereof for use as immunosuppressants |
| US6410556B1 (en) | 1999-09-10 | 2002-06-25 | Novo Nordisk A/S | Modulators of protein tyrosine phosphateses (PTPases) |
| US6468537B1 (en) | 1999-04-28 | 2002-10-22 | The Board Of Trustees Of Northwestern University | Localization of major peptide autoepitopes for nucleosome specific T cells of systemic lupus erythematosus |
| US6489330B1 (en) | 1995-03-07 | 2002-12-03 | Novartis International Pharmaceutical Ltd. | Use of penciclovir for the treatment of human herpes-virus-8 |
| US6521232B1 (en) | 1998-03-31 | 2003-02-18 | Nisshin Flour Milling Co., Ltd. | Proteins having immunomodulatory activity and remedies for immunological diseases |
| US6525242B1 (en) | 1999-11-02 | 2003-02-25 | The University Of Connecticut | Propagation of human hepatocytes in non-human mammals |
| US6525035B1 (en) | 1999-06-10 | 2003-02-25 | Sass & Sass, Inc. | Therapeutic composition and methods |
| US6558663B1 (en) | 1995-08-04 | 2003-05-06 | The General Hospital Corporation | Transgenic swine & swine cells having human HLA genes |
| US6572860B1 (en) | 1997-09-30 | 2003-06-03 | Cel-Sci Corporation | Immunogenic conjugated polypeptide for treatment of herpes simplex virus |
| WO2005002515A2 (en) | 2003-06-20 | 2005-01-13 | Biomarin Pharmaceutical Inc. | Delivery of therapeutic compounds to the brain and other tissues |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4394448A (en) | 1978-02-24 | 1983-07-19 | Szoka Jr Francis C | Method of inserting DNA into living cells |
| US4391904A (en) | 1979-12-26 | 1983-07-05 | Syva Company | Test strip kits in immunoassays and compositions therein |
| US5186941A (en) | 1983-05-06 | 1993-02-16 | Vestar, Inc. | Vesicle formulation for the controlled release of therapeutic agents |
| US6048729A (en) | 1987-05-01 | 2000-04-11 | Transkaryotic Therapies, Inc. | In vivo protein production and delivery system for gene therapy |
| US6063630A (en) | 1991-11-05 | 2000-05-16 | Transkaryotic Therapies, Inc. | Targeted introduction of DNA into primary or secondary cells and their use for gene therapy |
| US5474766A (en) | 1992-12-18 | 1995-12-12 | Washington University | Methods and compositions for inhibition of hepatic clearance of tissue-type plasminogen activator |
| JPH08253430A (ja) * | 1995-03-17 | 1996-10-01 | Kanagawa Kagaku Gijutsu Akad | Ldlレセプター媒介薬物輸送方法 |
| US6238908B1 (en) | 1995-06-07 | 2001-05-29 | Aastrom Biosciences, Inc. | Apparatus and method for maintaining and growth biological cells |
| US6156311A (en) | 1995-07-27 | 2000-12-05 | The American National Red Cross | Modulators of expression and function of LRP in alzheimer's disease |
| AU724620B2 (en) | 1996-01-16 | 2000-09-28 | Sokol, Ronald J Dr. | Use of antioxidant agents to treat cholestatic liver disease |
| TW492882B (en) | 1997-11-28 | 2002-07-01 | Caleb Pharmaceuticals Inc | Cholinergic antagonist plaster composition |
| US6261595B1 (en) | 2000-02-29 | 2001-07-17 | Zars, Inc. | Transdermal drug patch with attached pocket for controlled heating device |
| US6596762B2 (en) | 2001-05-17 | 2003-07-22 | The Regents Of The University Of Colorado | Antioxidant compositions and use for treatment of hepatic steatosis and steatohepatitis |
| EP1534823A4 (en) | 2002-07-12 | 2008-12-31 | Biomarin Pharm Inc | USE OF ISOCYANATLINKERS FOR THE MANUFACTURE OF HYDROLYSABLE ACTIVE BIOPOLYMER CONJUGATES |
| US20050026823A1 (en) * | 2003-06-20 | 2005-02-03 | Biomarin Pharmaceutical Inc. | Use of the chaperone receptor-associated protein (RAP) for the delivery of therapeutic compounds to the brain and other tissues |
| US8877714B2 (en) * | 2005-06-14 | 2014-11-04 | Raptor Pharmaceutical Inc. | Compositions comprising receptor-associated protein (RAP) variants specific for LRP2 and uses thereof |
-
2007
- 2007-09-18 CN CNA200780042719XA patent/CN101594878A/zh active Pending
- 2007-09-18 MX MX2009002893A patent/MX2009002893A/es active IP Right Grant
- 2007-09-18 EP EP07842713.5A patent/EP2063905B1/en not_active Not-in-force
- 2007-09-18 WO PCT/US2007/078792 patent/WO2008036682A2/en not_active Ceased
- 2007-09-18 KR KR1020097007889A patent/KR20090071598A/ko not_active Ceased
- 2007-09-18 CA CA002663377A patent/CA2663377A1/en not_active Abandoned
- 2007-09-18 JP JP2009528530A patent/JP2010503710A/ja active Pending
- 2007-09-18 US US12/441,618 patent/US8795627B2/en not_active Expired - Fee Related
Patent Citations (1001)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3691216A (en) | 1958-05-28 | 1972-09-12 | Sune Bergstrom | Pge2 methyl ester and pge2 methyl ester diacetate |
| US3852468A (en) | 1967-02-27 | 1974-12-03 | Ici Ltd | Alkanolamine derivatives as {62 -adrenergic blocking agents |
| US4089900A (en) | 1967-09-13 | 1978-05-16 | Pfizer Inc. | Antimicrobial agents |
| US3928356A (en) | 1967-10-06 | 1975-12-23 | Fujisawa Pharmaceutical Co | 10-{8 4-({107 -Hydroxy alkyl)-1-piperazimyl{9 -dibenzo (h,f) oxofins and thiepins and acetyl esters thereof |
| US3726978A (en) | 1967-11-02 | 1973-04-10 | Sandoz Ag | Tetrahydropyridazines and pyridazinones as anti-inflammatory agents |
| US3832470A (en) | 1968-01-29 | 1974-08-27 | H Russek | Treatment of angina pectoris with a long-acting vasodilating agent and a beta adrenergic receptor blocking agent |
| US3668210A (en) | 1968-02-07 | 1972-06-06 | Yoshitomi Pharmaceutical | 3-chloro dihydrodibenzazepine derivatives |
| US3789123A (en) | 1968-03-27 | 1974-01-29 | Ciba Geigy Corp | Tertiary aminoacids as anti-inflammatory agents |
| US3898210A (en) | 1968-08-21 | 1975-08-05 | Squibb & Sons Inc | 4-Azatricyclo {8 4.3.1.1{hu 3,8{b {9 undecane and related compounds |
| US3951950A (en) | 1968-08-21 | 1976-04-20 | E. R. Squibb & Sons, Inc. | 4-Azatricyclo[4.3.1.13,8 ]undecane and related compounds |
| US3678169A (en) | 1969-02-28 | 1972-07-18 | Ciba Geigy Corp | Pyridyl-2-imidazolones as anti-inflammatory agents |
| US3993763A (en) | 1969-03-18 | 1976-11-23 | Ciba-Geigy Corporation | Tertiary aminoacids as anti-inflammatory agents |
| US3624126A (en) | 1969-09-02 | 1971-11-30 | Squibb & Sons Inc | {66 {11 , {60 -adamantane acetic acid |
| US3759921A (en) | 1969-10-16 | 1973-09-18 | Lilly Co Eli | Method of suppressing immuneresponse with 1 substituted-3-(2 pyrimidyl)ureas |
| US4000275A (en) | 1969-11-24 | 1976-12-28 | Eli Lilly And Company | Immunosuppressants |
| US3691214A (en) | 1970-06-08 | 1972-09-12 | Warner Lambert Pharmaceutical | 17-valerate ester of 6alpha,9alpha-difluoroprednisolone,its compositions and use as an anti-inflammatory agent |
| US3694471A (en) | 1970-06-08 | 1972-09-26 | Warner Lambert Pharmaceutical | 17-valerate ester of 6{60 ,9{60 -difluorohydrocortisone, its compositions and use as an anti-inflammatory agent |
| US3624216A (en) | 1970-06-25 | 1971-11-30 | Abbott Lab | 8-substituted theophyllines as anti-inflammatory agents |
| US3934018A (en) | 1970-09-03 | 1976-01-20 | Abbott Laboratories | 4,6-Dihydro-1,3-dimethyl-8-phenylpyrazolo[4,3-e] [1,4]diazepin-5-(1H)-one and derivatives as anti-inflammatory agents |
| US3865748A (en) | 1970-09-22 | 1975-02-11 | Us Agriculture | Cinnamyl phenol antimicrobial agents |
| US3936393A (en) | 1970-09-22 | 1976-02-03 | The United States Of America As Represented By The Secretary Of Agriculture | Antimicrobial agents and use thereof |
| US3783160A (en) | 1970-10-28 | 1974-01-01 | Gates Rubber Co | Diethyl allyl phosphonate as an anti-microbial agent |
| US3917476A (en) | 1970-10-28 | 1975-11-04 | Gates Rubber Co | Diethyl alpha phosphonate as an (antimicrobial agent) algaecide |
| US3764676A (en) | 1970-10-28 | 1973-10-09 | Gates Rubber Co | Diethyl cyanomethyl phosphonate as an antimicrobial agent |
| US3980652A (en) | 1970-11-11 | 1976-09-14 | A. Christiaens Societe Anonyme | 2-(4-Methyl-piperazino)-3 or 5 cyano pyridine |
| US3991057A (en) | 1970-11-11 | 1976-11-09 | A. Christiaens Societe Anonyme | C-Piperazino-pyridine sulfonamides |
| US3998954A (en) | 1971-02-05 | 1976-12-21 | Pfizer Inc. | 1,3(2H,4H)-Dioxoisoquinoline-4-carboxamides used as anti-inflammatory agents |
| US4148796A (en) | 1971-03-15 | 1979-04-10 | Sumitomo Chemical Company, Limited | γ-Piperidinobutyrophenones |
| US3867383A (en) | 1971-03-29 | 1975-02-18 | Ciba Geigy Corp | Monoanthranilatoanilino-s-triazines |
| US3886157A (en) | 1971-03-29 | 1975-05-27 | Ciba Geigy Corp | 5,6,8,8B,9-Pentaazanaphth{8 3,2,1-d,e{9 anthracene derivatives |
| US3857955A (en) | 1971-03-29 | 1974-12-31 | Lilly Co Eli | Anti-inflammatory agents |
| US3764677A (en) | 1971-06-25 | 1973-10-09 | Gates Rubber Co | Diethyl betaaminoethylphosphonate as an antimicrobial agent |
| US3984405A (en) | 1971-06-28 | 1976-10-05 | E. R. Squibb & Sons, Inc. | Anti-inflammatory agents |
| US3880834A (en) | 1971-09-10 | 1975-04-29 | Shionogi & Co | 1-Methylaziridine compounds and production thereof |
| US3821401A (en) | 1971-09-13 | 1974-06-28 | Lilly Co Eli | Other publications |
| US4029661A (en) | 1971-10-04 | 1977-06-14 | Pcr, Inc. | Process for producing 5-fluorouracil and derivatives thereof in acid and/or alcohol solvents |
| US3897441A (en) | 1971-10-27 | 1975-07-29 | Syntex Inc | Certain thiazole-carboxamides and acylamino-thiazoles |
| US3982010A (en) | 1971-10-27 | 1976-09-21 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4001421A (en) | 1971-10-27 | 1977-01-04 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US3789121A (en) | 1971-11-26 | 1974-01-29 | Warner Lambert Co | 17{60 ,21-orthobutyrates of 6{60 , 9{60 -difluoro-hydrocortisone and 6{60 , 9{60 -difluoroprednisolone, compositions containing same and the use thereof as anti-inflammatory agents |
| US3936450A (en) | 1972-02-08 | 1976-02-03 | Centre Europeen de Recherches Mauvernay "C.E.R.M." | Anti-inflammatory agents and method for their preparation |
| US3821377A (en) | 1972-02-22 | 1974-06-28 | Squibb & Sons Inc | Anti-inflammatory agents |
| US3954868A (en) | 1972-03-02 | 1976-05-04 | Uniroyal, Inc. | Bis(diphenylaminomethane) antimicrobial agents |
| US3933834A (en) | 1972-03-06 | 1976-01-20 | Bayer Aktiengesellschaft | Unsymmetrical esters of N-substituted 1,4-dihydropyridine 3,5-dicarboxylic acid |
| US3883540A (en) | 1972-03-06 | 1975-05-13 | Bayer Ag | Unsymmetrical esters of N-substituted 1,4-dihydropyridine 3,5-dicarboxylic acid |
| US3867548A (en) | 1972-05-25 | 1975-02-18 | Us Agriculture | Dihydrocinnamyl phenols useful as antimicrobial agents |
| US3915889A (en) | 1972-05-25 | 1975-10-28 | Us Agriculture | Dihydrocinnamyl phenol antimicrobial agents |
| US3923818A (en) | 1972-06-10 | 1975-12-02 | Bayer Ag | 1,4-Dihydropyridines |
| US3959296A (en) | 1972-06-10 | 1976-05-25 | Bayer Aktiengesellschaft | 1,4-Dihydropyridines |
| US3968117A (en) | 1972-06-10 | 1976-07-06 | Bayer Aktiengesellschaft | 1,4-Dihydropyridines |
| US3925369A (en) | 1972-11-03 | 1975-12-09 | Science Union & Cie | New tricyclic ureas processes for their production and pharmaceutical compositions |
| US4064272A (en) | 1972-12-06 | 1977-12-20 | Pfizer Inc. | 2-Aminomethyleneindanone analgesic agents |
| US4164514A (en) | 1972-12-06 | 1979-08-14 | Pfizer Inc. | 2-Aminomethyleneindanone analgesic agents |
| US4022836A (en) | 1972-12-06 | 1977-05-10 | Pfizer Inc. | 2-Aminomethyleneindanone analgesic agents |
| US4117012A (en) | 1972-12-06 | 1978-09-26 | Pfizer Inc. | 2-aminomethyleneindanone analgesic agents |
| US3966968A (en) | 1973-01-26 | 1976-06-29 | Henkel & Cie G.M.B.H. | N,N'-disubstituted thioureas, their process of production and use as antimicrobial agents |
| US3939152A (en) | 1973-04-04 | 1976-02-17 | Yeda Research And Development Company Ltd. | 5-Phenyl-2,4-benzodiazepines |
| US3873715A (en) | 1973-04-06 | 1975-03-25 | Univ Miami | Therapeutic agent for improving cardiovascular function |
| US3930005A (en) | 1973-06-15 | 1975-12-30 | Squibb & Sons Inc | Antiinflammatory agents and their use |
| US4002775A (en) | 1973-07-09 | 1977-01-11 | Kabara Jon J | Fatty acids and derivatives of antimicrobial agents |
| US3856962A (en) | 1973-07-10 | 1974-12-24 | R Alphin | Anti-inflammatory agents |
| US4190587A (en) | 1973-08-06 | 1980-02-26 | Hoffmann-La Roche Inc. | 4-(3-Oxo-4-trifluoromethyl-1-octenyl)-2-oxo-2H-cyclopenta[b]furans |
| US3968125A (en) | 1973-11-05 | 1976-07-06 | Eli Lilly And Company | Dihydroxyhexahydrodibenzo[b,d]pyrans |
| US4011321A (en) | 1973-12-19 | 1977-03-08 | Smith Kline & French Laboratories Limited | Pharmaceutical compositions and methods of inhibiting β-adrenergic receptors |
| US3991212A (en) | 1973-12-26 | 1976-11-09 | Eli Lilly And Company | Anti-inflammatory agents |
| US4194009A (en) | 1974-01-10 | 1980-03-18 | Eli Lilly And Company | Aryloxyphenylpropylamines for obtaining a psychotropic effect |
| US4314081A (en) | 1974-01-10 | 1982-02-02 | Eli Lilly And Company | Arloxyphenylpropylamines |
| US4313896A (en) | 1974-01-10 | 1982-02-02 | Eli Lilly And Company | Aryloxyphenylpropylamines |
| US4018895A (en) | 1974-01-10 | 1977-04-19 | Eli Lilly And Company | Aryloxyphenylpropylamines in treating depression |
| US3993639A (en) | 1974-02-08 | 1976-11-23 | Roland Yves Mauvernay | Heptaminol adenosine-5'-monophosphate |
| US4044139A (en) | 1974-02-08 | 1977-08-23 | Uniroyal, Inc. | Bis(diphenylaminomethane) antimicrobial agents |
| US3897442A (en) | 1974-03-14 | 1975-07-29 | Syntex Inc | Thiazole cardiovascular agents |
| US3949081A (en) | 1974-04-08 | 1976-04-06 | Ciba-Geigy Corporation | 4-Carbamoyl-1-benzazepines as antiinflammatory agents |
| US3991201A (en) | 1974-06-27 | 1976-11-09 | Janssen Pharmaceutica N.V. | 1-(β-Aryl-β-R-ethyl)imidazoles as antimicrobial agents |
| US3975543A (en) | 1974-07-05 | 1976-08-17 | Eli Lilly And Company | Ethyl- and vinylbenzenes as anti-inflammatory agents |
| US4164586A (en) | 1974-07-19 | 1979-08-14 | Hoffmann-La Roche Inc. | Therapeutic agent for improving cardiovascular function |
| US4076834A (en) | 1974-07-19 | 1978-02-28 | Hoffmann-La Roche Inc. | Therapeutic agents for improving cardiovascular function |
| US4083968A (en) | 1974-07-19 | 1978-04-11 | Hoffmann-La Roche | Therapeutic agent for improving cardiovascular function |
| US4058620A (en) | 1974-07-19 | 1977-11-15 | Hoffmann-La Roche Inc. | Therapeutic agents for improving cardiovascular function |
| US3949082A (en) | 1974-07-24 | 1976-04-06 | Merck & Co., Inc. | Thiadiazoles as anti-inflammatory agents |
| US3940407A (en) | 1974-09-16 | 1976-02-24 | Syntex (U.S.A.) Inc. | β-Adrenergic blocking agents in the 1,2,3-thiadiazole series |
| US4117135A (en) | 1974-10-11 | 1978-09-26 | Schering, A.G. | Novel 5,6,7,8-tetrahydro-5-quinolines and their use as anti-inflammatory agents |
| US4139535A (en) | 1974-12-16 | 1979-02-13 | Merck & Co., Inc. | 3-Cyano-2-pyridinyloxymethyl-oxazolidine derivatives |
| US3968224A (en) | 1975-04-28 | 1976-07-06 | Stauffer Chemical Company | 3-(4'-Chlorophenyl)-5-methyl-4,5-dihydro-1,2,4-oxadiazole, its use as an anti-inflammatory agent |
| US3947475A (en) | 1975-04-28 | 1976-03-30 | Stauffer Chemical Company | 5-Furoyl-2,2,4-trimethyl-1,4-dihydro-1H-1,5-benzodiazepine as an anti-inflammatory agent |
| US4027031A (en) | 1975-04-28 | 1977-05-31 | Stauffer Chemical Company | 2-Cyclopropanecarboxamido-S-halothiazole as anti-inflammatory agents |
| US3998970A (en) | 1975-04-28 | 1976-12-21 | Stauffer Chemical Company | N,N-dimethyl-N'-phenylthiocarbamyl formamidine and its use as an anti-inflammatory agent |
| US3978227A (en) | 1975-04-28 | 1976-08-31 | Stauffer Chemical Company | 5-furoyl-2,2,4-trimethyl-1,4-dihydro-1h-1,5-benzodiazepine as an anti-inflammatory agent |
| US3959368A (en) | 1975-04-28 | 1976-05-25 | Stauffer Chemical Company | N,N-dimethyl-N'-phenylthiocarbamyl formamidine and its use as an anti-inflammatory agent |
| US3966944A (en) | 1975-05-19 | 1976-06-29 | Abbott Laboratories | 10 (N-methyl-4-piperidylidene)-10H[1]-benzopyrano[3,2-b]-pyridine as an analgesic, anti-inflammatory and agent against type III hypersensitivity disease |
| US4024284A (en) | 1975-06-09 | 1977-05-17 | Eli Lilly And Company | Ethyl- and vinylbenzenes as anti-inflammatory agents |
| US4021550A (en) | 1975-06-18 | 1977-05-03 | John Wyeth & Brother Limited | Hexahydroazepines as antiinflammatory agents |
| US4055655A (en) | 1975-07-21 | 1977-10-25 | National Research Laboratories | Complexes of heavy metal ions and polyfunctional organic ligands used as antimicrobial agents |
| US3978202A (en) | 1975-07-25 | 1976-08-31 | Stauffer Chemical Company | ο-Chlorobenzamidoxime as an anti-inflammatory agent |
| US3978219A (en) | 1975-07-25 | 1976-08-31 | Stauffer Chemical Company | Nicotinamidoxime as an anti-inflammatory agent |
| US4011326A (en) | 1975-07-29 | 1977-03-08 | Merck & Co., Inc. | 2-Substituted oxazolo[4,5-b]pyridine anti-inflammatory agents |
| US4145550A (en) | 1975-08-07 | 1979-03-20 | Merck Sharp & Dohme (I.A.) Corp. | 2-(4-Substituted-1,2,5-thiadiazole-3-yloxy)-acetaldehydes |
| US4031226A (en) | 1975-08-13 | 1977-06-21 | Janssen Pharmaceutica N.V. | N-[(1-piperidinyl)alkyl]arylcarboxamide derivatives |
| US4124713A (en) | 1975-08-26 | 1978-11-07 | American Hoechst Corporation | Oxopyridobenzoxepin-acetic acids and derivatives thereof useful as antiinflammatory and analgesic agents |
| US4012527A (en) | 1975-09-15 | 1977-03-15 | Stauffer Chemical Company | N,N-Dimethyl-N'-phenylthiocarbamyl formamidine hydrochloride and its use as an anti-inflammatory agent |
| US3994898A (en) | 1975-10-16 | 1976-11-30 | E. R. Squibb & Sons, Inc. | 1,2,4-Triazolo (4,3-b) pyridazin-3-ones |
| US4311708A (en) | 1975-11-06 | 1982-01-19 | Synthelabo | Phenol ethers |
| US4082843A (en) | 1975-11-26 | 1978-04-04 | Smith Kline & French Laboratories Limited | 3-(3-(3-Substituted amino-2-hydroxypropoxy)phenyl)-6-hydrazino pyridazines and their use as vasodilators and β-adrenergic blocking agents |
| US4049665A (en) | 1975-12-24 | 1977-09-20 | Colgate-Palmolive Company | Unsymmetrical disulfides as antimicrobial agents |
| US4145444A (en) | 1976-01-01 | 1979-03-20 | Kaken Chemical Co., Ltd. | Anti-inflammatory agent of benzoyl derivative |
| US4124726A (en) | 1976-01-01 | 1978-11-07 | Kaken Chemical Co., Ltd. | Anti-inflammatory agent of benzoyl derivative |
| US4012448A (en) | 1976-01-15 | 1977-03-15 | Stanford Research Institute | Synthesis of adriamycin and 7,9-epiadriamycin |
| US4275064A (en) | 1976-02-06 | 1981-06-23 | Interx Research Corporation | Transient pro-drug forms of xanthine derivatives and their use as topical anti-inflammatory agents |
| US4130664A (en) | 1976-02-13 | 1978-12-19 | Uniroyal, Inc. | (Bis(diphenylaminomethane) antimicrobial agents |
| US4018923A (en) | 1976-03-10 | 1977-04-19 | Eli Lilly And Company | 5,6-Diaryl-1,2,4-triazines as topically-active anti-inflammatory agents |
| US4021553A (en) | 1976-03-10 | 1977-05-03 | Eli Lilly And Company | 5,6-Diaryl-1,2,4-triazines as topically-active anti-inflammatory agents |
| US4013672A (en) | 1976-03-15 | 1977-03-22 | E. R. Squibb & Sons, Inc. | 2,5,7,8-Tetrahydro-1,2,4,5,6-pentaazabenzo[6,7]-cyclohepta[1,2,3-cd]-as-indacenes |
| US4018779A (en) | 1976-03-25 | 1977-04-19 | E. R. Squibb & Sons, Inc. | Derivatives of 10,11-dihydrobenzo[4,5]cyclohepta[1,2-b]-pyrazolo[4,3-e]pyridine-5(1H)ones |
| US4150231A (en) | 1976-04-06 | 1979-04-17 | Politechnika Gdanska | 1-Nitro-9-dialkylaminoisoalkylaminoacridines or their salts |
| US4020072A (en) | 1976-05-04 | 1977-04-26 | E. R. Squibb & Sons, Inc. | 5-Aminomethyl-1H-pyrazolo[3,4-b]pyridines |
| US4145425A (en) | 1976-06-15 | 1979-03-20 | Merck & Co., Inc. | Substituted (3-loweralkylamino-2-R1 0-propoxy)pyridines, their preparation and use |
| US4141981A (en) | 1976-07-06 | 1979-02-27 | Bayer Aktiengesellschaft | Antimicrobial agent |
| US4056673A (en) | 1976-07-16 | 1977-11-01 | Hoffmann-La Roche Inc. | Phosphonoacetic acid derivatives of nucleosides |
| US4064259A (en) | 1976-07-19 | 1977-12-20 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4064257A (en) | 1976-07-19 | 1977-12-20 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4064258A (en) | 1976-07-19 | 1977-12-20 | Syntex (U.S.A.) Inc. | Thiazole cardiovascular agents |
| US4215131A (en) | 1976-08-07 | 1980-07-29 | Bayer Aktiengesellschaft | Antimicrobial agents |
| US4296117A (en) | 1976-10-05 | 1981-10-20 | Boehringer Ingelheim Gmbh | 1-Aryloxy-2-hydroxy-3-[(Benzimidazolinone-substituted alkyl)-amino]propanes and salts thereof |
| US4343800A (en) | 1976-10-05 | 1982-08-10 | Boehringer Ingelheim Gmbh | 1-Aryloxy-2-hydroxy-3[(heterocyclic-substituted alkyl)-amino]propanes and salts thereof |
| US4381309A (en) | 1976-10-05 | 1983-04-26 | Boehringer Ingelheim Gmbh | 1-Aryloxy-2-hydroxy-3-((heterocyclic-substituted alkyl)-amino)-propanes and salts thereof |
| US4069341A (en) | 1976-10-18 | 1978-01-17 | The Dow Chemical Company | Oxybis(4,1-phenylene(2-oxo-2,1-ethanediyl)) thiocyanate and its use as an antimicrobial agent |
| US4089977A (en) | 1976-11-24 | 1978-05-16 | Kewanee Industries | Polymeric anti-microbial agent |
| US4062858A (en) | 1976-12-22 | 1977-12-13 | E. R. Squibb & Sons, Inc. | Derivatives of 5,6-dihydrobenzo[5,6]cyclohepta[1,2-b]pyrazolo[4,3-e]pyridin-11(1H)-ones and 11(1H)-imines |
| US4128717A (en) | 1976-12-22 | 1978-12-05 | E. R. Squibb & Sons, Inc. | Derivatives of 5,6-dihydrobenzo[5,6]cyclohepta[1,2-B]pyrazolo-[4,3-E]pyridin-11 (1H)-ones and 11 (1H)-imines |
| US4124707A (en) | 1976-12-22 | 1978-11-07 | Schering Corporation | 7α-Halogeno-3,20-dioxo-1,4-pregnadienes, methods for their manufacture, their use as anti-inflammatory agents, and pharmaceutical formulations useful therefor |
| US4256766A (en) | 1977-03-09 | 1981-03-17 | Mitsubishi Chemical Industries, Ltd | Immunosuppressant |
| US4180588A (en) | 1977-03-09 | 1979-12-25 | Mitsubishi Chemical Industries, Ltd. | Immunosuppressant |
| US4246411A (en) | 1977-03-14 | 1981-01-20 | Pcr Incorporated | 5,5-Difluorouracil |
| US4166122A (en) | 1977-03-15 | 1979-08-28 | Bayer Aktiengesellschaft | Bis-(5,5-dimethyl-1,3-oxazolidin-3-yl) methane as an antimicrobial agent |
| US4252815A (en) | 1977-04-21 | 1981-02-24 | Mead Johnson & Company | Methods of treating cardiovascular diseases with phenyltetrazolyloxy propanolamines |
| US4188388A (en) | 1977-04-28 | 1980-02-12 | Albert Rolland S.A. | Phenoxy pyridazinones and anorexigenic use thereof |
| US4233311A (en) | 1977-05-10 | 1980-11-11 | Bayer Aktiengesellschaft | Antimicrobial agents and their use |
| US4128664A (en) | 1977-05-16 | 1978-12-05 | Riker Laboratories, Inc. | Substituted benzamides as anti-inflammatory agents |
| US4133819A (en) | 1977-06-17 | 1979-01-09 | Pfizer Inc. | Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents |
| US4209520A (en) | 1977-06-17 | 1980-06-24 | Pfizer Inc. | Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents |
| US4232018A (en) | 1977-06-17 | 1980-11-04 | Pfizer Inc. | Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents |
| US4125612A (en) | 1977-06-20 | 1978-11-14 | Schering Corporation | N-1-(p-Biphenylalkyl)piperazines and their use as anti-inflammatory agents |
| US4314943A (en) | 1977-07-13 | 1982-02-09 | Mead Johnson & Company | Heterocyclic substituted aryloxy 3-indolyl-tertiary butylaminopropanols |
| US4147798A (en) | 1977-08-02 | 1979-04-03 | W. R. Grace & Co. | Antineoplastic agent |
| US4147872A (en) | 1977-09-13 | 1979-04-03 | Pfizer Inc. | 3-[2-Hydroxy-4-(substituted)-phenyl]azacycloalkanes and derivatives thereof as analgesic agents and intermediates therefor |
| US4306097A (en) | 1977-09-13 | 1981-12-15 | Pfizer Inc. | 3-[2-Hydroxy-4-(substituted)phenyl]-cycloalkanol analgesic agents |
| US4151297A (en) | 1977-10-31 | 1979-04-24 | Syntex (U.S.A.) Inc. | Bicyclo [3.1.0] hexyl-substituted ethylamino carbonyl phenoxy cardiovascular agents |
| US4145443A (en) | 1977-10-31 | 1979-03-20 | Syntex (U.S.A.) Inc. | Bicyclo 3.1.0!hexylethylaminocarbonyl-substituted naphthyloxy cardiovascular agents |
| US4123550A (en) | 1977-10-31 | 1978-10-31 | Syntex (U.S.A.) Inc. | Bicyclo[3.1.0]hexylethylaminocarbonyl-substituted heteroaryl cardiovascular agents |
| US4143054A (en) | 1977-11-04 | 1979-03-06 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane- and 7-oxabicycloheptene compounds |
| US4220594A (en) | 1977-11-04 | 1980-09-02 | E. R. Squibb & Sons, Inc. | Hexa- and octahydro-4,7-epoxyisobenzofuran-1-ol and hexa- and octahydro-5,8-epoxy-1H-2-benzopyran-3-ol |
| US4201778A (en) | 1977-11-08 | 1980-05-06 | Schering Corporation | 6-Acyloxy-1,4,6-pregnatrienes, their use as anti-inflammatory agents, methods for their manufacture, and 6-oxo-1,4-pregnadiene intermediates |
| US4324787A (en) | 1977-12-23 | 1982-04-13 | Troponwerke Gmbh & Co., Kg | 2-Oxo-1-pyrrolidineacetic acid compounds and their medicinal use |
| US4294828A (en) | 1978-01-20 | 1981-10-13 | Societe D'etudes Scientifiques Et Industrielles De L'ile De-France | New derivatives of 4-amino-5-alkyl sulphonyl orthoanisamides, methods of preparing them and their application as psychotropic agents |
| US4247710A (en) | 1978-02-08 | 1981-01-27 | Hoffmann-La Roche Inc. | Intermediate in the production of adrenergic blocking agents |
| US4329289A (en) | 1978-02-08 | 1982-05-11 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4446128A (en) | 1978-02-24 | 1984-05-01 | Ciba-Geigy Corporation | Antigen derivatives and processes for their preparation |
| US4231930A (en) | 1978-03-09 | 1980-11-04 | Shionogi & Co., Ltd. | 1-Substituted thiomethyltriazolobenzodiazepines |
| US4264499A (en) | 1978-03-09 | 1981-04-28 | Shionogi & Co., Ltd. | 1-Substituted thiomethyltriazolobenzodiazepines and production thereof |
| US4181720A (en) | 1978-04-05 | 1980-01-01 | Syntex (U.S.A.) Inc. | Corticosteroid antiinflammatory agents |
| US4304910A (en) | 1978-05-04 | 1981-12-08 | Kewanee Industries, Inc. | Quarnary ammonium polymeric anti-microbial agent |
| US4235908A (en) | 1978-05-24 | 1980-11-25 | John Wyeth & Brother Limited | 4-Aminoquinoline derivatives, useful as anti-inflammatory agents |
| US4177280A (en) | 1978-07-03 | 1979-12-04 | Syntex (U.S.A.) Inc. | Bicyclo[3.1.0]hexyl-substituted carbonylaminophenoxy cardiovascular agents |
| US4214089A (en) | 1978-07-18 | 1980-07-22 | American Home Products Corporation | Thiazolo[3,2-a]benzimidazoles, imidazo [2,1-b]thiazoles, and related compounds as antineoplastic agents, and enhancers of the immune response |
| US4277476A (en) | 1978-07-28 | 1981-07-07 | Synthelabo | Derivatives of fluorenes and fluoranthenes and process for their preparation |
| US4267328A (en) | 1978-08-01 | 1981-05-12 | Synthelabo | 1-Phenylpiperazines |
| US4322420A (en) | 1978-09-11 | 1982-03-30 | Sankyo Company Limited | Method of using 4-anilinoquinazoline derivatives as analgesic and anti-inflammatory agents |
| US4342769A (en) | 1978-10-02 | 1982-08-03 | Schering Corporation | 2-[(Methylsulfinyl)acetyl]-3-heterocyclicindoles and derivatives thereof as immunosuppressants |
| US4337199A (en) | 1978-11-01 | 1982-06-29 | Sanraku-Ocean Co., Ltd. | Antibiotic β-lactam compounds, production thereof, and their use as antimicrobial agent |
| US5066493A (en) | 1978-11-03 | 1991-11-19 | American Home Products Corporation | Rapamycin in treatment of tumors |
| US4173650A (en) | 1978-11-03 | 1979-11-06 | American Cyanamid Company | Cis-2-benzoyl-3-hydroxy-2-alkenonitriles as anti-inflammatory agents |
| US4355034A (en) | 1979-02-07 | 1982-10-19 | Merck & Co., Inc. | Ethenyl derivatives of mercaptoalkylpyridines as anti-inflammatory agents |
| US4477448A (en) | 1979-02-16 | 1984-10-16 | Sandoz Ltd. | Cephalosporin derivatives and use as antimicrobial agents |
| US4173634A (en) | 1979-02-23 | 1979-11-06 | E. R. Squibb & Sons, Inc. | Basically-substituted tricyclic pyrazoles useful as antiinflammatory agents |
| US4234593A (en) | 1979-03-20 | 1980-11-18 | Stauffer Chemical Company | 3-(N-Alkylcarbamyl)-5-(carboalkoxy)-1,3,4-oxadiazole-2-thiones and their use as anti-inflammatory agents |
| US4226887A (en) | 1979-04-16 | 1980-10-07 | Eli Lilly And Company | Anti-inflammatory agents |
| US4358451A (en) | 1979-04-26 | 1982-11-09 | Synthelabo | Pyrimido- and imidazo-pyridoindole derivatives |
| US4244955A (en) | 1979-04-30 | 1981-01-13 | Richardson-Merrell Inc. | 2,4a-Ethanobenz[g]isoquinolin-5(1H)-ones and their use as anti-fertility and analgesic agents |
| US4308283A (en) | 1979-06-18 | 1981-12-29 | International Minerals & Chemical Corp. | Antimicrobial agents |
| US4260634A (en) | 1979-06-18 | 1981-04-07 | International Minerals & Chemical Corp. | Antimicrobial agents |
| US4489085A (en) | 1979-08-04 | 1984-12-18 | Bayer Aktiengesellschaft | Antimicrobial agents and their use employing imidazolyl-enal ethers |
| US4283394A (en) | 1979-08-06 | 1981-08-11 | Research Corporation | Cytotoxic nucleoside-corticosteroid phosphodiesters |
| US4317825A (en) | 1979-08-08 | 1982-03-02 | Sumitomo Chemical Company, Limited | Antitumor and immunosuppressive 4-carbamoyl imidazolium-5-olate derivatives |
| US4450159A (en) | 1979-08-08 | 1984-05-22 | The Upjohn Company | Carbamic acid derivatives as selective immunosuppresive agents |
| US4285873A (en) | 1979-09-06 | 1981-08-25 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4278608A (en) | 1979-09-06 | 1981-07-14 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4281189A (en) | 1979-09-06 | 1981-07-28 | Hoffmann-La Roche Inc. | Sulfonamide intermediates for adrenergic blocking agents |
| US4304721A (en) | 1979-09-06 | 1981-12-08 | Hoffmann-La Roche Inc. | Adrenergic blocking agents |
| US4346096A (en) | 1979-09-20 | 1982-08-24 | Sumitomo Chemical Company, Limited | Antitumor and immunosuppressive 4-carbamoyl imidazolium-5-olate derivatives and pharmaceutical composition thereof |
| US4244963A (en) | 1979-09-27 | 1981-01-13 | Merck & Co., Inc. | 1-[2-(Alkyl and arylsulfonyl)-2-propenyl and propyl] substituted piperidines useful as antimicrobial and antiinflammatory agents |
| US4518608A (en) | 1979-09-27 | 1985-05-21 | Medimpex Gyogyszerkuelkereskedelmi Vaallalat | Watersoluble derivatives of non-steroidal anti-inflammatory agents and a process for the production thereof |
| US4397853A (en) | 1979-11-28 | 1983-08-09 | Yoshitomi Pharmaceutical Industries Ltd. | Isoxazole derivatives |
| US4252816A (en) | 1979-12-03 | 1981-02-24 | Merck & Co., Inc. | Tetrahydro-1H-1,4-diazepino(1,7-a)benzimidazoles useful as analgesic agents |
| US4395559A (en) | 1979-12-07 | 1983-07-26 | Hoffmann-La Roche Inc. | 2,3-Indoledione derivatives |
| US4335141A (en) | 1979-12-26 | 1982-06-15 | Merck & Co., Inc. | 2-Substituted-aminopropene-and propanenitrile antimicrobial and anti-inflammatory agents |
| US4311709A (en) | 1979-12-26 | 1982-01-19 | Merck & Co., Inc. | Loweralkyl substituted diphenyl polyamine as an antimicrobial agent |
| US4363808A (en) | 1980-02-11 | 1982-12-14 | Berlex Laboratories, Inc. | N-(3-Phenoxy-2-hydroxypropyl)benzimidazole-1-alkanamines |
| US4482562A (en) | 1980-02-13 | 1984-11-13 | Kowa Company, Ltd. | Aromatic aminoethanol compounds, and utilization thereof as cardiovascular agents |
| US4251530A (en) | 1980-02-19 | 1981-02-17 | Merck & Co., Inc. | 2-{[4-(6-Substituted-2-pyrazinyl)-1-piperazinyl]alkyl}-5-substituted-1,2,4-triazolo[4,3-a]pyridin-3(2H)-one analgesic agents |
| US4294763A (en) | 1980-03-05 | 1981-10-13 | University Of Rochester | Intermediates for the production of picropodophyllin and related compounds and processes for the preparation and use thereof |
| US4391982A (en) | 1980-03-05 | 1983-07-05 | The University Of Rochester | Intermediates for the production of picropodophyllin and related compounds and processes for the preparation and use thereof |
| US4399283A (en) | 1980-03-11 | 1983-08-16 | Warner Lambert Company | Pharmaceutical salts of 4'-(9-acridinylamino)-methanesulfon-m-anisidide |
| US4459306A (en) | 1980-04-10 | 1984-07-10 | Science Union Et Cie | Tricyclic ethers, their process of preparation and their use as medicines |
| US4722899A (en) | 1980-04-11 | 1988-02-02 | Toshiyuki Hamaoka | Producing highly specific, low cross-reactive antibody by immunizing with copolymer of D-glutamic acid and lysine |
| US4870093A (en) | 1980-05-16 | 1989-09-26 | Bayer Aktiengesellschaft | Antimicrobial agents and their use |
| US4590180A (en) | 1980-05-21 | 1986-05-20 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Use of adenosine derivatives as psychopharmacological agents |
| US4361583A (en) | 1980-08-19 | 1982-11-30 | Synthelabo | Analgesic agent |
| US4391827A (en) | 1980-09-08 | 1983-07-05 | Pfizer Inc. | 3-(2-Hydroxy-4-(substituted)phenyl)-cycloalkanone and cycloalkanol analgesic agents and intermediates therefor |
| US4395402A (en) | 1980-09-24 | 1983-07-26 | Zaidan Hojin Biseibutsu Kagaku Kankyu Kai | Analgesic agent |
| US4568679A (en) | 1980-12-23 | 1986-02-04 | Merck & Co., Inc. | Aralkylaminoethanol heterocyclic compounds |
| US4400534A (en) | 1980-12-23 | 1983-08-23 | Sankyo Company, Limited | Analgesic and anti-inflammatory agents |
| US4599228A (en) | 1981-01-19 | 1986-07-08 | Vipont Laboratories, Inc. | Antimicrobial agent |
| US4520026A (en) | 1981-02-06 | 1985-05-28 | S. A. Labaz N.V. | Indolizine derivatives and use as cardiovascular agents |
| US4470994A (en) | 1981-02-07 | 1984-09-11 | Bayer Aktiengesellschaft | Antimicrobial agents and their use |
| US4412995A (en) | 1981-02-19 | 1983-11-01 | Sterling Drug Inc. | Pentacyclic phenylpyrazole compounds as anti-inflammatory agents |
| US4370484A (en) | 1981-03-12 | 1983-01-25 | The Regents Of The University Of California | Sceptrin an antimicrobial agent from Agelas sceptrum |
| US4440763A (en) | 1981-03-18 | 1984-04-03 | Block Drug Company, Inc. | Use of 4-aminosalicyclic acid as an anti-inflammatory agent |
| US4524147A (en) | 1981-03-24 | 1985-06-18 | Mitsui Toatsu Chemicals, Incorporated | Uracil derivatives, process for preparing same, and pharmaceutical compositions comprising same |
| US4629793A (en) | 1981-04-10 | 1986-12-16 | Toyo Jozo Kabushiki Kaisha | 2,3-di-substituted-5,6-dihydroimidazo [2,1-b] thiazole, its salts, production thereof and anti-inflammatory agent containing the same |
| US4556669A (en) | 1981-04-10 | 1985-12-03 | Kumiai Kagaku Kogyo Kabushiki Kaisha | 2,-3-Di-substituted-5,6-dihydroimidazo [2,1-b] thiazole, its salts, production thereof and anti-inflammatory agent containing the same |
| US4501755A (en) | 1981-05-01 | 1985-02-26 | Pennwalt Corporation | Isoflavones useful as anti-inflammatory agents |
| US4440779A (en) | 1981-06-30 | 1984-04-03 | Merck & Co., Inc. | Tricyclic derivatives of substituted pyrrole acids as analgesic and anti-inflammatory agents |
| US4568762A (en) | 1981-07-01 | 1986-02-04 | Hoffmann-La Roche Inc. | 4-Methyl-2-oxo-cyclopentylidene acetic acid and esters thereof |
| US4443451A (en) | 1981-07-15 | 1984-04-17 | Janssen Pharmaceutica N.V. | Bicyclic pyrimidin-5-one derivatives |
| US4548938A (en) | 1981-07-15 | 1985-10-22 | Janssen Pharmaceutica N.V. | 5-H-1,3,4-thiadiazolo[3,2-a]pyrimidin-5-one compounds |
| US4434175A (en) | 1981-08-10 | 1984-02-28 | Merck & Co., Inc. | Nonsteroidal compounds as anti-inflammatory and analgesic agents |
| US4490540A (en) | 1981-09-14 | 1984-12-25 | Janssen Pharmaceutica N.V. | (2-Aryl-4-phenylthioalkyl-1,3-dioxolan-2-ylmethyl)azole derivatives |
| US4410696A (en) | 1981-09-24 | 1983-10-18 | Sumitomo Chemical Company, Limited | Antitumor and immunosuppressive 4-carbamoylimidazolium-5-olate derivatives |
| US4623648A (en) | 1981-09-25 | 1986-11-18 | Lacer, S.A. | 1-azaxanthone for use as therapeutic agent as an antipyretic, analgesic, anti-inflammatory and bronchodilator |
| US4514415A (en) | 1981-10-28 | 1985-04-30 | Ciba Geigy Corporation | Benzofuran-2(3H)-ones used as anti-inflammatory agents |
| US4374139A (en) | 1981-11-09 | 1983-02-15 | Hoffmann-La Roche Inc. | Levorotatory N-substituted acylmorphinans useful as analgesic agents |
| US4537981A (en) | 1981-11-09 | 1985-08-27 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane and 7-oxabicycloheptene compounds |
| US4567201A (en) | 1981-11-25 | 1986-01-28 | Takeda Chemical Industries, Ltd. | Diphenoxypropane derivatives and compositions of antiasthmatic and antiinflammatory agents thereof |
| US4469690A (en) | 1981-12-08 | 1984-09-04 | Smithkline Beckman Corporation | Synergistic compositions of renal dopaminergic agent and β-blocker |
| US4536503A (en) | 1981-12-14 | 1985-08-20 | Syntex (U.S.A.) Inc. | Naphthoxyalkylamines and related compounds as antiinflammatory agents |
| US4891370A (en) | 1981-12-14 | 1990-01-02 | Merck & Co., Inc. | Cephalosporin derivatives as anti-inflammatory agents |
| US4578390A (en) | 1981-12-14 | 1986-03-25 | Merck & Co., Inc. | Hydroxybenzylamino derivatives as anti-inflammatory agents |
| US4383994A (en) | 1982-01-19 | 1983-05-17 | Mccully Kilmer S | Homocysteine thiolactone salts and use thereof as anti-neoplastic agents |
| US4487776A (en) | 1982-02-11 | 1984-12-11 | Bayer Aktiengesellschaft | Azolyl-phenoxy-tetrahydrofuran-2-ylidene-methanes, a process for their preparation, and antimicrobial agents which contain these substances |
| US4512990A (en) | 1982-02-18 | 1985-04-23 | Syntex (U.S.A.), Inc. | Benzthiazine analogs as antiinflammatory agents |
| US4435420A (en) | 1982-04-12 | 1984-03-06 | Merrell Dow Pharmaceuticals | Anti-inflammatory agents and antiasthmatic agents |
| US4886790A (en) | 1982-04-12 | 1989-12-12 | The Research Foundation Of State University Of New York | Novel bis(2,2-dimethyl-1-aziridinyl) phosphinic amides for use in the treatment of tumors |
| US4544501A (en) | 1982-04-12 | 1985-10-01 | The Research Foundation Of State University Of New York | Bis(2,2-dimethyl-1-aziridinyl)phosphinic amides for use in the treatment of tumors |
| US4529727A (en) | 1982-04-21 | 1985-07-16 | Janssen Pharmaceutical, N.V. | Pyrimido[2,1-b][1,3]-thiazines |
| US4472411A (en) | 1982-04-22 | 1984-09-18 | Taisho Pharmaceutical Co., Ltd. | 1,4-Dihydropyridine derivatives and use as vasodilators |
| US4418076A (en) | 1982-05-03 | 1983-11-29 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane hydrazone prostaglandin analogs useful in treating thrombolytic diseases |
| US4474807A (en) | 1982-05-06 | 1984-10-02 | Henkel Kommandigesellschaft Auf Aktien | 2-(3-Iodo-2-propynyloxy)-ethyl carbamates, the preparation thereof, and their use as antimicrobial agents |
| US4474806A (en) | 1982-05-10 | 1984-10-02 | Merck & Co., Inc. | Sulfonyl or carbonyl inositol derivatives useful as anti-inflammatory/analgesic agents |
| US4537904A (en) | 1982-05-17 | 1985-08-27 | E. R. Squibb & Sons, Inc. | Compositions of 7-oxabicycloheptane and 7-oxabicycloheptene compounds and a method for their use in inhibiting bronchoconstriction |
| US4556675A (en) | 1982-05-17 | 1985-12-03 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane and 7-oxabicycloheptene compounds |
| US4614825A (en) | 1982-05-17 | 1986-09-30 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane and 7-oxabicycloheptene compounds |
| US4416896A (en) | 1982-05-17 | 1983-11-22 | E. R. Squibb & Sons, Inc. | 7-Oxabicyclopheptane substituted amino prostaglandin analogs useful in the treatment of thrombolytic disease |
| US4495197A (en) | 1982-05-24 | 1985-01-22 | Merck & Co., Inc. | N-Carboxyl-thienamycin esters and analogs thereof as anti-inflammatory agents |
| US4493839A (en) | 1982-05-24 | 1985-01-15 | Merck & Co., Inc. | 1-Carbapenem-3-carboxylic esters as anti-inflammatory agents |
| US4465687A (en) | 1982-05-24 | 1984-08-14 | Merck & Co., Inc. | Thienamycin derivatives as anti-inflammatory agents |
| US4511724A (en) | 1982-06-10 | 1985-04-16 | Merck & Co., Inc. | 5-(Pyrrol-2-oyl)-1,2-dihydro-3H-pyrrolo [1,2-a]pyrrole derivatives as anti-inflammatory and analgesic agents |
| US4424202A (en) | 1982-06-11 | 1984-01-03 | The Vinoxen Company, Inc. | Azelaaldehydates as psychotropic agents |
| US4440781A (en) | 1982-06-11 | 1984-04-03 | The Vinoxen Company, Inc. | Oxyoctadecanoates as psychotropic agents |
| US4427694A (en) | 1982-06-11 | 1984-01-24 | The Vinoxen Company, Inc. | Sesamin as a psychotropic agent |
| US4463015A (en) | 1982-08-18 | 1984-07-31 | E. R. Squibb & Sons, Inc. | Aryl substituted 7-oxabicycloheptane compounds, useful in inhibiting platelet aggregation |
| US4539326A (en) | 1982-08-20 | 1985-09-03 | Takeda Chemical Industries, Ltd. | 5-Oxo-5H-(1)benzopyrano(2,3-b)pyridine derivatives, their production and use as anti-inflammatory agents |
| US4489098A (en) | 1982-09-28 | 1984-12-18 | The Dow Chemical Company | 2,2,3-Trihalopropionaldehydes as antimicrobial agents |
| US4631283A (en) | 1982-09-30 | 1986-12-23 | Ortho Pharmaceutical Corporation | Ortho substituted dihydroxy-2(1H)quinazolinone-1-alkanoic acids |
| US4533671A (en) | 1982-10-08 | 1985-08-06 | Merck & Co., Inc. | 5-(2,3-Dihydro-1H-pyrrolizin-5-oyl)-2-alkanoic or carboxylic acids and analogs as anti-inflammatory and analgesic agents |
| US4536512A (en) | 1982-10-08 | 1985-08-20 | Merck & Co., Inc. | 5-(2,3-Dihydro-1H-pyrrolizin-5-oyl)-2,3-dihydro-1H-pyrrolizine-1-alkanoic or carboxylic acids and use thereof as anti-inflammatory and analgesic agents |
| US4456615A (en) | 1982-10-25 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4560684A (en) | 1982-12-21 | 1985-12-24 | Shionogi & Co., Ltd. | 1,4-Benzodiazepine derivatives |
| US4456616A (en) | 1982-12-27 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4456617A (en) | 1983-01-12 | 1984-06-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4466979A (en) | 1983-01-21 | 1984-08-21 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted carbamate prostaglandin analogs useful in treating platelet aggregation and bronchoconstriction |
| US4559348A (en) | 1983-03-09 | 1985-12-17 | Beecham Group, P.L.C. | 5- And/or 7-substituted pyrazolo-[4,3-b]-pyridines and their use as antiinflammatory agents |
| US4582854A (en) | 1983-03-14 | 1986-04-15 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted oxa prostaglandin analgos useful in the treatment of thrombolytic disease |
| US4474803A (en) | 1983-03-14 | 1984-10-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thio prostaglandin analogs useful in treating platelet aggregation and bronchoconstriction |
| US4617314A (en) | 1983-04-08 | 1986-10-14 | Yoshitomi Pharmaceutical Industries Ltd. | Benzofuran- and benzopyran-carboxamide derivatives |
| US4595686A (en) | 1983-04-21 | 1986-06-17 | Hexachimie | Niflumic acid morpholinoethyl ester diniflumate, use as analgesic and anti-inflammatory agents and compositions |
| US4517188A (en) | 1983-05-09 | 1985-05-14 | Mead Johnson & Company | 1-Pyrimidinyloxy-3-hetaryl-alkylamino-2-propanols |
| US4680298A (en) | 1983-05-31 | 1987-07-14 | Schering Corporation | Tricyclic anti-allergy and use as anti-inflammatory agents |
| US4614741A (en) | 1983-07-05 | 1986-09-30 | Troponwerke Gmbh & Co., Kg | Depot antiinflammatory agents |
| US4594357A (en) | 1983-07-05 | 1986-06-10 | Troponwerke Gmbh & Co. | Depot antiinflammatory agents |
| US4552882A (en) | 1983-07-06 | 1985-11-12 | Provesan, Sa | 7-(1-Pyrrolyl) derivatives of 1-ethyl-1,4-dihydro-4-oxoquinoline-3-carboxylic acids and 1-ethyl-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylic acids and their use as antimicrobial agents |
| US4550186A (en) | 1983-07-11 | 1985-10-29 | Duke University | Binuclear copper (II) carboxylates formed from amine-carboxyboranes |
| US4541956A (en) | 1983-07-28 | 1985-09-17 | Unique Technologies, Inc. | Tin steroids and their use as antineoplastic agents |
| US4721796A (en) | 1983-08-05 | 1988-01-26 | Hayward Lloyl D | Nitrates of D-isoidide |
| US4599360A (en) | 1983-08-10 | 1986-07-08 | Sankyo Company Limited | Ophthalmic anti-inflammatory agents |
| US4595694A (en) | 1983-08-24 | 1986-06-17 | Kotobuki Seiyaku Co. Ltd. | Azulene derivatives, processes of their synthesis and their uses as anti-ulcerative and anti-inflammatory agents |
| US4479953A (en) | 1983-08-25 | 1984-10-30 | Merck & Co., Inc. | Pyrazine aldimine compounds as antimicrobial agents |
| US4525479A (en) | 1983-08-29 | 1985-06-25 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thiocarbamate prostaglandin analogs useful as cardiovascular agents |
| US4645836A (en) | 1983-09-12 | 1987-02-24 | Ortho Pharmaceutical Corporation | Process for the preparation of 6,7-dihydroxy-4-alkyl-2(1H) quinazolinone-1-propionic acids |
| US4474804A (en) | 1983-09-19 | 1984-10-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicyclo substituted prostaglandin phenyl carboxylic acid derivatives useful as cardiovascular agents |
| US4555570A (en) | 1983-09-29 | 1985-11-26 | Ortho Pharmaceutical Corporation | Substituted 4-alkyl-2-(1H) quinazolinone-1-alkanoic acid derivatives |
| US4555571A (en) | 1983-09-29 | 1985-11-26 | Ortho Pharmaceutical Corporation | Substituted 2(1H)-quinazolinone-1-alkanoic acids and esters |
| US4556739A (en) | 1983-09-29 | 1985-12-03 | Ortho Pharmaceutical Corporation | 3,4-Dialkoxy-2-alkylcarbonyl analino compounds |
| US4656267A (en) | 1983-09-29 | 1987-04-07 | Ortho Pharmaceutical Corporation | Substituted 2(1H)-quinazolinone-1-alkanoic acids and esters |
| US4613600A (en) | 1983-09-30 | 1986-09-23 | Mead Johnson & Company | Antidepressant 1,2,4-triazolone compounds |
| US4774256A (en) | 1983-10-03 | 1988-09-27 | E. R. Squibb & Sons, Inc. | Use of enkephalinase inhibitors as analgesic agents |
| US4778818A (en) | 1983-10-12 | 1988-10-18 | Merck & Co., Inc. | Substituted 2-(heteroaryl-2-propenyl)phenols useful as anti-inflammatory agents |
| US4537903A (en) | 1983-10-12 | 1985-08-27 | Merck & Co., Inc. | Substituted cinnamyl-2,3-dihydrobenzofuran and analogs useful as anti-inflammatory agents |
| US4686235A (en) | 1983-10-12 | 1987-08-11 | Merck & Co., Inc. | Substituted cinnamyl-2,3-dihydrobenzofuran and analogs useful as anti-inflammatory agents |
| US4522949A (en) | 1983-10-20 | 1985-06-11 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin interphenylene analogs useful as cardiovascular agents |
| US4492700A (en) | 1983-10-24 | 1985-01-08 | Merck & Co., Inc. | 3-Halo-2-thiopyrazines as antimicrobial agents |
| US4649139A (en) | 1983-10-27 | 1987-03-10 | Burroughs Wellcome Co. | 1,2,4-triazines |
| US4667039A (en) | 1983-11-07 | 1987-05-19 | Hoechst-Roussel Pharmaceuticals Inc. | 11-substituted 5H,11H-pyrrolo(2,1-C) (1,4)benzoxazepines as antipsychotic and analgesic agents |
| US4608374A (en) | 1983-11-07 | 1986-08-26 | Hoechst-Roussel Pharmaceuticals Inc. | 11-substituted 5H,11H-pyrrolo[2,1-c][1,4]benzoxazepines as antipsychotic and analgesic agents |
| US4681879A (en) | 1983-11-07 | 1987-07-21 | Hoechst-Roussel Pharmaceuticals Inc. | 11-substituted 5H,11H-pyrrolo[2,1-c][1,4]benzoxazepines as antipsychotic and analgesic agents |
| US4524151A (en) | 1983-11-14 | 1985-06-18 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane thio ethers useful as cardiovascular agents |
| US4563476A (en) | 1983-11-21 | 1986-01-07 | Merck & Co., Inc. | Substituted 5-hydroxy-2,3-dihydrobenzofurans and analogs thereof useful as anti-inflammatory agents |
| US4652564A (en) | 1983-12-14 | 1987-03-24 | Schering Corporation | Substituted spiro pyridine derivatives as anti-allergy and antiinflammatory agents |
| US4532327A (en) | 1983-12-28 | 1985-07-30 | The United States Of America As Represented By The Secretary Of Agriculture | Sesbanimide and the use thereof in treating leukemic tumors |
| US4634708A (en) | 1984-01-25 | 1987-01-06 | Sandoz Ltd. | Indolophenanthridines useful as dopaminergic and analgesic agents |
| US4526900A (en) | 1984-01-26 | 1985-07-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4533673A (en) | 1984-01-26 | 1985-08-06 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted enaminone prostaglandin analogs and their use in treatment of thrombolytic disease |
| US4526901A (en) | 1984-01-26 | 1985-07-02 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxamide prostaglandin analogs and their use in treating thrombolytic disease |
| US4658037A (en) | 1984-02-07 | 1987-04-14 | Pfizer Inc. | Intermediates for 1,3-disubstituted 2-oxindoles as analgesic and antiinflammatory agents |
| US4748018A (en) | 1984-02-07 | 1988-05-31 | Stolle Research & Development Corp. | Method of passive immunization of mammals using avian antibody |
| US4593029A (en) | 1984-02-15 | 1986-06-03 | Syntex (U.S.A.) Inc. | Novel ω-(N-imidazolyl)alkyl ethers of 1,2,3,5-tetrahydroimidazo[2,1-b]quinazolin-2-ones |
| US4558067A (en) | 1984-03-01 | 1985-12-10 | Merck & Co., Inc. | Phenylthiomethyl-6-hydroxy-2,3-dihydrobenzo-pyran and analogs thereof useful as anti-inflammatory agents |
| US5482961A (en) | 1984-03-14 | 1996-01-09 | Bodor; Nicholas S. | Soft β-adrenergic blocking agents |
| US5334601A (en) | 1984-03-14 | 1994-08-02 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US4536513A (en) | 1984-03-14 | 1985-08-20 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin interphenylene analogs useful in the treatment of thrombolytic disease |
| US5576332A (en) | 1984-03-14 | 1996-11-19 | Bodor; Nicholas S. | Soft β-drenegic blocking agents |
| US4829086A (en) | 1984-03-14 | 1989-05-09 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US5202347A (en) | 1984-03-14 | 1993-04-13 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US5135926A (en) | 1984-03-14 | 1992-08-04 | Bodor Nicholas S | Soft β-adrenergic blocking agents |
| US4556672A (en) | 1984-03-19 | 1985-12-03 | Pfizer Inc. | 3-Substituted 2-oxindole-1-carboxamides as analgesic and anti-inflammatory agents |
| US4542155A (en) | 1984-04-02 | 1985-09-17 | E. R. Squibb & Sons, Inc. | Tetrahydrofuranyl substituted prostaglandin analogs |
| US4536514A (en) | 1984-04-06 | 1985-08-20 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombolytic disease |
| US4579867A (en) | 1984-04-09 | 1986-04-01 | American Hospital Supply Corporation | Stable pharmaceutical compositions of short-acting β-adrenergic receptor blocking agents |
| US4550187A (en) | 1984-04-12 | 1985-10-29 | The Research Foundation Of State University Of New York | Synthesis of platinum (IV) antineoplastic agents |
| US4542156A (en) | 1984-04-26 | 1985-09-17 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted prostaglandin alcohols and their use in the treatment of thrombolytic disease |
| US4542157A (en) | 1984-04-27 | 1985-09-17 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4550120A (en) | 1984-04-30 | 1985-10-29 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted ethers and their use in treating thrombolytic disease |
| US4569942A (en) | 1984-05-04 | 1986-02-11 | Pfizer Inc. | N,3-Disubstituted 2-oxindole-1-carboxamides as analgesic and antiinflammatory agents |
| US4521539A (en) | 1984-05-10 | 1985-06-04 | E. R. Squibb & Sons, Inc. | Tetrahydrofuranyl substituted ethers |
| US4645773A (en) | 1984-05-15 | 1987-02-24 | Schering Aktiengesellschaft | β-carboline-3-oxadiazolyl derivatives, and their use as psychotropic agents |
| US4631285A (en) | 1984-05-15 | 1986-12-23 | Schering Aktiengesellschaft | β-Carboline-3-carboxylic acid derivatives, and their use as psychotropic agents |
| US4719231A (en) | 1984-05-25 | 1988-01-12 | Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai | 3-[N-(mercaptoacyl)]amino-4-arylbutanoic acid derivatives and an analgesic agent comprising the same |
| US4579866A (en) | 1984-05-29 | 1986-04-01 | Usv Pharmaceutical Corp. | Phenylacetamides as anti-allergy, anti-asthma and anti-inflammatory agents |
| US4560698A (en) | 1984-06-04 | 1985-12-24 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thio prostaglandin analogs and their use in the treatment in thrombolytic disease |
| US4555523A (en) | 1984-06-04 | 1985-11-26 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted thio prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4647565A (en) | 1984-06-07 | 1987-03-03 | Pfizer Inc. | 2-(2-quinazolinylaminoalkoxymethyl)-1,4-dihydropyridine derivatives as cardiovascular agents |
| US4721712A (en) | 1984-06-12 | 1988-01-26 | Pfizer Inc. | 1,3-disubstituted 2-oxindoles as analgesic and anti-inflammatory agents |
| US5310731A (en) | 1984-06-28 | 1994-05-10 | Whitby Research, Inc. | N-6 substituted-5'-(N-substitutedcarboxamido)adenosines as cardiac vasodilators and antihypertensive agents |
| US4853391A (en) | 1984-06-30 | 1989-08-01 | Guy Nadler | Pyrido[1,2-a]indoles and their use as cardiovascular |
| US4552866A (en) | 1984-07-05 | 1985-11-12 | E. R. Squibb & Sons, Inc. | Use of diamino alcohols as analgesic agents |
| US4670541A (en) | 1984-07-05 | 1987-06-02 | E. R. Squibb & Sons, Inc. | Use of diamino alcohols as analgesic agents |
| US4594188A (en) | 1984-07-11 | 1986-06-10 | E. R. Squibb & Sons, Inc. | Use of diamino ketones as analgesic agents |
| US4539312A (en) | 1984-07-11 | 1985-09-03 | E. R. Squibb & Sons, Inc. | Use of diamino ketones as analgesic agents |
| US4730052A (en) | 1984-07-13 | 1988-03-08 | Taisho Pharmaceutical Co., Ltd. | Method for preparing unsymmetrical 1,4-dihydropyridine-3,5-dicarboxylic acid diesters |
| US4542160A (en) | 1984-07-30 | 1985-09-17 | E. R. Squibb & Sons, Inc. | Method of use of bicycloheptane substituted prostaglandin analogs as cardiovascular agents |
| US4611066A (en) | 1984-08-10 | 1986-09-09 | Arizona State University | Bryostatins 4 to 8 |
| US4632923A (en) | 1984-08-15 | 1986-12-30 | Schering Corporation | Substituted hetero spiro pyridine derivatives as anti-allergy and anti-inflammatory agents |
| US4695571A (en) | 1984-08-24 | 1987-09-22 | Pfizer Inc. | Tricyclic oxindole antiinflammatory agents |
| US4749792A (en) | 1984-09-26 | 1988-06-07 | E. R. Squibb & Sons, Inc. | Diamino ketones and alcohols as analgesic agents |
| US4762837A (en) | 1984-10-19 | 1988-08-09 | Godecke Aktiengesellschaft | 4-alkoxy-pyrido[2,3-d]pyrimidine derivatives for treatment of myocardiac ischemia |
| US4681882A (en) | 1984-10-19 | 1987-07-21 | Godecke Aktiengesellschaft | 4-alkoxy-pyrido[2,3-d]pyrimidine derivatives |
| US4686224A (en) | 1984-10-31 | 1987-08-11 | Pfizer Inc. | Oxindole antiinflammatory agents |
| US4644005A (en) | 1984-10-31 | 1987-02-17 | Pfizer Inc. | Oxindole antiinflammatory agents |
| US4575512A (en) | 1984-11-01 | 1986-03-11 | E. R. Squibb & Sons, Inc. | 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their anti-thrombotic compositions and methods |
| US4690930A (en) | 1984-11-05 | 1987-09-01 | Shionogi & Co., Ltd | Pyrazolo[4,3-c]quinoline-3-one and imidazo[4,3-c]cinnolin-3-one derivatives and their use as psychotropic agents |
| US4647585A (en) | 1984-11-08 | 1987-03-03 | E. R. Squibb & Sons, Inc. | Bicycloheptane substituted ethers |
| US4650874A (en) | 1984-11-26 | 1987-03-17 | G. D. Searle & Co. | N-(aralkoxybenzyl)-4(benzhydryl) piperidines |
| US4661506A (en) | 1984-11-30 | 1987-04-28 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted ox prostaglandin analogs |
| US4638011A (en) | 1984-12-17 | 1987-01-20 | E. R. Squibb & Sons, Inc. | Tetrahydrothienyl substituted prostaglandin analogs |
| US4542151A (en) | 1984-12-17 | 1985-09-17 | E. R. Squibb & Sons, Inc. | Tetrahydrothienyl substituted ethers |
| US4684747A (en) | 1984-12-20 | 1987-08-04 | Yale University | N,N'-bis(sulfonyl)hydrazines having antineoplastic activity |
| US4892887A (en) | 1984-12-20 | 1990-01-09 | Yale University | N,N'-bis(sulfonyl)hydrazines having antineoplastic activity |
| US4720484A (en) | 1985-01-07 | 1988-01-19 | Adir S.A.R.L. | Peptide compounds having a nitrogenous polycyclic structure |
| US4588743A (en) | 1985-01-22 | 1986-05-13 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane-substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease |
| US4760051A (en) | 1985-01-24 | 1988-07-26 | Pickart Loren R | Use of GHL-Cu as a wound-healing and anti-inflammatory agent |
| US4588742A (en) | 1985-02-20 | 1986-05-13 | E. R. Squibb & Sons, Inc. | Thiabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4591603A (en) | 1985-02-25 | 1986-05-27 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4588741A (en) | 1985-02-28 | 1986-05-13 | E. R. Squibb & Sons, Inc. | Platelet aggregation inhibiting and bronchoconstriction inhibiting thiabicycloheptane substituted amino prostaglandin analog derivatives, compositions, and method of use therefor |
| US4845216A (en) | 1985-03-08 | 1989-07-04 | The Trustees Of Princeton University | Pyrido [2,3,d]pyrimidine derivatives |
| US4927828A (en) | 1985-03-08 | 1990-05-22 | The Trustees Of Princeton University | Diastereoisomeric tetrahydropyrido-(2,3,d) pyrimidine derivatives |
| US4855318A (en) | 1985-03-21 | 1989-08-08 | Bayer Aktiengesellschaft | Iodopropargyl ethers useful as antimicrobial agents |
| US4596828A (en) | 1985-03-28 | 1986-06-24 | Merck & Co., Inc. | [(2-hydroxy-5-alkoxyphenyl)methylthio]phenylmethanol and derivatives thereof useful as anti-inflammatory agents |
| US4611007A (en) | 1985-04-22 | 1986-09-09 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US4607049A (en) | 1985-04-22 | 1986-08-19 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted thio prostaglandin analogs useful in the treatment of thrombolytic disease |
| US4713393A (en) | 1985-04-25 | 1987-12-15 | Merck & Co., Inc. | Phenylpropyl-2,3-dihydrobenzofurans useful as anti-inflammatory agents |
| US4775679A (en) | 1985-04-25 | 1988-10-04 | Merck & Co., Inc. | Certain heterocyclic-ethyl-2,3-dihydrobenzofurans useful as anti-inflammatory agents |
| US4608386A (en) | 1985-04-26 | 1986-08-26 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane ethers useful in the treatment of thrombotic diseases |
| US4585755A (en) | 1985-04-29 | 1986-04-29 | Merck & Co., Inc. | Cyclic and bridged cyclic somatostatin analogs useful as local anti-inflammatory agents |
| US4748153A (en) | 1985-04-29 | 1988-05-31 | Merck & Co., Inc. | Compounds having somatostatin-like activity useful as local anti-inflammatory agents |
| US4788188A (en) | 1985-05-06 | 1988-11-29 | Sanofi (S.A.) | Quinolylglycinamide derivatives, the process for preparation thereof and their therapeutic application as psychotropic drugs |
| US4607048A (en) | 1985-05-16 | 1986-08-19 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted aryl amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction |
| US4595692A (en) | 1985-05-17 | 1986-06-17 | E. R. Squibb & Sons, Inc. | 7-thiabicycloheptane substituted ethers |
| US4611005A (en) | 1985-05-21 | 1986-09-09 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US5202330A (en) | 1985-06-03 | 1993-04-13 | E. R. Squibb & Sons, Inc. | 2-thio or oxo-4-aryl or heterocyclo-1,5(2H)-pyrimidinedicarboxylic acid diesters and 3-acyl-5-pyrimidinecarboxylic acids and esters |
| US5026712A (en) | 1985-06-05 | 1991-06-25 | Schering Ag | Novel imidazo[1,5-a]pyridines, useful as cardiovascular and CNS agents |
| US4628095A (en) | 1985-06-05 | 1986-12-09 | G. D. Searle & Co. | Substituted N-benzyl-4-(benzhydryl) piperidines |
| US4996229A (en) | 1985-06-06 | 1991-02-26 | University Of Hawaii | Scytophycins |
| US4863955A (en) | 1985-06-06 | 1989-09-05 | Eli Lilly And Company | Scytophycins |
| US4609671A (en) | 1985-06-27 | 1986-09-02 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted amino prostaglandin analogs useful in the treatment of thrombotic disease |
| US4611006A (en) | 1985-06-28 | 1986-09-09 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted ethers useful in the treatment of thrombotic disease |
| US4737493A (en) | 1985-07-01 | 1988-04-12 | Warner-Lambert Company | 7-((substituted)amino)-8-((substituted)carbonyl)-methylamino)-1-oxaspiro(4,5)decanes as analgesic agents |
| US4663336A (en) | 1985-07-01 | 1987-05-05 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted diamide and its congener prostaglandin analogs useful in the treatment of thrombotic disease |
| US4998931A (en) | 1985-07-05 | 1991-03-12 | Puget Sound Blood Center | Method of reducing immunogenicity and inducing immunologic tolerance |
| US4725616A (en) | 1985-07-09 | 1988-02-16 | Pfizer Inc. | 1,3-dicarboxamide-oxindoles as antiinflammatory agents |
| US4678802A (en) | 1985-07-09 | 1987-07-07 | Pfizer Inc. | 1-acylcarbamoyloxindole-3-carboxamides as antiinflammatory agents |
| US4654335A (en) | 1985-07-11 | 1987-03-31 | E. R. Squibb & Sons, Inc. | Antihypertensive 1,5-benzothiazepine derivatives, compositions, and method of use therefor |
| US4704382A (en) | 1985-07-29 | 1987-11-03 | G. D. Searle & Co. | Phenylpiperazine phosphonates |
| US4654355A (en) | 1985-08-01 | 1987-03-31 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide-thioamide prostaglandin analogs |
| US4654356A (en) | 1985-08-01 | 1987-03-31 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted diacid diamide prostaglandin analogs |
| US4647561A (en) | 1985-08-05 | 1987-03-03 | E. R. Squibb & Sons, Inc. | 1,5-benzodiazepine compounds |
| US4654357A (en) | 1985-08-09 | 1987-03-31 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted sulfonamide prostaglandin analogs |
| US4626548A (en) | 1985-08-19 | 1986-12-02 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted prostaglandin compounds useful in the treatment of thrombotic disease |
| US4844907A (en) | 1985-08-28 | 1989-07-04 | Euroceltique, S.A. | Pharmaceutical composition comprising analgesic and anti-inflammatory agent |
| US4632931A (en) | 1985-09-25 | 1986-12-30 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide-sulfonamide prostaglandin analogs useful in the treatment of thrombotic disease |
| US4686221A (en) | 1985-10-01 | 1987-08-11 | Kanebo, Ltd. | Quinolinecarboxylic acid compounds and antimicrobial agent containing the same |
| US4681970A (en) | 1985-10-18 | 1987-07-21 | G. D. Searle & Co. | Bicyclo-substituted phenylacetonitrile derivatives |
| US4753951A (en) | 1985-10-18 | 1988-06-28 | Shionogi & Co., Ltd. | Condensed imidazopyridine derivatives useful as psychotropic agents |
| US4652576A (en) | 1985-10-18 | 1987-03-24 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide-carbamate prostaglandin analogs |
| US4593042A (en) | 1985-10-18 | 1986-06-03 | G. D. Searle & Co. | Bicyclo-substituted phenylacetonitrile derivatives |
| US4639461A (en) | 1985-10-28 | 1987-01-27 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted keto-amide prostaglandin analogs useful in the treatment of thrombotic disease |
| US4638012A (en) | 1985-11-05 | 1987-01-20 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane α-substituted ketone prostaglandin analogs useful in the treatment of thrombotic disease |
| US4778800A (en) | 1985-11-13 | 1988-10-18 | Schering Aktiengesellschaft | 3-oxadiazole and 3-carboxylic acid beta-carboline derivatives, and their use as psychotropic agents |
| US4824955A (en) | 1985-11-15 | 1989-04-25 | Nippon Kayaku Kabushiki Kaisha | Selenium oxy chloride-pyridine or bipyridine complexes |
| US4647573A (en) | 1985-11-22 | 1987-03-03 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted thioamide-amide prostaglandin analogs |
| US5106996A (en) | 1985-12-05 | 1992-04-21 | Bristol-Myers Company | Process for the preparation of podophyllotoxin |
| US4656185A (en) | 1985-12-05 | 1987-04-07 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted aminoalkyl amide prostaglandin analogs |
| US4618685A (en) | 1985-12-18 | 1986-10-21 | Mccully Kilmer S | N-homocysteine thiolactonyl retinamide and use thereof as an antineoplastic agent |
| US5055290A (en) | 1985-12-18 | 1991-10-08 | Boehringer Mannehim Gmbh | Ciamexone as a selective immunosuppressant |
| US4668787A (en) | 1985-12-20 | 1987-05-26 | Ortho Pharmaceutical Corporation | 5,6-dialkoxy-4-imino-2(1H)quinazolinone derivatives |
| US4622326A (en) | 1985-12-23 | 1986-11-11 | Hoechst-Roussel Pharmaceuticals Inc. | 6H-isoxazolo(5,4-d)pyrazolo(3,4-b)pyridines, and their use as antihypertensive and analgesic agents |
| US4849563A (en) | 1986-01-21 | 1989-07-18 | Yale University | Novel 1-alkyl-1-arenesulfonyl-2-alkoxycarbonylsulfenylhydrazines having antineoplastic activity |
| US4962114A (en) | 1986-01-21 | 1990-10-09 | Yale University | 1-alkyl-1-sulfonyl-2-alkoxycarbonylsulfenylhydrazines having antineoplastic activity |
| US4772703A (en) | 1986-01-27 | 1988-09-20 | American Home Products Corporation | 2-(phenoxymethyl)-quinazolines as antiallergic and antiinflammatory agents |
| US4904786A (en) | 1986-01-27 | 1990-02-27 | American Home Products Corporation | Quinoline compounds as antiallergic and antiinflammatory agents |
| US4780538A (en) | 1986-02-12 | 1988-10-25 | Merck & Co., Inc. | Process for 1,4-dihydropyridine compounds using a titanamine catalyst |
| US4727072A (en) | 1986-02-12 | 1988-02-23 | Mcneilab, Inc. | 3-alkoxy-2-aminopropylamines compositions and use as cardiovascular agents |
| US4745123A (en) | 1986-02-18 | 1988-05-17 | Warner-Lambert Company | Substituted tetrahydro-3-pyridine-carboxylic acid, ester, and amide cholinergic agents |
| US4652578A (en) | 1986-02-24 | 1987-03-24 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amide prostaglandin analogs |
| US5219872A (en) | 1986-02-27 | 1993-06-15 | Roussel Uclaf | Compounds of 1,2,5,6-tetrahydropyridin-3-carboxaldehyde oxime which are useful as cholinergic agents |
| US4746504A (en) | 1986-03-14 | 1988-05-24 | Bio-Technology General Corp. | Heavy metal salts of hyaluronic acid and their use as antimicrobial agents |
| US4784991A (en) | 1986-03-14 | 1988-11-15 | Bio-Technology General Corp. | Heavy metal salts of hyaluronic acid and their use as antimicrobial agents |
| US4663337A (en) | 1986-04-18 | 1987-05-05 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amides useful in the treatment of thrombotic disease |
| US4670560A (en) | 1986-04-28 | 1987-06-02 | Ortho Pharmaceutical Corporation | Thienopyrimidine-2,4-dione derivatives and intermediates thereof |
| US4707550A (en) | 1986-04-28 | 1987-11-17 | Ortho Pharmaceutical Corporation | N-(substituted thienyl)-N'-(substituted piperazinyl)-ureas |
| US4703120A (en) | 1986-04-28 | 1987-10-27 | Ortho Pharmaceutical Corporation | Furo(3,4-d)pyrimidine-2,4-dione derivatives and intermediates thereof |
| US4803216A (en) | 1986-05-07 | 1989-02-07 | Fisons Plc | Pyrazole-3-amines as anti-inflammatory agents |
| US4670453A (en) | 1986-05-08 | 1987-06-02 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amido-carbamoyl prostaglandin analogs useful in the treatment of thrombotic disease |
| US4810692A (en) | 1986-05-22 | 1989-03-07 | Rhone-Poulenc Sante | Immunosuppressant substances, process for their preparation and pharmaceutical compositions containing them |
| US4904685A (en) | 1986-06-09 | 1990-02-27 | Pfizer Inc. | Antiallergy and antiinflammatory agents |
| US4835166A (en) | 1986-06-09 | 1989-05-30 | Pfizer Inc. | Antiallergy and antiinflammatory agents |
| US5036088A (en) | 1986-06-09 | 1991-07-30 | Pfizer Inc. | Antiallergy and antiinflammatory agents, compositions and use |
| US4708966B1 (cg-RX-API-DMAC7.html) | 1986-06-27 | 1991-03-12 | Procter & Gamble | |
| US4708966A (en) | 1986-06-27 | 1987-11-24 | The Procter & Gamble Company | Novel anti-inflammatory agents, pharmaceutical compositions and methods for reducing inflammation |
| US4833145A (en) | 1986-06-30 | 1989-05-23 | The Trustees Of Princeton University | 4(3H)-oxo-5,6,7,8-tetrahydropyrido[2,3-d]pyrimidine derivatives |
| US4650797A (en) | 1986-07-18 | 1987-03-17 | E. R. Squibb & Sons, Inc. | Substituted 1,5-benzodiazepine compounds |
| US4877619A (en) | 1986-08-25 | 1989-10-31 | Vestar, Inc. | Liposomal vesicles for intraperitoneal administration of therapeutic agents |
| US4788205A (en) | 1986-08-29 | 1988-11-29 | Pfizer Inc. | Dihydropyridine anti-allergic and antiinflammatory agents |
| US4775757A (en) | 1986-09-22 | 1988-10-04 | Ortho Pharmaceutical Corporation | Thienopyridines useful as cardiovascular agents |
| US4734424A (en) | 1986-09-24 | 1988-03-29 | E. R. Squibb & Sons, Inc. | Bicycloheptane substituted diamide and its congener prostaglandin analogs |
| US4734426A (en) | 1986-09-24 | 1988-03-29 | E. R. Squibb & Sons, Inc. | 5,6-epoxy-7-oxabicycloheptane substituted diamide prostaglandin analogs |
| US4735962A (en) | 1986-10-06 | 1988-04-05 | E. R. Squibb & Sons, Inc. | 7-thiabicycloheptane substituted diamide and its congener prostaglandin analogs |
| US4734425A (en) | 1986-10-17 | 1988-03-29 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted hydroxamic acid prostaglandin analogs |
| US4782071A (en) | 1986-11-03 | 1988-11-01 | Warner-Lambert Company | Tetrasubstituted urea cholinergic agents |
| US4801598A (en) | 1986-11-07 | 1989-01-31 | Pfizer Inc. | Dihydropyridine anti-allergic and anti-inflammatory agents |
| US4738978A (en) | 1986-11-10 | 1988-04-19 | E. R. Squibb & Sons, Inc. | Bisthioamide-7-oxabicycloheptane prostaglandin analogs |
| US4785085A (en) | 1986-11-21 | 1988-11-15 | Bristol-Myers Company | Rebeccamycin analogs |
| US4710508A (en) | 1986-12-08 | 1987-12-01 | Warner-Lambert Company | O-substituted tetrahydropyridine oxime cholinergic agents |
| US4786648A (en) | 1986-12-08 | 1988-11-22 | Warner-Lambert Company | O-substituted tetrahydropyridine oxime cholinergic agents |
| US4971984A (en) | 1986-12-11 | 1990-11-20 | Beehringer Biochemia Robin S.P.A. | 2-methylthiomethyl-dihydropyridines and pharmaceutical compositions containing them |
| US5702688A (en) | 1986-12-23 | 1997-12-30 | Tristrata Technology, Inc. | Amphoteric compositions and polymeric forms of alpha hydroxyacids, and their therapeutic use |
| US4874760A (en) | 1987-01-09 | 1989-10-17 | Toa Eiyo, Ltd. | 4,7-dihydroisothiazolo(5,4-b)pyridine derivatives and cardiovascular treating agents containing said derivatives |
| US5098613A (en) | 1987-01-12 | 1992-03-24 | Eli Lilly And Company | Anti-inflammatory agents |
| US4945099A (en) | 1987-01-12 | 1990-07-31 | Eli Lilly And Company | Anti-inflammatory agents |
| US4791129A (en) | 1987-01-20 | 1988-12-13 | Pfizer Inc. | 1,3-dicarboxamidooxindoles as analgesic and antiinflammatory agents |
| US5109024A (en) | 1987-02-03 | 1992-04-28 | Merrell Dow Pharmaceuticals Inc. | Polyamine derivatives as antineoplastic agents |
| US4767776A (en) | 1987-02-20 | 1988-08-30 | Warner-Lambert Company | N-1H-tetrazol-5-yl-2-naphthalene carboxamides and their use as antiallergy and antiinflammatory agents |
| US4764525A (en) | 1987-02-25 | 1988-08-16 | Warner-Lambert Company | N-1H-tetrazol-5-ylbenzamides having use as antiallergy and antiinflammatory agents |
| US4749715A (en) | 1987-03-02 | 1988-06-07 | E. R. Squibb & Sons, Inc. | 7-oxabicycloheptane substituted amino prostaglandin analogs |
| US5118509A (en) | 1987-03-09 | 1992-06-02 | Alza Corporation | Inducing skin tolerance to a sensitizing drug |
| US5049387A (en) | 1987-03-09 | 1991-09-17 | Alza Corporation | Inducing skin tolerance to a sensitizing drug |
| US5017618A (en) | 1987-03-16 | 1991-05-21 | University Of Florida | Labile derivatives of ketone analogs of 3-substituted-1-alkylamino-2-propanols and their use as beta-adrenergic blockers |
| US4798841A (en) | 1987-03-31 | 1989-01-17 | Warner-Lambert Company | Tetrahydropyridine oxime cholinergic agents and method of treatment |
| US4753946A (en) | 1987-04-08 | 1988-06-28 | E. R. Squibb & Sons, Inc. | Pyrimidinecarboxylic acid derivatives |
| US5089251A (en) | 1987-04-10 | 1992-02-18 | Sanofi | Aromatic derivatives and their use as antimicrobial agents |
| US4916156A (en) | 1987-04-10 | 1990-04-10 | Sanofi | Aromatic derivatives, their preparation and their use as antimicrobial agents |
| US5002955A (en) | 1987-04-23 | 1991-03-26 | Hoechst-Roussel Pharmaceuticals Inc. | Fused heteroalkylene quinolinamines and use as cholinergic agents |
| US5219873A (en) | 1987-04-24 | 1993-06-15 | Roussel Uclaf | Compounds of 1,2,5,6-tetrahydropyridine which are useful as cholinergic agents |
| US4954519A (en) | 1987-04-28 | 1990-09-04 | Georgia Tech Research Corporation | Isocoumarins with basic substituents as serine proteases inhibitors, anticoagulants and anti-inflammatory agents |
| US5324648A (en) | 1987-04-28 | 1994-06-28 | Georgia Tech Research Corporation | Substituted isocoumarins as serine protease inhibitors and anti-inflammatory agents |
| US4845242A (en) | 1987-04-28 | 1989-07-04 | Georgia Tech Research Corporation | Isocoumarins with basic substituents as serine proteases inhibitors, anticoagulants and anti-inflammatory agents |
| US4769371A (en) | 1987-05-01 | 1988-09-06 | E. R. Squibb & Sons, Inc. | Dihydropyrimidine carboxylic acid esters |
| US4912248A (en) | 1987-05-18 | 1990-03-27 | The Procter & Gamble Company | Novel anti-inflammatory agents, pharmaceutical compositions and methods for reducing inflammation |
| US5081126A (en) | 1987-05-19 | 1992-01-14 | Fujisawa Pharmaceutical Co., Ltd. | Quinolyl- and isoquinolyl-methoxyphenyl-dithioacetyl derivatives useful as antiinflammatory agents |
| US4888434A (en) | 1987-05-26 | 1989-12-19 | Dow Corning K.K. | Antimicrobial agent |
| US5019390A (en) | 1987-05-29 | 1991-05-28 | Research Corporation Technologies, Inc. | Anticancer agent--IMIC |
| US4851412A (en) | 1987-05-30 | 1989-07-25 | Pfizer Inc. | Dihydropyridine antiallergic and antiinflammatory agents |
| US5298633A (en) | 1987-06-08 | 1994-03-29 | Allergan, Inc. | Intermediates and processes for preparing 4-substituted 2-5(H)-furanones as anti-inflammatory agents |
| US4889866A (en) | 1987-06-11 | 1989-12-26 | Syntex (U.S.A.) Inc. | Arylsulfonyl dihydropyridine derivatives |
| US4752616A (en) | 1987-06-29 | 1988-06-21 | E. R. Squibb & Sons, Inc. | Arylthioalkylphenyl carboxylic acids, compositions containing same and method of use |
| US5037809A (en) | 1987-07-10 | 1991-08-06 | Fujisawa Pharmaceutical Co., Ltd. | Antimicrobial agent, FR109615 and production thereof |
| US5514715A (en) | 1987-07-10 | 1996-05-07 | Fujisawa Pharmaceutical Co., Ltd. | Antimicrobial agent, FR109615 and production thereof |
| US4980365A (en) | 1987-07-13 | 1990-12-25 | Hoechst-Roussel Pharmaceuticals Inc. | N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents |
| US5008264A (en) | 1987-07-13 | 1991-04-16 | Hoechst-Roussel Pharmaceuticals Inc. | N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents |
| US5030639A (en) | 1987-07-13 | 1991-07-09 | Hoechst-Roussel Pharmaceuticals Inc. | N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents |
| US4988733A (en) | 1987-07-15 | 1991-01-29 | Burroughs Wellcome Co. | N-[1-(3-phenoxyphenyl)ethyl]acetohydroxamic acid compounds which are useful anti-inflammatory agents |
| US4904663A (en) | 1987-07-15 | 1990-02-27 | Shionogi & Co., Ltd. | N-(2-oxpyrrolidin-1-yl-)acetyl)piperazine derivatives and drug for senile dementia |
| US4767756A (en) | 1987-07-17 | 1988-08-30 | E. R. Squibb & Sons, Inc. | 3-substituted benzazepines |
| US4992447A (en) | 1987-07-17 | 1991-02-12 | Pfizer Inc. | Certain oxo-pyrrolo 1,4-dihydropyridines as antiallergy and antiinflammatory agents |
| US4853392A (en) | 1987-07-17 | 1989-08-01 | Pfizer Inc. | Fused 1,4-dihydropyridines as antiallergy and antiinflammatory agents |
| US4794110A (en) | 1987-07-20 | 1988-12-27 | Hoechst-Roussel Pharmaceuticals, Inc. | 5-Aryl-11-substituted-5H,11H-pyrrolo[2,1-c][1,4]benzoxazepined as analgesic and hypotensive agents |
| US4771047A (en) | 1987-07-27 | 1988-09-13 | E. R. Squibb & Sons, Inc. | Benzazepine derivatives |
| US4847290A (en) | 1987-08-17 | 1989-07-11 | Sumner Burstein | Delta 1-thc-7-oic acid and analgesic and anti-inflammatory agents |
| US4977167A (en) | 1987-08-19 | 1990-12-11 | Shionogi & Co., Ltd. | Carbamoylpyrolidone derivatives and drugs for senile dementia |
| US5120733A (en) | 1987-08-19 | 1992-06-09 | Shionogi And Co. Ltd. | Carbamoylpyrrolidone derivatives and drugs for senile dementia |
| US4774239A (en) | 1987-08-26 | 1988-09-27 | E. R. Squibb & Sons, Inc. | Benzazepine derivatives |
| US5036077A (en) | 1987-09-17 | 1991-07-30 | Sanofi | 1-(benzylpiperidino)propan-2-ol derivatives, their preparation, their use as antimicrobial agents and the products in which they are present |
| US4826990A (en) | 1987-09-30 | 1989-05-02 | American Home Products Corporation | 2-aryl substituted heterocyclic compounds as antiallergic and antiinflammatory agents |
| US4895953A (en) | 1987-09-30 | 1990-01-23 | American Home Products Corporation | 2-Aryl substituted heterocyclic compounds as antiallergic and antiinflammatory agents |
| US4942236A (en) | 1987-09-30 | 1990-07-17 | American Home Products Corporation | 2-aryl substituted pyridyl-containing phenyl sulfonamido compounds as antiallergic and antiinflammatory agents |
| US5654484A (en) | 1987-10-08 | 1997-08-05 | Merrell Pharmaceuticals Inc. | Polyamine derivatives as antineoplastic agents |
| US5011931A (en) | 1987-11-18 | 1991-04-30 | The Boots Company Plc | Process for the preparation of 1-methyl-3-methylthio-4-quinolone and the sulfinyl, and sulfonyl analogs thereof |
| US5266562A (en) | 1987-11-19 | 1993-11-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Anti-inflammatory agents |
| US4847303A (en) | 1987-11-23 | 1989-07-11 | The Procter & Gamble Company | Tert-butylphenyl compounds useful as anti-inflammatory agents |
| US4847303B1 (cg-RX-API-DMAC7.html) | 1987-11-23 | 1991-03-12 | Procter & Gamble | |
| US5055466A (en) | 1987-11-23 | 1991-10-08 | E. R. Squibb & Sons, Inc. | N-morpholino derivatives and their use as anti-hypertensive agents |
| US4883872A (en) | 1987-11-25 | 1989-11-28 | E. R. Squibb & Sons, Inc. | 3-oxo-1,2,4-triazolo(4,3-A) pyrimidine-6-carboxylic acid esters |
| US4847379A (en) | 1987-11-30 | 1989-07-11 | E. R. Squibb & Sons, Inc. | 3,6-dihydro-1,5(2H)-pyrimidinecarboxylic acid esters |
| US4910192A (en) | 1987-12-04 | 1990-03-20 | Sri International | Topically active steroidal anti-inflammatory agents |
| US5192799A (en) | 1987-12-11 | 1993-03-09 | Mitsui Petrochemical Industries, Ltd. | Coumaran group containing amine compounds and their acid addition salts and quaternary ammonium salts and the use thereof as anti arrhythmic agents and as psychotropic agents |
| US4870210A (en) | 1987-12-18 | 1989-09-26 | American Home Products Corporation | Aminoguanidine derivative as anti-inflammatory agents |
| US4824831A (en) | 1987-12-21 | 1989-04-25 | E. R. Squibb & Sons, Inc. | 4,5-dihydro-1H-benzazepine-3-carboxylic acid esters which are useful as anti-hypertensive agents |
| US4968800A (en) | 1988-02-04 | 1990-11-06 | Kanebo Limited | Novel platinum complex, antineoplastic agent containing the same, and intermediate therefor |
| US4889859A (en) | 1988-02-05 | 1989-12-26 | The Trustees Of Princeton University | Pyrido[2,3-d]pyrimidine derivatives |
| US4994450A (en) | 1988-02-12 | 1991-02-19 | Dr. Lo. Zambeletti S.P.A. | Azacyclic compounds and their use as analgesic agents |
| US4859686A (en) | 1988-02-19 | 1989-08-22 | Pfizer Inc. | Dihydropyridine anti-allergic and anti-inflammatory agents |
| US4904671A (en) | 1988-02-25 | 1990-02-27 | Pfizer Inc. | Dihydropyridine antiallergic and antiinflammatory agents |
| US5217958A (en) | 1988-03-03 | 1993-06-08 | E. R. Squibb & Sons, Inc. | 1,2-hydroxy phosphonates and derivatives thereof |
| US4900748A (en) | 1988-03-04 | 1990-02-13 | The United States Of America As Represented By The Department Of Health And Human Services | Carbamates related to (-)-physostigmine as cholinergic agents |
| US4927835A (en) | 1988-03-04 | 1990-05-22 | Nippon Shinyaku Co., Ltd. | Acylphenol derivatives, useful as anti-inflammatory agents and pain suppressants |
| US4906634A (en) | 1988-03-08 | 1990-03-06 | Schering A.G. | Novel N-[4-(aminosubstituted)phenyl]methanesulfonamides and their use as cardiovascular agents |
| US4835157A (en) | 1988-03-15 | 1989-05-30 | Ortho Pharmaceutical Corporation | Thieno- and furopyrimidine-2,4-dione piperidine derivatives as serotonin antagonists and alpha adrenergic blocking agents |
| US4981843A (en) | 1988-04-07 | 1991-01-01 | E. R. Squibb & Sons, Inc. | N-heterocyclic alcohol derivatives |
| US5152980A (en) | 1988-05-19 | 1992-10-06 | The Beth Israel Hospital Association | Induction of tolerance to a foreign antigen IL-2 receptor-binding substances |
| US4970318A (en) | 1988-05-24 | 1990-11-13 | Pfizer Inc. | Aromatic and heterocyclic carboxamide derivatives as antineoplastic agents |
| US4882333A (en) | 1988-05-25 | 1989-11-21 | The Trustess Of Princeton University | N-(5,6,7,8-tetrahydropyrido[2,3-d]pyrimidin-6-yl-alkanoyl)-glutamic acid derivatives |
| US4882334A (en) | 1988-05-25 | 1989-11-21 | The Trustees Of Princeton University | N-(5,6,7,8-tetrahydropyrido]2,3-d]pyrimidin-6-ylethl-thineyl-and furylcarbonyl)-glutamic acid derivatives |
| US5208250A (en) | 1988-05-25 | 1993-05-04 | Warner-Lambert Company | Known and selected novel arylmethylenyl derivatives of thiazolidinones, imidazolidinones and oxazolidinones useful as antiallergy agents and anti-inflammatory agents |
| US5464856A (en) | 1988-05-25 | 1995-11-07 | Warner-Lambert Company | Arylmethylenyl derivatives of imidazolidinones useful as antiinflammatory agents |
| US4871746A (en) | 1988-05-31 | 1989-10-03 | The Trustees Of Princeton University | N-[N-(tetrahydropyrido[2,3-D]pyrimidinylmethyl)-aminomethylbenzoyl]glutamic acid derivatives as neoplastic growth inhibitors |
| US4857644A (en) | 1988-06-09 | 1989-08-15 | American Home Products Corporation | Aryl sulfonopiperazines as anti-inflammatory agents |
| US6096315A (en) | 1988-06-14 | 2000-08-01 | Cel Sci Corporation | Heterofunctional cellular immunological reagents, vaccines containing same and methods for the use of same |
| US4981792A (en) | 1988-06-29 | 1991-01-01 | Merck & Co., Inc. | Immunosuppressant compound |
| US5290772A (en) | 1988-06-29 | 1994-03-01 | Merck & Co., Inc. | Immunosuppressant agent |
| US5010109A (en) | 1988-06-30 | 1991-04-23 | Chisso Corporation | Antimicrobial agent composition |
| US5051423A (en) | 1988-07-13 | 1991-09-24 | Schering Ag | Derivatized alkanolamines as cardiovascular agents |
| US4888335A (en) | 1988-07-25 | 1989-12-19 | Mcneilab, Inc. | 3-alkoxy-2-aminopropyl heterocyclic amines and their use as cardiovascular agents |
| US5723481A (en) | 1988-07-26 | 1998-03-03 | Sankyo Company, Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US5232939A (en) | 1988-07-26 | 1993-08-03 | Sankyo Company Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US5354768A (en) | 1988-07-26 | 1994-10-11 | Sankyo Company, Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US5665752A (en) | 1988-07-26 | 1997-09-09 | Sankyo Company, Limited | Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents |
| US4977144A (en) | 1988-08-02 | 1990-12-11 | Ciba-Geigy Corporation | Imidazo[4,5-b]pyridine derivatives as cardiovascular agents |
| US5175160A (en) | 1988-08-09 | 1992-12-29 | Daiichi Pharmaceutical Co., Ltd. | Antimicrobial agent for animals |
| US5691346A (en) | 1988-08-10 | 1997-11-25 | The Australian National University | Castanospermine as an anti-inflammatory and immunosuppressant agent |
| US5695753A (en) | 1988-08-31 | 1997-12-09 | Behringwerke Aktiengesellschaft | Transglutaminases as immunosuppressants |
| US5464615A (en) | 1988-08-31 | 1995-11-07 | Behringwerke Aktiengesellschaft | Use of transglutaminases as immunosuppressants |
| US5061702A (en) | 1988-09-02 | 1991-10-29 | Meiji Seika Kabushiki Kaisha | Cephem compound as an antimicrobial agent |
| US5073570A (en) | 1988-09-14 | 1991-12-17 | Lonza Inc. | Mono-iodopropargyl esters of dicarboxylic anhydrides and their use as antimicrobial agents |
| US5219884A (en) | 1988-09-14 | 1993-06-15 | Taito Co., Ltd. | Immunosuppressant |
| US5185362A (en) | 1988-09-14 | 1993-02-09 | Mcneilab, Inc. | Diphenylamine cardiovascular agents, compositions and use |
| US5036065A (en) | 1988-10-20 | 1991-07-30 | Taiho Pharmaceutical Company, Limited | Benzothiadiazepine derivatives |
| US4959383A (en) | 1988-10-31 | 1990-09-25 | E. R. Squibb & Sons, Inc. | Phenylsulfone alkenoic acids, derivatives thereof, compositions containing same and method of use |
| US5070099A (en) | 1988-10-31 | 1991-12-03 | E. R. Squibb & Sons, Inc. | Arylthioalkylphenyl carboxylic acids, derivatives thereof, compositions containing same method of use |
| US5006542A (en) | 1988-10-31 | 1991-04-09 | E. R. Squibb & Sons, Inc. | Arylthioalkylphenyl carboxylic acids, derivatives thereof, compositions containing same and method of use |
| US4883811A (en) | 1988-11-17 | 1989-11-28 | Misra Raj N | 7-Oxabicycloheptane imino interphenylene substituted prostaglandin analogs useful in the treatment of thrombotic disease |
| US5376670A (en) | 1988-11-29 | 1994-12-27 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents |
| US5256680A (en) | 1988-11-29 | 1993-10-26 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxy-phenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents |
| US5155122A (en) | 1988-11-29 | 1992-10-13 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxy-phenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents |
| US4897397A (en) | 1988-12-16 | 1990-01-30 | Schering Corporation | Aryl-alkynoic, alkenoic or alkanoic compounds and compositions useful as antiallergy and anti-inflammatory agents |
| USRE34918E (en) | 1988-12-27 | 1995-04-25 | Kaken Pharmaceutical Co., Ltd. | Azaazulene compounds which are useful as antiallergic and antiinflammatory agents |
| US5013736A (en) | 1988-12-27 | 1991-05-07 | Kaken Pharmaceutical Co., Ltd. | Azaazulene compounds which are useful as antiallergic and antiinflammatory agents |
| US5013751A (en) | 1989-01-10 | 1991-05-07 | Alcon Laboratories, Inc. | (+) Suprofen esters and amides as opthalmic anti-inflammatory agents |
| US4906655A (en) | 1989-01-24 | 1990-03-06 | Warner-Lambert Company | Novel 1,2-cyclohexylaminoaryl amides useful as analgesic agents |
| US5093342A (en) | 1989-02-09 | 1992-03-03 | Aktiebolaget Hassle | Use of omeprazole as an antimicrobial agent |
| US5084281A (en) | 1989-02-14 | 1992-01-28 | Dillon Richard S | Method and solution for treating tissue wounds |
| US4954526A (en) | 1989-02-28 | 1990-09-04 | The United States Of America As Represented By The Department Of Health And Human Services | Stabilized nitric oxide - primary amine complexes useful as cardiovascular agents |
| US5540931A (en) | 1989-03-03 | 1996-07-30 | Charles W. Hewitt | Methods for inducing site-specific immunosuppression and compositions of site specific immunosuppressants |
| US5061728A (en) | 1989-03-07 | 1991-10-29 | Pfizer Inc. | Use of 4-phenyl-1,2,3,4-tetrahydro-1-naphthalenamine derivatives in the treatment of inflammation and as immunosuppressants |
| US5431896A (en) | 1989-03-15 | 1995-07-11 | Merck & Co., Inc. | Microbial immunoregulant |
| US4952692A (en) | 1989-04-04 | 1990-08-28 | E. R. Squibb & Sons, Inc. | Benzazepine derivatives |
| US5068323A (en) | 1989-04-21 | 1991-11-26 | Merck & Co., Inc. | Thermally re-arranged FK-506 derivatives having immunosuppressant activity |
| US5409893A (en) | 1989-05-05 | 1995-04-25 | Boehringer Mannheim Italia, S.P.A. | Ruthenium(III) complexes as antineoplastic agents |
| US5112846A (en) | 1989-05-26 | 1992-05-12 | Warner-Lambert Company | N-hydroxyamide, N-hydroxythioamide, hydroxyurea, and N-hydroxythiourea derivatives of selected nsaids as antiinflammatory agents |
| US4981865A (en) | 1989-05-26 | 1991-01-01 | Warner-Lambert Co. | N-hydroxyamide, N-hydroxythioamide, hydroxyurea, and N-hydroxythiourea derivatives of selected nsaids as antiinflammatory agents |
| US5075330A (en) | 1989-05-26 | 1991-12-24 | Warner-Lambert Co. | N-hydroxyamide, N-hydroxythioamide, N-hydroxyurea, and N-hydroxythiourea derivatives of selected NSAIDS as antiinflammatory agents |
| US5140031A (en) | 1989-05-31 | 1992-08-18 | E. R. Squibb & Sons, Inc. | Pyranyl cyanoguanidine derivatives |
| US5017578A (en) | 1989-06-09 | 1991-05-21 | Hoechst-Roussel Pharmaceuticals Inc. | N-heteroaryl-purin-6-amines useful as analgesic and anticonvulsant agents |
| US4962119A (en) | 1989-06-09 | 1990-10-09 | Warner-Lambert Company | Triazole derivatives of fenamates as antiinflammatory agents |
| US5066668A (en) | 1989-06-09 | 1991-11-19 | Warner-Lambert Co. | Triazole derivatives of fenamates as antiinflammatory agents |
| US5462952A (en) | 1989-06-09 | 1995-10-31 | Warner-Lambert Company | Fenamate 1,3,4-thiadiazoles and 1,3,4-oxadiazoles as antiinflammatory agents |
| US5104656A (en) | 1989-06-16 | 1992-04-14 | Seth Pyare L | Percutaneous treatment with a high potency non-steroidal anti-inflammatory agent |
| US4931457A (en) | 1989-06-28 | 1990-06-05 | Hoechst-Roussel Pharmaceuticals Inc. | Naphthylamino-and naphthyloxy-pyridinamine comounds useful as topical antiinflammatory agents for the treatment of skin disorders |
| US4939137A (en) | 1989-06-28 | 1990-07-03 | Ortho Pharmaceutical Corporation | Ring-fused thienopyrimidinedione derivatives |
| US4931457B1 (en) | 1989-06-28 | 1993-11-16 | Hoechst-Roussel Pharmaceuticals Incorporated | Naphthylamino-and naphthyloxy-pyridineamin compounds useful as topical antiinflammatory agents for the treatment of skin disorders |
| US5116867A (en) | 1989-06-30 | 1992-05-26 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | D-propranolol as a selective adenosine antagonist |
| US5068247A (en) | 1989-07-07 | 1991-11-26 | Yoshitomi Pharmaceutical Industries, Ltd. | 2-aminopentanoic acid compounds and their use as immunosuppressants |
| US5256416A (en) | 1989-07-28 | 1993-10-26 | Merck Patent Gmbh | Extracts of the Acanthospermum hispidum plant |
| US5116861A (en) | 1989-08-07 | 1992-05-26 | Takeda Chemical Industries, Ltd. | Nitrosothiol derivatives and their use |
| US4904674A (en) | 1989-08-16 | 1990-02-27 | Hoechst-Roussel Pharmaceuticals Inc. | 1-(Benzo[b]thienyl)-2-(thienyl)ethenes and related compounds useful as anti-inflammatory agents |
| US4988710A (en) | 1989-08-25 | 1991-01-29 | Washington University | Aryl-cycloalkyl-alkanolamines for treatment of cholinergic neurotoxins |
| US5252745A (en) | 1989-08-25 | 1993-10-12 | Rohm And Haas Company | Preparation and use of iodopropargyl esters of α-amino acid derivatives as antimicrobial agents |
| US5077404A (en) | 1989-08-29 | 1991-12-31 | Piper James R | Cyclized 5,10-dideazaaminopterin compounds |
| US5214068A (en) | 1989-09-06 | 1993-05-25 | Yale University | Sulfonylhydrazines and their use as antineoplastic agents and as antitrypanosomal agents |
| US5101072A (en) | 1989-09-06 | 1992-03-31 | Yale University | Sulfonylhydrazines and their use as antineoplastic agents and as antitrypanosomal agents |
| US4966967A (en) | 1989-09-15 | 1990-10-30 | Berlex Laboratories, Inc. | 3,4,5,6-tetrahydro-2H-1,7,4-benzodioxazonines as cardiovascular agents |
| US4970226A (en) | 1989-10-03 | 1990-11-13 | Harbor Branch Oceanographic Institution, Inc. | Bis-indole imidazole compounds which are useful antitumor and antimicrobial agents |
| US5071848A (en) | 1989-10-23 | 1991-12-10 | Abbott Laboratories | Tricyclic quinoline antineoplastic agents |
| US4959378B1 (cg-RX-API-DMAC7.html) | 1989-10-24 | 1993-08-10 | Hoechst Roussel Pharma | |
| US5037835A (en) | 1989-10-24 | 1991-08-06 | Hoechst-Roussel Pharmaceuticals Inc. | Benzocycloalkylaminopyridinamines and related compounds as topical antiinflammatory agents for the treatment of skin disorders |
| US4959378A (en) | 1989-10-24 | 1990-09-25 | Hoechst-Roussel Pharmaceuticals Inc. | Aminopyridinylaminophenol compounds useful as topical antiinflammatory agents for the treatment of skin disorders |
| US4992448A (en) | 1989-10-24 | 1991-02-12 | Hoechst-Roussel Pharmaceuticals Inc. | Benzocycloalkylaminopyridinamines and related compounds as topical antiinflammatory agents for the treatment of skin disorders |
| US5356803A (en) | 1989-10-27 | 1994-10-18 | Genencor International, Inc. | Antimicrobial composition containing Type II endoglycosidase and antimicrobial agent |
| US5128349A (en) | 1989-10-30 | 1992-07-07 | Laboratoire L. Lafon | 1-(4-aminophenyl)-2-piperidinopropanone derivatives, preparation process and use in therapeutics |
| US4988728A (en) | 1989-11-03 | 1991-01-29 | Alcon Laboratories, Inc. | Suprofen esters and amides as ophthalmic anti-inflammatory agents |
| US5208228A (en) | 1989-11-13 | 1993-05-04 | Merck & Co., Inc. | Aminomacrolides and derivatives having immunosuppressive activity |
| US5318971A (en) | 1989-11-13 | 1994-06-07 | Schering Corporation | 3-Substituted-1-aryl-2(1H)-quinolones useful as anti-allergy and anti-inflammatory agents |
| US5362902A (en) | 1989-11-23 | 1994-11-08 | Pfizer Inc. | N-(1-(2-carboxyethyl35cloalkylcarbonyl)-beta-alanine derivatives for pharmaceutical use |
| US5332737A (en) | 1989-12-05 | 1994-07-26 | Imperial Chemical Industries Plc | Amino-1,3,5-triazines and their anhydrobase derivatives as agents for cardiovascular system |
| US5574037A (en) | 1989-12-05 | 1996-11-12 | Imperial Chemical Industries Plc | Amino 1,3,5-triazine derivatives as agents for cardiovascular system |
| US4996206A (en) | 1989-12-11 | 1991-02-26 | The Trustees Of Princeton University | N-(pyrrolo[2,3-d]pyrimidin-3-ylacyl)-glutamic acid derivatives |
| US5095037A (en) | 1989-12-21 | 1992-03-10 | Nissho Corporation | Combined anti-inflammatory agent |
| US5095037B1 (en) | 1989-12-21 | 1995-12-19 | Nissho Kk | Combined anti-inflammatory agent |
| US5064835A (en) | 1990-03-01 | 1991-11-12 | Merck & Co., Inc. | Hydroxymacrolide derivatives having immunosuppressive activity |
| US5346911A (en) | 1990-03-06 | 1994-09-13 | Warner-Lambert Company | Azabicyclo and azacyclo oxime and amine cholinergic agents and methods of treatment |
| US5482938A (en) | 1990-03-06 | 1996-01-09 | Warner-Lambert Company | Azabicyclo and azacyclo oxime and amine cholinergic agents and methods of treatment |
| US5360811A (en) | 1990-03-13 | 1994-11-01 | Hoechst-Roussel Pharmaceuticals Incorporated | 1-alkyl-, 1-alkenyl-, and 1-alkynylaryl-2-amino-1,3-propanediols and related compounds as anti-inflammatory agents |
| US5610292A (en) | 1990-03-13 | 1997-03-11 | Acic (Canada) Inc. | Process for producing 2,2'-o-cyclonucleosides nucleosides, and analogs thereof |
| US5358952A (en) | 1990-03-13 | 1994-10-25 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | O6 -substituted guanine compounds and methods for depleting O6 -alkylguanine-DNA alkyltransferase levels |
| US5079247A (en) | 1990-03-14 | 1992-01-07 | American Cyanamid Company | N1 -substituted benz(cd)indol-2-imine compounds as cardiovascular agents |
| US5212172A (en) | 1990-03-15 | 1993-05-18 | Allergan, Inc. | 4-(1-hydroxy-2-substituted amino)ethyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5081147A (en) | 1990-03-15 | 1992-01-14 | Allergan, Inc. | 4-(1-hydroxy-2-substituted amino)ethyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5290783A (en) | 1990-03-16 | 1994-03-01 | Beth Israel Hospital Association | Use of spiperone derivatives as immunosuppressant agents |
| US5574041A (en) | 1990-03-16 | 1996-11-12 | Beth Israel Hospital Association | Use of spiperone derivatives as immunosuppressant agents |
| US5414013A (en) | 1990-03-22 | 1995-05-09 | E. R. Squibb & Sons, Inc. | Trifluoromethyl mercaptan and mercaptoacyl derivatives and method of using same |
| US5414017A (en) | 1990-03-22 | 1995-05-09 | E. R. Squibb & Sons, Inc. | Trifluoromethyl mercaptan and mercaptoacyl derivatives and method of using same |
| US5223516A (en) | 1990-03-22 | 1993-06-29 | E. R. Squibb & Sons, Inc. | 3,3,3-trifluoro-2-mercaptomethyl-N-tetrazolyl substituted propanamides and method of using same |
| US5081261A (en) | 1990-03-23 | 1992-01-14 | Allergan, Inc. | 4-(1-hydroxy-2-N-substituted sulfonamido) ethyl-5-hydroxy-2(5H)-furanones and 4-(N-substituted sulfonamido)-2-ethenyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5494927A (en) | 1990-03-27 | 1996-02-27 | Warner-Lambert Company | 3,5-di-tertiarybutyl-4-hydroxyphenylmethylene derivatives of 2-substituted thiazolidinones, oxazolidinones, and imidazolidinones as antiinflammatory agents |
| US5143928A (en) | 1990-03-27 | 1992-09-01 | Warner-Lambert Company | 3,5-di-tertiarybutyl-4-hydroxyphenylmethylene derivatives of 2-substituted thiazolidinones, oxazolidinones, and imidazolidinones as antiinflammatory agents |
| US5234939A (en) | 1990-03-27 | 1993-08-10 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl imidazolyl methanones and related compounds as antiinflammatory agents |
| US5290800A (en) | 1990-03-27 | 1994-03-01 | Warner-Lambert Company | 3,5-di-tertiarybutyl-4-hydroxyphenylmethylene derivatives of 2-substituted thiazolidinones, oxazolidinones, and imidazolidinones as antiinflammatory agents |
| US5234937A (en) | 1990-03-27 | 1993-08-10 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxphenyl oxazolyl methanones and related compounds as antiinflammatory agents |
| US5086064A (en) | 1990-03-27 | 1992-02-04 | Warner-Lambert Company | 3,5-di-tertiary-butyl-4-hydroxyphenyl thiazolyl, oxazolyl, and imidazolyl methanones and related compounds as antiinflammatory agents |
| US5013850A (en) | 1990-03-30 | 1991-05-07 | Allergan, Inc. | 4-ethyl and 4-ethenyl-5-hydroxy-2(5H)-furanones substituted on alpha carbon of the ethyl or ethenyl side chain with a long chain alkyl group and on the beta carbon with a polar group, as anti-inflammatory agents |
| US5061813A (en) | 1990-04-02 | 1991-10-29 | E. R. Squibb & Sons, Inc. | Substituted cyanoimino benzopyranes |
| US5563170A (en) | 1990-04-02 | 1996-10-08 | E. R. Squibb & Sons, Inc. | Substituted cyanoimino benzopyranes |
| US5037811A (en) | 1990-04-17 | 1991-08-06 | Allergan, Inc. | 4-(oxygen, sulfur or nitrogen substituted)-methyl 5-hydroxy-2(5H)-furanones as anti-inflammatory agents |
| US5043457A (en) | 1990-04-17 | 1991-08-27 | Allergan, Inc. | 2(5H)-furanones substituted in the 3 position, as Ca2+ channel antagonists and anti-inflammatory agents |
| US5198449A (en) | 1990-04-27 | 1993-03-30 | A. H. Robins Company Incorporated | N-substituted alpha-arylazacycloalkylmethanamines and their use as cardiovascular agents |
| US5208245A (en) | 1990-05-07 | 1993-05-04 | Wakunaga Seiyaku Kabushiki Kaisha | Dihydropyridine derivative |
| US5260444A (en) | 1990-05-07 | 1993-11-09 | Wakunaga Seiyaku Kabushiki Kaisha | Dihydropyridine derivative |
| US5204365A (en) | 1990-05-25 | 1993-04-20 | Sociedad Espanola De Especialidades Farmaco-Terapeuticas S.A. | Substituted diphenylmethane derivatives as analgesic or anti-inflammatory agents |
| US5036070A (en) | 1990-06-13 | 1991-07-30 | American Home Products Corporation | Polycyclic phenalkyl amines as psychotropic agents |
| US5185326A (en) | 1990-06-14 | 1993-02-09 | Bayer Aktiengesellschaft | Efomycins a, e and g as antiinflammatory agents |
| US5189036A (en) | 1990-06-20 | 1993-02-23 | Schering Ag | Imidazolylbenzoyl substituted heterocycles |
| US5330993A (en) | 1990-07-02 | 1994-07-19 | Vertex Pharmaceuticals, Inc. | Immunosuppressive compounds |
| US5192773A (en) | 1990-07-02 | 1993-03-09 | Vertex Pharmaceuticals, Inc. | Immunosuppressive compounds |
| US5622970A (en) | 1990-07-02 | 1997-04-22 | Vertex Pharmaceuticals, Incorporated | Immunosuppressive compounds |
| US5516797A (en) | 1990-07-02 | 1996-05-14 | Vertex Pharmaceuticals, Incorporated | Immunosuppressive compounds |
| US5665774A (en) | 1990-07-02 | 1997-09-09 | Armistead; David M. | Immunosuppressive compounds |
| US5073560A (en) | 1990-07-20 | 1991-12-17 | Fisons Corporation | Spiro-isoxazolidine derivatives as cholinergic agents |
| US5470842A (en) | 1990-07-30 | 1995-11-28 | Glycomed, Incorporated | Carbohydrate-based anti-inflammatory agents |
| US5190961A (en) | 1990-08-03 | 1993-03-02 | Terumo Kabushiki Kaisha | Thiourea derivatives and antimicrobial agent and antulcer agent containing the same |
| US5124455A (en) | 1990-08-08 | 1992-06-23 | American Home Products Corporation | Oxime-carbamates and oxime-carbonates as bronchodilators and anti-inflammatory agents |
| US5254685A (en) | 1990-08-09 | 1993-10-19 | Wakunaga Seiyaku Kabushiki Kaisha | Tricyclic compound or salts thereof, method for producing the same and antimicrobial agent containing the same |
| US5399553A (en) | 1990-08-09 | 1995-03-21 | Wakunaga Seiyaku Kabushiki Kaisha | Tricyclic compound or salts thereof, method for producing the same and anti-microbial agent containing the same |
| US5302592A (en) | 1990-08-17 | 1994-04-12 | Rohm And Haas Company | Use of substituted 3-thioacryloyl compounds as antimicrobial agents |
| US5464832A (en) | 1990-08-17 | 1995-11-07 | Rohm And Haas Company | Substituted 3-thioacryloyl compounds and their use as antimicrobial agents |
| US5308837A (en) | 1990-08-22 | 1994-05-03 | Merrell Dow Pharmaceuticals Inc. | 5'-amine substituted adenosine analogs as immunosuppressants |
| US5624924A (en) | 1990-08-24 | 1997-04-29 | Abbott Laboratories | Quinobenzothiazine antineoplastic agents |
| US5318965A (en) | 1990-08-24 | 1994-06-07 | Abbott Laboratories | Quinobenzoxazine, antineoplastic agents |
| US5095019A (en) | 1990-08-27 | 1992-03-10 | Hoechst-Roussel Pharmaceuticals Inc. | 4-substituted dihydropyrido(4,3-D)pyrimidines as analgesics and topical antiinflammatory agents for the treatment of skin disorders |
| US5059602A (en) | 1990-08-27 | 1991-10-22 | Hoechst-Roussel Pharmaceuticals Inc. | 4-substituted dihydropyrido(4,3-d)pyrimidines as analgesics and topical antiinflammatory agents for the treatment of skin disorders |
| US5091528A (en) | 1990-09-12 | 1992-02-25 | Allergan, Inc. | 6- or 7- (2-imino-2-imidazolidine)-1,4-benzoxazines as α adrenergic agents |
| US5624930A (en) | 1990-09-14 | 1997-04-29 | Hoechst Marion Roussel, Inc. | Carbocyclic nucleoside analogs useful as immunosuppressants |
| US5514688A (en) | 1990-09-14 | 1996-05-07 | Merrell Dow Pharmaceuticals Inc. | Carbocyclic adenosine analogs useful as immunosuppressants |
| US5605903A (en) | 1990-09-14 | 1997-02-25 | Hoechst Marion Roussel, Inc. | Carbocyclic nucleoside analogs useful as immunosuppressants |
| US5470857A (en) | 1990-09-14 | 1995-11-28 | Marion Merrell Dow Inc. | Carbocyclic nucleoside analogs useful as immunosuppressants |
| US5244896A (en) | 1990-09-14 | 1993-09-14 | Marion Merrell Dow Inc. | Carbocyclic adenosine analogs useful as immunosuppressants |
| US5096700A (en) | 1990-09-28 | 1992-03-17 | The Procter & Gamble Company | Halogenated aminohexanoates and aminobutyrates antimicrobial agents |
| US5290788A (en) | 1990-10-03 | 1994-03-01 | Pfizer Inc. | Indole derivatives as antiallergy and antiinflammatory agents |
| US5216165A (en) | 1990-10-03 | 1993-06-01 | American Home Products Corporation | N-substituted aminoquinolines as analgesic agents |
| US5143918A (en) | 1990-10-11 | 1992-09-01 | Merck & Co., Inc. | Halomacrolides and derivatives having immunosuppressive activity |
| US5428073A (en) | 1990-10-20 | 1995-06-27 | Bayer Aktiengesellschaft | Antimicrobial agents which are substituted 2-cyclohexan-1-yl-amine compounds. |
| US5196441A (en) | 1990-10-20 | 1993-03-23 | Bayer Aktiengesellschaft | Compounds useful as antimicrobial agents |
| US5298498A (en) | 1990-12-07 | 1994-03-29 | The Upjohn Company | Phosphonic acid derivatives useful as anti-inflammatory agents |
| US5209930A (en) | 1990-12-10 | 1993-05-11 | Rohm And Haas Company | Preparation and use of n-iodopropargyl oxycarbonyl amino acid esters and derivatives as antimicrobial agents |
| US5464849A (en) | 1991-01-09 | 1995-11-07 | Pfizer Inc. | N-hydroxyurea derivatives as antiallergy and antiinflammatory agents |
| US5319099A (en) | 1991-01-21 | 1994-06-07 | Shionogi Seiyaku Kabushiki Kaisha | 3-benzylidene-1-carbamoyl-2-pyrrolidone compounds useful as antiinflammatory agents |
| US5177079A (en) | 1991-01-31 | 1993-01-05 | Warner-Lambert Company | 2-substituted-4,6-di-tertiarybutyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5340815A (en) | 1991-01-31 | 1994-08-23 | Warner-Lambert Company | 2-substituted-4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5432181A (en) | 1991-01-31 | 1995-07-11 | Warner-Lambert Company | Substituted heteroaryl analogs of 4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5248682A (en) | 1991-01-31 | 1993-09-28 | Warner-Lambert Company | 2-substituted-4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5302597A (en) | 1991-01-31 | 1994-04-12 | Warner-Lambert Company | 2-substituted-4,6-di-tertiarybutyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5679640A (en) | 1991-02-12 | 1997-10-21 | Cytel Corporation | Immunosuppressant peptides |
| US5359066A (en) | 1991-02-28 | 1994-10-25 | Wakunaga Pharmaceutical Co., Ltd. | Certain tricyclic pyrido[3,2,1-ij]cinnoline-8-carboxylates, useful as antimicrobial agents |
| US5874479A (en) | 1991-03-01 | 1999-02-23 | Warner-Lambert Company | Therapeutic permeation enhanced-wound healing compositions and methods for preparing and using same |
| US5863938A (en) | 1991-03-01 | 1999-01-26 | Warner Lambert Company | Antibacterial-wound healing compositions and methods for preparing and using same |
| US5856364A (en) | 1991-03-01 | 1999-01-05 | Warner Lambert Company | Therapeutic antiviral-wound healing compositions and methods for preparing and using same |
| US5674912A (en) | 1991-03-01 | 1997-10-07 | Warner-Lambert Company | Sunscreen-wound healing compositions and methods for preparing and using same |
| US5516764A (en) | 1991-03-07 | 1996-05-14 | Mect Corporation | Anti-inflammatory agent |
| US5428016A (en) | 1991-03-13 | 1995-06-27 | Morinaga Milk Industry Co., Ltd. | Antimicrobial peptide and antimicrobial agent |
| US5457118A (en) | 1991-04-04 | 1995-10-10 | Pfizer Inc. | Pyridine derived agents for cardiovascular diseases |
| US5705523A (en) | 1991-04-04 | 1998-01-06 | Pfizer Inc. | Pyridine- and imidazole-derived agents for cardiovascular diseases |
| US5147877A (en) | 1991-04-18 | 1992-09-15 | Merck & Co. Inc. | Semi-synthetic immunosuppressive macrolides |
| US5688949A (en) | 1991-04-22 | 1997-11-18 | Otsuka Pharmaceutical Factory, Inc. | Pyrazolo 1,5-A!pyrimidine derivatives and anti-inflammatory agent containing the same |
| US5093338A (en) | 1991-04-23 | 1992-03-03 | Merck & Co., Inc. | Lipophilic macrolide useful as an immunosuppressant |
| US5091389A (en) | 1991-04-23 | 1992-02-25 | Merck & Co., Inc. | Lipophilic macrolide useful as an immunosuppressant |
| US5424396A (en) | 1991-04-24 | 1995-06-13 | Morinaga Milk Industry Co., Ltd. | Antimicrobial peptide and antimicrobial agent |
| US5223503A (en) | 1991-04-29 | 1993-06-29 | Eli Lilly And Company | 6-substituted pyrido[2,3-d]pyrimidines as antineoplastic agents |
| US5225571A (en) | 1991-04-30 | 1993-07-06 | Allergan, Inc. | Substituted dihydroxy-bis-[5-hydroxy-2(5H)-furanone-4-yl]-alkanes as anti-inflammatory agents |
| US5183906A (en) | 1991-04-30 | 1993-02-02 | Allergan, Inc. | 2- and 5-alkyl and phenyl substituted 4-(1-hydroxy, 1-acyloxy or 1-carbamoyloxy)-5-hydroxy-2 (5h)-furanones as anti-inflammatory agents |
| US5250700A (en) | 1991-05-01 | 1993-10-05 | American Home Products Corporation | Phenyl pyrazolidinones as bronchodilators and anti-inflammatory agents |
| US5191084A (en) | 1991-05-01 | 1993-03-02 | American Home Products Corporation | Phenyl pyrazolidinones as bronchodilators and anti-inflammatory agents |
| US5250552A (en) | 1991-05-09 | 1993-10-05 | Warner-Lambert Company | 3-[thiazolidinone, oxazolidinone, imidazolidinone]-indoles as antiinflammatory agents |
| US5143929A (en) | 1991-05-09 | 1992-09-01 | Warner-Lambert Company | 2-substituted thiazolidinone, oxazolidinone, and imidazolidinone derivatives of fenamates as antiinflammatory agents |
| US5143927A (en) | 1991-05-09 | 1992-09-01 | Warner-Lambert Company | 3-(thiazolidone, oxazolidinone, imidazolidinone)-indoles as antiinflammatory agents |
| US5114958A (en) | 1991-05-09 | 1992-05-19 | Warner-Lambert Company | 1,2,4-oxadiazole and 1,2,4-thiadiazole derivatives of fenamates as antiinflammatory agents |
| US5250678A (en) | 1991-05-13 | 1993-10-05 | Merck & Co., Inc. | O-aryl, O-alkyl, O-alkenyl and O-alkynylmacrolides having immunosuppressive activity |
| US5565560A (en) | 1991-05-13 | 1996-10-15 | Merck & Co., Inc. | O-Aryl,O-alkyl,O-alkenyl and O-alkynylmacrolides having immunosuppressive activity |
| US5532248A (en) | 1991-05-13 | 1996-07-02 | Merck Co., Inc. | O-aryl,O-alkyl, and O-alkenyl-macrolides having immunosuppressive activity |
| US5162334A (en) | 1991-05-13 | 1992-11-10 | Merck & Co., Inc. | Amino O-alkyl, O-alkenyl and O-alkynlmacrolides having immunosuppressive activity |
| US5262533A (en) | 1991-05-13 | 1993-11-16 | Merck & Co., Inc. | Amino O-aryl macrolides having immunosuppressive activity |
| US5432183A (en) | 1991-05-31 | 1995-07-11 | Pfizer Inc. | Use of rapamycin prodrugs as immunosuppressant agents |
| US5347029A (en) | 1991-06-19 | 1994-09-13 | The Upjohn Company | Dialkyl (dialkoxyphosphinyl)methyl phosphates as anti-inflammatory agents |
| US5124347A (en) | 1991-07-31 | 1992-06-23 | Warner-Lambert Co. | 3-5-ditertiarybutylphenyl-4-hydroxymethylidene derivatives of 1,3-dihydro-2H-indole-2-ones as antiinflammatory agents |
| US5149701A (en) | 1991-08-01 | 1992-09-22 | Merck & Co., Inc. | C-31 methylated FR-900520 cyclic hemiketal immunosuppressant agents |
| US5273979A (en) | 1991-08-01 | 1993-12-28 | Merck & Co., Inc. | C-31 desmethyl FR-900520 cyclic hemiketal immunosuppressant agent |
| US5169851A (en) | 1991-08-07 | 1992-12-08 | American Home Products Corporation | Rapamycin analog as immunosuppressants and antifungals |
| US5138051A (en) | 1991-08-07 | 1992-08-11 | American Home Products Corporation | Rapamycin analogs as immunosuppressants and antifungals |
| US5202332A (en) | 1991-08-07 | 1993-04-13 | American Home Products Corporation | Rapamycin analog as immunosuppressant |
| US5189042A (en) | 1991-08-22 | 1993-02-23 | Merck & Co. Inc. | Fluoromacrolides having immunosuppressive activity |
| US5202350A (en) | 1991-08-29 | 1993-04-13 | Bristol-Myers Squibb Co. | Furanone anti-inflammatory agents |
| US5597831A (en) | 1991-08-29 | 1997-01-28 | Vufb A.S | 6-[X-(2-hydroxyethyl) aminoalkyl]-5,11-dioxo-5,6-dihydro-11-H-indeno[1,2-c]isoquinolines and their use as antineoplastic agents |
| US5169963A (en) | 1991-08-30 | 1992-12-08 | Allergan, Inc. | Di-(5-hydroxy-2(5H)2-oxo-4-furyl)alkylmethyl-alpha,omega alkanedioates and N,N-bis-(5-hydroxy-2(5H)2-oxo-4-furyl)alkylmethyl-alpha,omega-dialkanoic acid amides as anti-inflammatory agents |
| US5171864A (en) | 1991-08-30 | 1992-12-15 | Allergan, Inc. | Di-(5-hydroxy-2(5H)-2-oxo-4-furyl)methyl-alpha,omega alkane-dioates and N,N-bis-(5-hydroxy-2(5H)-2-oxo-4-furyl)methyl-alpha,omega-dialkanoic acid amides as anti-inflammatory agents |
| US5604234A (en) | 1991-09-05 | 1997-02-18 | Abbott Laboratories | Substituted thiol macrolactam immunomodulators |
| US5708002A (en) | 1991-09-05 | 1998-01-13 | Abbott Laboratories | Macrocyclic immunomodulators |
| US5270319A (en) | 1991-09-09 | 1993-12-14 | Warner-Lambert Company | 5-hydroxy-2-pyrimidinylmethylene derivatives useful as antiinflammatory agents |
| US5344925A (en) | 1991-09-09 | 1994-09-06 | Merck & Co., Inc. | Imidazolidyl macrolides having immunosuppressive activity |
| US5349061A (en) | 1991-09-09 | 1994-09-20 | Merck & Co., Inc. | O-heteroaryl, O-alkylheteroaryl, O-alkenylheteroaryl and O-alkynylheteroarylmacrolides having immunosuppressive activity |
| US5208241A (en) | 1991-09-09 | 1993-05-04 | Merck & Co., Inc. | N-heteroaryl, n-alkylheteroaryl, n-alkenylheteroaryl and n-alkynylheteroarylmacrolides having immunosuppressive activity |
| US5252732A (en) | 1991-09-09 | 1993-10-12 | Merck & Co., Inc. | D-heteroaryl, O-alkylheteroaryl, O-alkenylheteroaryl and O-alkynylheteroarylmacrolides having immunosuppressive activity |
| US5247076A (en) | 1991-09-09 | 1993-09-21 | Merck & Co., Inc. | Imidazolidyl macrolides having immunosuppressive activity |
| US5348957A (en) | 1991-09-09 | 1994-09-20 | Warner-Lambert Company | 5-hydroxy-2-pyrimidinylmethylene derivatives useful as antiinflammatory agents |
| US5378723A (en) | 1991-09-26 | 1995-01-03 | The United States Of America As Represented By The Secretary Of The Dept. Of Health And Human Services | Carbamate analogs of thiaphysovenine and method for inhibiting cholinesterases |
| US5318978A (en) | 1991-10-15 | 1994-06-07 | Warner-Lambert Company | Azabicyclo oxime and amine cholinergic agents and methods of treatment |
| US5464842A (en) | 1991-10-15 | 1995-11-07 | Warner-Lambert Company | Azabicyclo oxime and amine cholinergic agents and methods of treatment |
| US5280045A (en) | 1991-10-16 | 1994-01-18 | The Procter & Gamble Company | 4(3,5-bis(1,1-dimethylethyl-4-hydroxyphenyl)-4-oxobutanamide compound useful as an anti-inflammatory agent |
| US5266567A (en) | 1991-10-24 | 1993-11-30 | Rohm And Haas Company | Halopropargylated cyclic quaternary ammonium compounds as antimicrobial agents |
| US5354862A (en) | 1991-10-24 | 1994-10-11 | Rohm And Haas Company | Preparation and the use of halopropargylated cyclic quaternary ammonium compounds as antimicrobial agents |
| US5151413A (en) | 1991-11-06 | 1992-09-29 | American Home Products Corporation | Rapamycin acetals as immunosuppressant and antifungal agents |
| US6306651B1 (en) | 1991-11-22 | 2001-10-23 | The General Hospital Corporation | Specific tolerance in transplantation |
| US5905085A (en) | 1991-12-06 | 1999-05-18 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl deazaadenyl analogs useful as immunosuppressants |
| US5723466A (en) | 1991-12-06 | 1998-03-03 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5817660A (en) | 1991-12-06 | 1998-10-06 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5817661A (en) | 1991-12-06 | 1998-10-06 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5817672A (en) | 1991-12-06 | 1998-10-06 | Hoechst Marion Roussel, Inc. | Trans cyclopentanyl purine analogs useful as immunosuppressants |
| US5472973A (en) | 1991-12-12 | 1995-12-05 | Scios Nova Inc. | Fluorenyl derivatives as anti-inflammatory agents |
| US5478828A (en) | 1991-12-13 | 1995-12-26 | Bristol-Myers Squibb Company | Piperazinyl-and piperidinyl-cyclohexanols |
| US5387593A (en) | 1991-12-13 | 1995-02-07 | Briston-Myers Squibb | Piperazinyl-and piperidinyl-cyclohexanols |
| US5212189A (en) | 1991-12-17 | 1993-05-18 | Warner-Lambert Company | Thiadiazole or oxadiazole analogs of fenamic acids containing substituted hydroxamate side chains as antiinflammatory agents |
| US5225418A (en) | 1991-12-17 | 1993-07-06 | Du Pont Merck Pharmaceutical Company | 5H-(1,2)benzisothiazolo[2,3-a]quinoline-5-ones and analogs as antiinflammatory agents |
| US5393756A (en) | 1991-12-17 | 1995-02-28 | The Du Pont Merck Pharmaceutical Company | 5H-[1,2]benzisothiazolo[2,3-a]quinoline-5-ones and analogs as antiinflammatory agents |
| US5438064A (en) | 1991-12-23 | 1995-08-01 | American Home Products Corporation | Derivatives of 4-anilinoquinoline-3-carboxamide as analgesic agents |
| US5238689A (en) | 1992-01-07 | 1993-08-24 | Procept, Inc. | Use of ruthenium red as immunosuppressive agents |
| US5656591A (en) | 1992-01-23 | 1997-08-12 | Morinaga Milk Industry Co., Ltd. | Antimicrobial agents and method for treating products therewith |
| US5461062A (en) | 1992-02-12 | 1995-10-24 | Shionogi & Co., Ltd. | Condensed imidazopyridine derivatives |
| US5658564A (en) | 1992-02-19 | 1997-08-19 | The General Hospital Corporation | Xenograft thymus |
| US5220025A (en) | 1992-02-24 | 1993-06-15 | Warner-Lambert Company | 2-substituted amino-4, 6-di-tertiary-butyl-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents |
| US5196431A (en) | 1992-02-24 | 1993-03-23 | Warner-Lambert Company | 2-substituted amino-4, 6-di-tertiary-buthyl-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents |
| US5284949A (en) | 1992-02-24 | 1994-02-08 | Warner-Lambert Company | 2-substituted amino-4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines as antiinflammatory agents |
| US5506233A (en) | 1992-03-02 | 1996-04-09 | Pfizer Inc. | Desosamino derivatives of macrolides as immunosuppressants and antifungal agents |
| US5157051A (en) | 1992-03-05 | 1992-10-20 | The Dow Chemical Company | Composition and use of 3-thiocyano-2-halo-2-propenenitriles as antimicrobial agents |
| US5187175A (en) | 1992-03-06 | 1993-02-16 | Warner-Lambert Company | 2-carbonyl substituted-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents |
| US5196424A (en) | 1992-03-24 | 1993-03-23 | Eli Lilly And Company | N-[2-amino-4-substituted[[(pyrrollo or pyrido)[2,3-d]pyrimidinyl]-alkyl]benzoyl]-L-glutamic acids |
| US5389675A (en) | 1992-03-27 | 1995-02-14 | The United States Of America As Represented By The Department Of Health And Human Services | Mixed ligand metal complexes of nitric oxide-nucleophile adducts useful as cardiovascular agents |
| US5686424A (en) | 1992-04-08 | 1997-11-11 | Miles Inc. | 2-oxoethyl derivatives as immunosuppressants |
| US5608056A (en) | 1992-04-13 | 1997-03-04 | Fujisawa Pharmaceutical Co., Ltd. | Substituted 3-pyrrolidinylthio-carbapenems as antimicrobial agents |
| US5256664A (en) | 1992-04-28 | 1993-10-26 | Bristol-Myers Squibb Company | Antidepressant 3-halophenylpiperazinylpropyl derivatives of substituted triazolones and triazoldiones |
| US5646276A (en) | 1992-05-13 | 1997-07-08 | Bristol-Myers Squibb Co. | Diazepine containing dual action inhibitors |
| US5859239A (en) | 1992-05-18 | 1999-01-12 | E. R. Squibb & Sons, Inc. | Mercaptoalkanoylamino and acylmercaptoalkanoylamino benzoxazepines and benzothiazepines |
| US5723457A (en) | 1992-05-18 | 1998-03-03 | E. R. Squibb & Sons, Inc. | Acylmercaptoalkanoylamino and mercaptoalkanoylamino benzazepines |
| US5552397A (en) | 1992-05-18 | 1996-09-03 | E. R. Squibb & Sons, Inc. | Substituted azepinone dual inhibitors of angiotensin converting enzyme and neutral exdopeptidase |
| US5346913A (en) | 1992-05-26 | 1994-09-13 | Rohm And Haas Company | N-iodopropargyl hydantoin compounds, compositions, preparation, and use as antimicrobial agents |
| US5244917A (en) | 1992-06-02 | 1993-09-14 | The Dupont Merck Pharmaceutical Company | Substituted naphthofurans as anti-inflammatory agents |
| US5284840A (en) | 1992-06-12 | 1994-02-08 | Merck & Co., Inc. | Alkylidene macrolides having immunosuppressive activity |
| US5284877A (en) | 1992-06-12 | 1994-02-08 | Merck & Co., Inc. | Alkyl and alkenyl macrolides having immunosuppressive activity |
| US5527820A (en) | 1992-06-23 | 1996-06-18 | Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai | Antibiotics having immunosuppressive activity, delaminomycins and processes for the production of the same |
| US5338753A (en) | 1992-07-14 | 1994-08-16 | Sumner H. Burstein | (3R,4R)-Δ6 -tetrahydrocannabinol-7-oic acids useful as antiinflammatory agents and analgesics |
| US5739279A (en) | 1992-07-31 | 1998-04-14 | Pfizer Inc. | Peptidyl 4-amino-2,2-difluoro-3-oxo-1,6-hexanedioic acid derivatives as antiinflammatory agents |
| US5240929A (en) | 1992-08-03 | 1993-08-31 | Warner-Lambert Company | 2-heterocyclic-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5312821A (en) | 1992-08-03 | 1994-05-17 | Warner-Lambert Company | 2-heterocyclic-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents |
| US5500417A (en) | 1992-09-23 | 1996-03-19 | The Upjohn Company | Arylmethylphosphonates and phosphonic acids useful as anti-inflammatory agents |
| US5593980A (en) | 1992-09-23 | 1997-01-14 | The Upjohn Company | Arylmethylphosphonates and phosphonic acids useful as anti-inflammatory agents |
| US5736143A (en) | 1992-10-02 | 1998-04-07 | Alberta Research Council | Anti-inflammatory, tolerogenic and immunoinhibiting properties of carbohydrate binding-peptides |
| US5595742A (en) | 1992-10-06 | 1997-01-21 | Toyo Seiyaku Kabushiki Kaisha | Antimicrobial agent for staphylococcus |
| US5698529A (en) | 1992-10-08 | 1997-12-16 | Supratek Pharma, Inc. | Chemotherapeutic compositions |
| US5665772A (en) | 1992-10-09 | 1997-09-09 | Sandoz Ltd. | O-alkylated rapamycin derivatives and their use, particularly as immunosuppressants |
| US5604229A (en) | 1992-10-21 | 1997-02-18 | Yoshitomi Pharmaceutical Industries, Ltd. | 2-amino-1,3-propanediol compound and immunosuppressant |
| US5719176A (en) | 1992-10-21 | 1998-02-17 | Yoshitomi Pharmaceutical Industries, Ltd. | 2-amino-1,3-propanediol compound and immunosuppressant |
| US5843452A (en) | 1992-11-09 | 1998-12-01 | Pharmagenesis, Inc. | Immunotherapy composition and method |
| US5554789A (en) | 1992-11-10 | 1996-09-10 | Laboratorios Menarini S.A. | Arylpropionic derivative, a process for the preparation and the use thereof as an analgesic agent |
| US5260300A (en) | 1992-11-19 | 1993-11-09 | American Home Products Corporation | Rapamycin carbonate esters as immuno-suppressant agents |
| US5552424A (en) | 1992-11-20 | 1996-09-03 | Pfizer Inc. | Isoxazolines as antiinflammatory agents |
| US5541233A (en) | 1992-12-01 | 1996-07-30 | Minnesota Mining And Manufacturing Company | Durable anti-microbial agent |
| US5643971A (en) | 1992-12-01 | 1997-07-01 | Minnesota Mining And Manufacturing Company | Durable anti-microbial agents |
| US5807889A (en) | 1992-12-09 | 1998-09-15 | H. Lundbeck A/S | Aminomethylindans, -benzofuranes and -benzothiophenes |
| US5508277A (en) | 1992-12-11 | 1996-04-16 | Adir Et Compagnie | Bicyclic pyrimidines |
| US5760002A (en) | 1992-12-22 | 1998-06-02 | The Proctor & Gamble Company | Diflouro pentapeptide derivative anti-inflammatory agents |
| US5693645A (en) | 1992-12-23 | 1997-12-02 | Beth Israel Deaconess Medical Center, Inc. | Use of spiperone or spiperone derivatives as immunosuppressant agents |
| US5580888A (en) | 1992-12-23 | 1996-12-03 | Celltech Therapeutics Limited | Styryl derivatives as anti-inflammatory agents |
| US5298522A (en) | 1993-01-22 | 1994-03-29 | Pfizer Inc. | 6-chloro-5-fluoro-3-(2-thenoyl)-2-oxindole-1-carboxamide as an analgesic and anti-inflammatory agent while maintaining a normal urine protein/creatinine ratio |
| US5594027A (en) | 1993-01-29 | 1997-01-14 | American Cyanamid Company | Aminocycloalkanobenzodioxoles as beta-3 selective adrenergic agents |
| US5510376A (en) | 1993-01-29 | 1996-04-23 | American Cyanamid Company | Aminocycloalkanobenzodioxoles as beta-3 selective adrenergic agents |
| US5424301A (en) | 1993-02-01 | 1995-06-13 | Warner-Lambert Company | Starch stabilized o-substituted tetrahydropyridine oxime cholinergic agents |
| US5607959A (en) | 1993-02-09 | 1997-03-04 | Pfizer Inc. | Oxindole 1-[N-(alkoxycarbonyl) ] carboxamides and 1-(N-carboxamido) carboxamides as antiinflammatory agents |
| US5633277A (en) | 1993-02-09 | 1997-05-27 | Miles Inc. | Sulfonamide aminomethylene derivatives as immunosuppressants |
| US5686469A (en) | 1993-02-09 | 1997-11-11 | Miles Inc. | Aminomethylene derivaties as immunosuppressants |
| US5385918A (en) | 1993-02-09 | 1995-01-31 | Miles Inc. | Aminomethylene-peptides as immunosuppressants |
| US5639455A (en) | 1993-02-17 | 1997-06-17 | Ajinomoto Co., Inc. | Immunosuppressant |
| US5665715A (en) | 1993-02-23 | 1997-09-09 | Merrell Pharmaceuticals Inc. | Farnesyl:protein transferase inhibitors as anticancer agents |
| US5463181A (en) | 1993-02-23 | 1995-10-31 | Merrell Dow Pharmaceuticals Inc. | Farnesyl: protein transferase inhibitors as anticancer agents |
| US5455230A (en) | 1993-02-23 | 1995-10-03 | Aktiebolaget Astra | Delta opioid receptor antagonists and their use as analgesic agents |
| US5292736A (en) | 1993-02-26 | 1994-03-08 | Sterling Winthrop Inc. | Morpholinoalkylindenes as antiglaucoma agents |
| US5530026A (en) | 1993-03-03 | 1996-06-25 | Universite Laval | Certain aryl-ureido anti-cancer agents |
| US5391544A (en) | 1993-03-04 | 1995-02-21 | Kagome Kabushiki Kaisha | Cyathane derivatives and antimicrobial agents containing same |
| US5387586A (en) | 1993-03-05 | 1995-02-07 | Adir Et Compagnie | (Aryl(alkyl)carbonyl)-heterocyclic compounds, compositions and use |
| US5484788A (en) | 1993-03-26 | 1996-01-16 | Beth Israel Hospital Association | Buspirone as a systemic immunosuppressant |
| US5534546A (en) | 1993-03-31 | 1996-07-09 | Kagome Kabushiki Kaisha | Indene derivatives and antimicrobial agents containing same |
| US5576341A (en) | 1993-04-16 | 1996-11-19 | Nippon Chemiphar Co., Ltd. | 2-[[2-(N-isobutyl-N-methyl)amino]benzylsulfinyl]-benzimidazole as antimicrobial agent |
| US5459151A (en) | 1993-04-30 | 1995-10-17 | American Home Products Corporation | N-acyl substituted phenyl piperidines as bronchodilators and antiinflammatory agents |
| US5393771A (en) | 1993-05-12 | 1995-02-28 | Brisol-Myers Squibb Company | 4-substituted benzopyran and related compounds |
| US5654294A (en) | 1993-05-13 | 1997-08-05 | Bristol-Myers Squibb | Spiro lactam dual action inhibitors |
| US5380738A (en) | 1993-05-21 | 1995-01-10 | Monsanto Company | 2-substituted oxazoles further substituted by 4-fluorophenyl and 4-methylsulfonylphenyl as antiinflammatory agents |
| US5786350A (en) | 1993-05-24 | 1998-07-28 | Gruppo Lepetit S.P.A. | 36-derivatives of rifamycins and their use as antimicrobial agents |
| US6060049A (en) | 1993-05-24 | 2000-05-09 | Ximerex, Inc. | Surrogate tolerogenesis for the development of tolerance to xenografts |
| US6379668B1 (en) | 1993-06-02 | 2002-04-30 | Research Corporation Technologies, Inc. | Use of anti-CD45 leukocyte antigen antibodies for immunomodulation |
| US6099838A (en) | 1993-06-02 | 2000-08-08 | Reasearch Corporation Technologies, Inc. | Pharmaceutical compositions comprising anti-CD45RB antibodies for the inhibition of T-cell mediated immune responses |
| US6024957A (en) | 1993-06-02 | 2000-02-15 | Research Corporation Technologies, Inc. | Immunomodulators and methods for the prevention and reversal of organ transplant rejection using same |
| US5288693A (en) | 1993-06-25 | 1994-02-22 | Rohm And Haas Company | 2-(3-oxoalk(en)yl)-3-isothiazolones and derivatives as antimicrobial agents |
| US5661129A (en) | 1993-06-26 | 1997-08-26 | Schwarz Pharma Ag | Organic nitrates containing a disulfide group as cardiovascular agents |
| US5776974A (en) | 1993-07-02 | 1998-07-07 | The University Of Nottingham | Immunosuppressant compounds |
| US5494895A (en) | 1993-07-22 | 1996-02-27 | Merck & Co., Inc. | Scorpion peptide margatoxin with immunosuppressant activity |
| US5534508A (en) | 1993-07-29 | 1996-07-09 | Katayama Seiyakusyo Co., Ltd. | Cephem compounds and antimicrobial agents |
| US5731322A (en) | 1993-08-06 | 1998-03-24 | Smithkline Beecham S.P.A. | Octahydro-1H-pyrrolo 3,2-g!and 2,3-g!isoquinoline derivatives |
| US5780026A (en) | 1993-08-09 | 1998-07-14 | Nippon Zoki Pharmaceutical Co., Ltd. | Immunomodulating and antiinflammatory agent |
| US5827837A (en) | 1993-08-20 | 1998-10-27 | The Regents Of The University Of California | Polyanion anti-inflammatory agents |
| US5385902A (en) | 1993-09-01 | 1995-01-31 | Rohm And Haas Company | Iodopropargylated oxalic derivatives as antimicrobial agents |
| US5512678A (en) | 1993-09-14 | 1996-04-30 | Merrell Pharmaceuticals Inc. | 5-(1-fluoro-vinyl)-1H-pyrimidine-2,4-dione derivatives useful as antineoplastic agents |
| US5684004A (en) | 1993-09-24 | 1997-11-04 | Merrell Pharmaceuticals, Inc. | Triaryl-ethylene derivatives |
| US5525633A (en) | 1993-09-24 | 1996-06-11 | Merrell Dow Pharmaceuticals Inc. | Triaryl-ethylene derivatives |
| US5733939A (en) | 1993-09-29 | 1998-03-31 | Alliance Pharmaceutical Corp. | Fluorocarbons as anti-inflammatory agents |
| US5470885A (en) | 1993-09-29 | 1995-11-28 | The Research Foundation Of The State University Of New York | Fluorocarbons as anti-inflammatory agents |
| US5401758A (en) | 1993-10-07 | 1995-03-28 | Bristol-Myers Squibb Company | Pyridinyl cyanoguanidine compounds |
| US5837702A (en) | 1993-10-07 | 1998-11-17 | Bristol-Myers Squibb Co. | 4-arylamino-benzopyran and related compounds |
| US5547966A (en) | 1993-10-07 | 1996-08-20 | Bristol-Myers Squibb Company | Aryl urea and related compounds |
| US5681571A (en) | 1993-10-08 | 1997-10-28 | Duotol Ab | Immunological tolerance-inducing agent |
| US6153203A (en) | 1993-10-08 | 2000-11-28 | Duotol Ab | Immunological tolerance-inducing agent |
| US6365163B1 (en) | 1993-10-08 | 2002-04-02 | Duotol | Immunological tolerance-inducing agent |
| US6322796B1 (en) | 1993-10-08 | 2001-11-27 | Duotol Ab | Immunological tolerance-inducing agent |
| US5580892A (en) | 1993-10-22 | 1996-12-03 | Allergan | Method for using 2-(2-alkylphenylamino)-oxazolines as adrenergic agents |
| US5708015A (en) | 1993-10-22 | 1998-01-13 | Allergan | Method for using pharmaceutical compositions containing 2-(2-alkyphenyl-amino)-thiazolines as adrenergic agents |
| US5468729A (en) | 1993-10-26 | 1995-11-21 | Alpha 1 Biomedicals | Method for treatment of autoimmune hepatitis |
| US5880161A (en) | 1993-11-05 | 1999-03-09 | The United States Of America As Represented By The Department Of Health And Human Services | Therapeutic polyamines |
| US5554373A (en) | 1993-11-05 | 1996-09-10 | Seabrook; Samuel G. | Compositions containing anti-microbial agents and methods for making and using same |
| US5436265A (en) | 1993-11-12 | 1995-07-25 | Merck Frosst Canada, Inc. | 1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents |
| US5583139A (en) | 1993-11-19 | 1996-12-10 | Abbott Laboratories | Marcolide immunomodulators |
| US5672605A (en) | 1993-11-19 | 1997-09-30 | Abbott Laboratories | Macrolide immunomodulators |
| US5696111A (en) | 1993-11-22 | 1997-12-09 | Merck & Co., Inc. | 3-acylaminobenzazepines |
| US5679672A (en) | 1993-11-22 | 1997-10-21 | Merck & Co., Inc. | Benzodiazepines |
| US5686434A (en) | 1993-11-26 | 1997-11-11 | Pfizer Inc. | 3-aryl-2-isoxazolines as antiinflammatory agents |
| US5716967A (en) | 1993-11-26 | 1998-02-10 | Pfizer Inc. | Isoxazoline compounds as antiinflammatory agents |
| US5612350A (en) | 1993-11-30 | 1997-03-18 | Abbott Laboratories | Macrocyclic immunomodulators with novel cyclohexyl ring replacements |
| US5770612A (en) | 1993-12-21 | 1998-06-23 | Eli Lilly And Company | Methods of treating menstrual symptoms and compositions there for |
| US5631283A (en) | 1994-02-02 | 1997-05-20 | The United States Of America As Represented By The Secretary Of The Army | Use of sialic acid or antibodies to sialidase as anti-infectious agents and anti-inflammatory agents |
| US5593960A (en) | 1994-02-18 | 1997-01-14 | The Regents Of The University Of California | Cyclic heptapeptide anti-inflammatory agent |
| US5444043A (en) | 1994-02-18 | 1995-08-22 | The Regents Of The University Of California | Cyclic heptapeptide anti-inflammatory agent |
| US5508417A (en) | 1994-02-23 | 1996-04-16 | Rohm And Haas Company | Broad-spectrum isothiazole antimicrobial agents |
| US5482925A (en) | 1994-03-17 | 1996-01-09 | Comedicus Incorporated | Complexes of nitric oxide with cardiovascular amines as dual acting cardiovascular agents |
| WO1995025536A1 (en) | 1994-03-21 | 1995-09-28 | Washington University | Methods and compositions for inhibition of hepatic clearance of tissue factor pathway inhibitor |
| US5741526A (en) | 1994-03-25 | 1998-04-21 | Kabushiki Kaisha Kaisui Kagaku Kenkyujo | Antimicrobial agent |
| US5451686A (en) | 1994-04-15 | 1995-09-19 | Allergan, Inc. | 3 and 5 alkyl and phenyl 4-(hydroxy or acyloxy)-alkyl substituted 2(5H)-furanones as anti-inflammatory agents |
| US5686482A (en) | 1994-04-28 | 1997-11-11 | Yamanouchi Pharmaceutical Co., Ltd. | N-(3-pyrrolidinyl) benzamide derivative |
| US5683709A (en) | 1994-05-05 | 1997-11-04 | Ciba Vision Corporation | Poly(benzalkonium salt) as an anti-microbial agent for aqueous drug compositions |
| US5814648A (en) | 1994-05-19 | 1998-09-29 | Pfizer Inc. | N-hydroxyureas as antiinflammatory agents |
| US5476876A (en) | 1994-05-24 | 1995-12-19 | The Procter & Gamble Company | Di-tert-butylphenol compounds useful as anti-inflammatory agents |
| US5880280A (en) | 1994-06-15 | 1999-03-09 | Merck & Co., Inc. | Aryl, alkyl, alkenyl and alkynylmacrolides having immunosuppressive activity |
| US5550233A (en) | 1994-06-21 | 1996-08-27 | Merck & Co., Inc. | Aryl, alkyl, alkenyl and alkynylmacrolides having immunosuppressive activity |
| US5635516A (en) | 1994-06-28 | 1997-06-03 | Adir Et Compagnie | (Thia) cycloalkyl[B]indole compounds as anti-inflammatory agents |
| US5786344A (en) | 1994-07-05 | 1998-07-28 | Arch Development Corporation | Camptothecin drug combinations and methods with reduced side effects |
| US5656661A (en) | 1994-07-27 | 1997-08-12 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5674891A (en) | 1994-07-27 | 1997-10-07 | The Procter & Gamble Company | Dihydrobenzothiophene compounds useful as anti-inflammatory agents |
| US5753668A (en) | 1994-08-01 | 1998-05-19 | The United States Of America As Represented By The Department Of Health And Human Services | Substituted benzyloxypyrimidines and their inactivation of O6 -alkylguanine-DNA alkyltransferase |
| US5525606A (en) | 1994-08-01 | 1996-06-11 | The United States Of America As Represented By The Department Of Health And Human Services | Substituted 06-benzylguanines and 6(4)-benzyloxypyrimidines |
| US5637586A (en) | 1994-08-11 | 1997-06-10 | Kureha Chemical Industry Co., Ltd. | Benzimidazolesulfonamide derivatives and pharmaceutical composition |
| US5508026A (en) | 1994-08-29 | 1996-04-16 | The Regents Of The University Of California | Indole alkaloids useful as UV protective and anti-inflammatory agents |
| US5498405A (en) | 1994-08-29 | 1996-03-12 | The Regents Of The University Of California | Indole alkaloids useful as UV protective and anti-inflammatory agents |
| US5684002A (en) | 1994-09-07 | 1997-11-04 | The Procter & Gamble Company | Dihydorbenzofuran and related compounds useful as anti-inflammatory agents |
| US5693648A (en) | 1994-09-30 | 1997-12-02 | Merck & Co., Inc. | O-aryl, O-alkyl, O-alkenyl and O-alkynyl-macrolides having immunosuppressive activity |
| US5877206A (en) | 1994-10-03 | 1999-03-02 | Mars, Incorporated | Methods for inhibiting topoisomerase using procyanidin oligomers |
| US5837735A (en) | 1994-10-05 | 1998-11-17 | Helsinn Healthcare S.A. | Antiinflammatory agent for external use |
| US5709870A (en) | 1994-10-18 | 1998-01-20 | Rengo Co., Ltd. | Antimicrobial agent |
| US5510361A (en) | 1994-10-20 | 1996-04-23 | The Procter & Gamble Company | Di-tert-butylphenol compounds with heterocyclic moiety, useful as anti-inflammatory agents |
| US5545734A (en) | 1994-10-25 | 1996-08-13 | Merck & Co., Inc. | Aryl and heteroaryl macrolides having immunosuppressive activity |
| US5512687A (en) | 1994-10-28 | 1996-04-30 | Procept, Inc. | Compounds for inhibiting immune response |
| US6255278B1 (en) | 1994-11-10 | 2001-07-03 | Cellena Ag | Composition containing pooled transferrins as an active principle for the induction of immune tolerance against antigens |
| US5622948A (en) | 1994-12-01 | 1997-04-22 | Syntex (U.S.A.) Inc. | Pyrrole pyridazine and pyridazinone anti-inflammatory agents |
| US5723718A (en) | 1994-12-20 | 1998-03-03 | St. Joseph's Hospital And Medical Center | Induction of immune tolerance to tumor cells |
| US5770201A (en) | 1994-12-23 | 1998-06-23 | Rijsuniversiteit Te Leiden | HA-2 antigenic peptide |
| US5552422A (en) | 1995-01-11 | 1996-09-03 | Merck Frosst Canada, Inc. | Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents |
| US5648376A (en) | 1995-01-19 | 1997-07-15 | Pharmagenesis, Inc. | Immunosuppressant diterpene compound |
| US5872109A (en) | 1995-02-07 | 1999-02-16 | Shiseido Company, Ltd. | Anti-inflammatory agent |
| US5506228A (en) | 1995-02-23 | 1996-04-09 | Merck & Co., Inc. | 2,6-diaryl pyridazinones with immunosuppressant activity |
| US5670504A (en) | 1995-02-23 | 1997-09-23 | Merck & Co. Inc. | 2,6-diaryl pyridazinones with immunosuppressant activity |
| US6489330B1 (en) | 1995-03-07 | 2002-12-03 | Novartis International Pharmaceutical Ltd. | Use of penciclovir for the treatment of human herpes-virus-8 |
| US5610196A (en) | 1995-03-22 | 1997-03-11 | Research Corporation Technologies, Inc. | Topical antimicrobial agents |
| US5604262A (en) | 1995-03-22 | 1997-02-18 | Research Corporation Technologies, Inc. | Topical antimicrobial agents |
| US5612060A (en) | 1995-05-25 | 1997-03-18 | Alexander; J. Wesley | Enhancement of transplant graft survival through nutritional immunomodulation and immunosuppressive therapy |
| US5552411A (en) | 1995-05-26 | 1996-09-03 | Warner-Lambert Company | Sulfonylquinolines as central nervous system and cardiovascular agents |
| US5618813A (en) | 1995-05-26 | 1997-04-08 | Abbott Laboratories | Benzo[5.6]pyrano[2.3.4-ij]quinolizine and benzo[5.6]thiopyrano[2.3.4-ij]quinolizine derivatives as antibacterial and antineoplastic agents |
| US5643950A (en) | 1995-06-02 | 1997-07-01 | Ortho Pharmaceutical Corporation | Triphenylalkyl antimicrobial agents |
| US5753715A (en) | 1995-06-02 | 1998-05-19 | Ortho Pharmaceutical Corporation | 2-disubstituted cyclohexenyl and cyclohexyl antimicrobial agents |
| US5874436A (en) | 1995-06-02 | 1999-02-23 | Demers; James P. | Triphenylalkyl antimicrobial agents |
| US5631251A (en) | 1995-06-07 | 1997-05-20 | Merck & Co., Inc. | 5-cyclopropyl-1,4 benzodiazepine-2-ones |
| US5869057A (en) | 1995-06-07 | 1999-02-09 | Rock; Edwin P. | Recombinant vaccines to break self-tolerance |
| US5726171A (en) | 1995-06-07 | 1998-03-10 | Merck & Co Inc | N-(1-alkyl-5-phenyl-2,3,4,5-tetrahydro-1H-benzo B! 1,4!diazepin-3yl)-acetamides |
| US5869478A (en) | 1995-06-07 | 1999-02-09 | Bristol-Myers Squibb Company | Sulfonamido substituted benzopyran derivatives |
| US5691332A (en) | 1995-06-07 | 1997-11-25 | Merck & Co., Inc. | N-(2,4-dioxo-2,3,4,5-tetrahydro-1H-1,5-benzodiazepin-3-yl)-3-amides |
| US5612370A (en) | 1995-06-07 | 1997-03-18 | Bristol-Myers Squibb Company | Phenylglycine and phenylalaninen amido benzopyran derivatives |
| US5612323A (en) | 1995-06-07 | 1997-03-18 | Bristol-Myers Squibb Company | Phosphinic ester substituted benzopyran derivatives |
| US5753687A (en) | 1995-06-19 | 1998-05-19 | Ontogen Corporation | Modulators of proteins with phosphotryrosine recognition units |
| US5744495A (en) | 1995-07-13 | 1998-04-28 | Smithkline Beecham Corporation | N, N-diethyl-8, 8-dipropyl-2-azaspiro 4.5! decane-2-propanamine |
| US6558663B1 (en) | 1995-08-04 | 2003-05-06 | The General Hospital Corporation | Transgenic swine & swine cells having human HLA genes |
| US5686488A (en) | 1995-08-25 | 1997-11-11 | Alcon Laboratories, Inc. | Polyethoxylated castor oil products as anti-inflammatory agents |
| US5776946A (en) | 1995-08-28 | 1998-07-07 | Mcgeer; Patrick L. | Peripheral benzodiazepine receptor ligands as antiinflammatory agents |
| US5856320A (en) | 1995-10-17 | 1999-01-05 | Katayama Seiyakusyo Co., Ltd. | Cephem compounds, their preparation and their use as antimicrobial agents |
| US6103235A (en) | 1995-10-30 | 2000-08-15 | The United States Of America As Represented By The Department Of Health And Human Services | Methods of inducing immune tolerance using immunotoxins |
| US5883119A (en) | 1995-10-31 | 1999-03-16 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5679705A (en) | 1995-10-31 | 1997-10-21 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5696156A (en) | 1995-10-31 | 1997-12-09 | Merck & Co. Inc. | Triterpene derivatives with immunosuppressant activity |
| US5696117A (en) | 1995-11-07 | 1997-12-09 | Ortho Pharmaceutical Corporation | Benzoxazine antimicrobial agents |
| US5854242A (en) | 1995-11-07 | 1998-12-29 | Ortho Pharmaceutical Corporation | Benzoxazine antimicrobial agents |
| US6087096A (en) | 1995-11-13 | 2000-07-11 | Dau; Peter C. | Method of intrafamily fragment analysis of the T cell receptor α and β chain CDR3 regions |
| US5684204A (en) | 1995-11-15 | 1997-11-04 | The Procter & Gamble Company | Sulfur containing di-tert-butylphenol compounds useful as anti-inflammatory agents |
| US5891653A (en) | 1995-12-29 | 1999-04-06 | Attfield; Derrick Cecil | Method of suppressing graft rejection by means of stress proteins |
| US5707990A (en) | 1996-01-30 | 1998-01-13 | Ortho Pharmaceutical Corporation | 2-substituted amino and thio alkyl benzoxazine antimicrobial agents |
| US5821250A (en) | 1996-02-01 | 1998-10-13 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5750543A (en) | 1996-02-01 | 1998-05-12 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5684041A (en) | 1996-02-01 | 1997-11-04 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5618835A (en) | 1996-02-01 | 1997-04-08 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5684031A (en) | 1996-02-01 | 1997-11-04 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5686471A (en) | 1996-02-01 | 1997-11-11 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5672620A (en) | 1996-02-01 | 1997-09-30 | The Procter & Gamble Company | Dihydrobenzofuran and related compounds useful as anti-inflammatory agents |
| US5760041A (en) | 1996-02-05 | 1998-06-02 | American Cyanamid Company | 4-aminoquinazoline EGFR Inhibitors |
| US5859027A (en) | 1996-02-26 | 1999-01-12 | Chektec Corporation | Antimicrobial agent |
| US6037372A (en) | 1996-03-15 | 2000-03-14 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Use of an alkanoyl-L-carnitine for the treatment of glutamate mediated diseases |
| US6043247A (en) | 1996-04-19 | 2000-03-28 | Novo Nordisk A/S | Modulators of molecules with phosphotyrosine recognition units |
| US6006752A (en) | 1996-05-09 | 1999-12-28 | The General Hospital Corporation | Mixed chimerism and tolerance |
| US6412492B1 (en) | 1996-05-09 | 2002-07-02 | The General Hospital Corporation | Mixed chimerism and tolerance |
| US5688825A (en) | 1996-05-31 | 1997-11-18 | University Of Connecticut | Anandamide amidase inhibitors as analgesic agents |
| US5874459A (en) | 1996-05-31 | 1999-02-23 | University Of Connecticut | Anandamide amidase inhibitors as analgesic agents |
| US5739169A (en) | 1996-05-31 | 1998-04-14 | Procept, Incorporated | Aromatic compounds for inhibiting immune response |
| US5741798A (en) | 1996-06-03 | 1998-04-21 | Boehringer Ingelheim Pharmaceuticals, Inc. | 2-benzyl-4-sulfonyl-4H-isoquinolin-1,3-diones and their use as antiinflammatory agents |
| US5773469A (en) | 1996-06-18 | 1998-06-30 | Ortho Pharmaceutical Corporation | Diaryl antimicrobial agents |
| US6037373A (en) | 1996-07-05 | 2000-03-14 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Use of L-acetylcarnitine, L-isovalerylcarnitine, L-propionylcarnitine for increasing the levels of IGF-1 |
| US5677318A (en) | 1996-07-11 | 1997-10-14 | Merck Frosst Canada, Inc. | Diphenyl-1,2-3-thiadiazoles as anti-inflammatory agents |
| US5877184A (en) | 1996-08-06 | 1999-03-02 | Merck & Co., Inc. | Macrolides having immunosuppressive activity |
| US6030624A (en) | 1996-08-16 | 2000-02-29 | Uab Research Foundation | Mucosal immunogens for novel vaccines |
| US6290950B1 (en) | 1996-10-04 | 2001-09-18 | Igor Dimitrievich Poliakov | Mycosis vaccines |
| US5874594A (en) | 1996-10-16 | 1999-02-23 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US5763478A (en) | 1996-10-16 | 1998-06-09 | Merck & Co., Inc. | Triterpene derivatives with immunosuppressant activity |
| US6352698B1 (en) | 1996-10-22 | 2002-03-05 | Johnson & Johnson Consumer France, Sas, Roc Division | Use of complexes for the preparation of compositions for the treatment of sensitive skin, preparation process and hypoallergenic compositions |
| US6391303B1 (en) | 1996-11-18 | 2002-05-21 | Emisphere Technologies, Inc. | Methods and compositions for inducing oral tolerance in mammals |
| US5762919A (en) | 1997-01-10 | 1998-06-09 | Medlogic Global Corporation | Cyanoacrylate compostions comprising an antimicrobial agent |
| US5811091A (en) | 1997-01-10 | 1998-09-22 | Medlogic Global Corporation | Cyanoacrylate compostions comprising an antimicrobial agent |
| US5783177A (en) | 1997-01-10 | 1998-07-21 | Medlogic Global Corporation | Cyanoacrylate compositions comprising an antimicrobial agent |
| US5902594A (en) | 1997-01-10 | 1999-05-11 | Medlogic Global Corporation | Cyanoacrylate compositions comprising an antimicrobial agent |
| US5684042A (en) | 1997-01-10 | 1997-11-04 | Medlogic Global Corporation | Cyanoacrylate compositions comprising an antimicrobial agent |
| US6124495A (en) | 1997-03-11 | 2000-09-26 | Beacon Laboratories, Inc. | Unsaturated oxyalkylene esters and uses thereof |
| US5939455A (en) | 1997-03-11 | 1999-08-17 | Beacon Laboratories, Inc. | Therapeutic augmentation of oxyalkylene diesters and butyric acid derivatives |
| US5948407A (en) | 1997-03-19 | 1999-09-07 | Shire Laboratories Inc. | Oral induction of tolerance to parenterally administered non-autologous polypeptides |
| US5801193A (en) | 1997-04-15 | 1998-09-01 | Immune Modulation, Inc. | Compositions and methods for immunosuppressing |
| US6344476B1 (en) | 1997-05-23 | 2002-02-05 | Bayer Corporation | Inhibition of p38 kinase activity by aryl ureas |
| US5874476A (en) | 1997-07-14 | 1999-02-23 | Rohm And Haas Company | Dihaloformaldoxime carbamates as antimicrobial agents |
| US6169087B1 (en) | 1997-09-23 | 2001-01-02 | Novo Nordisk A/S | Modulators of protein tyrosine phosphatases (PTPases) |
| US6572860B1 (en) | 1997-09-30 | 2003-06-03 | Cel-Sci Corporation | Immunogenic conjugated polypeptide for treatment of herpes simplex virus |
| US6262044B1 (en) | 1998-03-12 | 2001-07-17 | Novo Nordisk A/S | Modulators of protein tyrosine phosphatases (PTPASES) |
| US6521232B1 (en) | 1998-03-31 | 2003-02-18 | Nisshin Flour Milling Co., Ltd. | Proteins having immunomodulatory activity and remedies for immunological diseases |
| US6329153B1 (en) | 1998-06-22 | 2001-12-11 | Vanderbilt University | Method for evaluating immunosuppressive regimens |
| WO2000024782A2 (en) | 1998-10-23 | 2000-05-04 | Amgen Inc. | Modified peptides, comprising an fc domain, as therapeutic agents |
| US6468537B1 (en) | 1999-04-28 | 2002-10-22 | The Board Of Trustees Of Northwestern University | Localization of major peptide autoepitopes for nucleosome specific T cells of systemic lupus erythematosus |
| US6525035B1 (en) | 1999-06-10 | 2003-02-25 | Sass & Sass, Inc. | Therapeutic composition and methods |
| US6410556B1 (en) | 1999-09-10 | 2002-06-25 | Novo Nordisk A/S | Modulators of protein tyrosine phosphateses (PTPases) |
| US6525242B1 (en) | 1999-11-02 | 2003-02-25 | The University Of Connecticut | Propagation of human hepatocytes in non-human mammals |
| US6403555B1 (en) | 1999-12-08 | 2002-06-11 | Xcyte Therapies, Inc. | Depsipeptide and congeners thereof for use as immunosuppressants |
| US6395767B2 (en) | 2000-03-10 | 2002-05-28 | Bristol-Myers Squibb Company | Cyclopropyl-fused pyrrolidine-based inhibitors of dipeptidyl peptidase IV and method |
| WO2005002515A2 (en) | 2003-06-20 | 2005-01-13 | Biomarin Pharmaceutical Inc. | Delivery of therapeutic compounds to the brain and other tissues |
Cited By (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9221867B2 (en) | 2003-01-06 | 2015-12-29 | Angiochem Inc. | Method for transporting a compound across the blood-brain barrier |
| US9713646B2 (en) | 2005-07-15 | 2017-07-25 | Angiochem Inc. | Potentiation of anticancer agents |
| WO2008116171A1 (en) * | 2007-03-21 | 2008-09-25 | Raptor Pharmaceutical Inc. | Cyclic receptor-associated protein (rap) peptides |
| US8440629B2 (en) | 2007-03-21 | 2013-05-14 | Raptor Pharmaceuticals Inc. | Cyclic receptor-associated protein (RAP) peptides |
| US9365634B2 (en) | 2007-05-29 | 2016-06-14 | Angiochem Inc. | Aprotinin-like polypeptides for delivering agents conjugated thereto to tissues |
| US8710013B2 (en) | 2008-04-18 | 2014-04-29 | Angiochem Inc. | Pharmaceutical compositions of paclitaxel, paclitaxel analogs or paclitaxel conjugates and related methods of preparation and use |
| JP2012503619A (ja) * | 2008-09-26 | 2012-02-09 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | Hcv感染に対する抗ウイルス治療のための標的としての宿主細胞キナーゼ |
| US8921314B2 (en) | 2008-10-15 | 2014-12-30 | Angiochem, Inc. | Conjugates of GLP-1 agonists and uses thereof |
| US8828925B2 (en) | 2008-10-15 | 2014-09-09 | Angiochem Inc. | Etoposide and doxorubicin conjugates for drug delivery |
| US9914754B2 (en) | 2008-12-05 | 2018-03-13 | Angiochem Inc. | Conjugates of neurotensin or neurotensin analogs and uses thereof |
| US8853353B2 (en) | 2008-12-17 | 2014-10-07 | Angiochem, Inc. | Membrane type-1 matrix metalloprotein inhibitors and uses thereof |
| JP2012521754A (ja) * | 2009-03-27 | 2012-09-20 | ジェイダブリュ ファーマシューティカル コーポレーション | インターフェロン−アルファ及び細胞質残留性細胞膜透過ペプチドを含むIFN−α融合タンパク質 |
| US9173891B2 (en) | 2009-04-20 | 2015-11-03 | Angiochem, Inc. | Treatment of ovarian cancer using an anticancer agent conjugated to an angiopep-2 analog |
| US9161988B2 (en) | 2009-07-02 | 2015-10-20 | Angiochem Inc. | Multimeric peptide conjugates and uses thereof |
| EP2528613A4 (en) * | 2010-01-28 | 2013-06-05 | Raptor Pharmaceuticals Inc | METHOD OF TREATING LIVING DRESS WITH PEPTIDE FUCOSIDASE HEMMER CONJUGATES FROM A RECEPTOR ASSOCIATED PROTEIN |
| JP2013518128A (ja) * | 2010-01-28 | 2013-05-20 | ラプトール ディスカバリーズ インコーポレイテッド | 受容体関連タンパク質(rap)ペプチド−フコシダーゼ阻害薬複合体による肝障害処置のための方法 |
| WO2011094536A1 (en) | 2010-01-28 | 2011-08-04 | Raptor Pharmaceuticalls Inc. | Method for treating liver disorders with receptor associated protein ( irp) peptide-fucosidase inhibitor conjugates |
| US8916162B2 (en) | 2010-02-20 | 2014-12-23 | Alexey Gennadievich Zdanovsky | Botulinum neurotoxin antigenic compositions and methods |
| US20120328642A1 (en) * | 2010-02-20 | 2012-12-27 | Alexey Gennadievich Zdanovsky | Botulinum neurotoxin antigenic compositions and methods |
| WO2011103465A3 (en) * | 2010-02-20 | 2012-02-23 | Alexey Gennadievich Zdanovsky | Botulinum neurotoxin antigenic compositions and methods |
| EP2919798A1 (en) * | 2012-11-14 | 2015-09-23 | Sagetis Biotech, SL | Polypeptides for blood brain barrier transport |
| US20150376237A1 (en) * | 2012-11-14 | 2015-12-31 | Sagetis Biotech, Sl | Polypeptides for blood brain barrier transport |
| US20140154285A1 (en) * | 2012-12-05 | 2014-06-05 | Thevax Genetics Vaccine Co., Ltd. | Fusion proteins for use as immunogenic enhancers for inducing antigen-specific t cell responses |
| US9481714B2 (en) * | 2012-12-05 | 2016-11-01 | Thevax Genetics Vaccine Co., Ltd. | Fusion proteins for use as immunogenic enhancers for inducing antigen-specific T cell responses |
| US10442868B2 (en) * | 2013-03-14 | 2019-10-15 | Rhode Island Hospital, A Lifespan-Partner | Treating hepatitis B virus infections by administering receptor associated protein (RAP) |
| US20160024223A1 (en) * | 2013-03-14 | 2016-01-28 | Rhode Island Hospital, A Lifespan-Partner | Treating Hepatitus B Virus Infections |
| ITMI20130513A1 (it) * | 2013-04-05 | 2014-10-06 | Euroclone S P A | Metodo diagnostico per patologie autoimmuni del fegato |
| US9775898B2 (en) * | 2015-02-26 | 2017-10-03 | Thevax Genetics Vaccine Co., Ltd. | Vaccine composition comprising an immunogenic protein and combination adjuvants for use in eliciting antigen-specific T-cell responses |
| US20160250324A1 (en) * | 2015-02-26 | 2016-09-01 | Thevax Genetics Vaccine Co., Ltd. | Vaccine composition comprising an immunogenic protein and combination adjuvants for use in eliciting antigen-specific t-cell responses |
| US10849992B1 (en) | 2015-04-07 | 2020-12-01 | Alector Llc | Methods of screening for sortilin binding antagonists |
| US10428150B2 (en) | 2015-04-07 | 2019-10-01 | Alector Llc | Anti-sortilin antibodies and methods of use thereof |
| US10308718B2 (en) | 2015-04-07 | 2019-06-04 | Alector Llc | Anti-sortilin antibodies and methods of use thereof |
| US11186645B2 (en) | 2015-04-07 | 2021-11-30 | Alector Llc | Isolated nucleic acids encoding anti-sortilin antibodies |
| US11208488B2 (en) | 2015-04-07 | 2021-12-28 | Alector Llc | Methods of increasing progranulin levels using anti-Sortilin antibodies |
| US11339223B2 (en) | 2015-04-07 | 2022-05-24 | Alector Llc | Methods of use of anti-Sortilin antibodies for treating a disease, disorder, or injury |
| US12186409B2 (en) | 2015-04-07 | 2025-01-07 | Alector Llc | Methods of screening for sortilin binding antagonists |
| US10980892B2 (en) | 2015-06-15 | 2021-04-20 | Angiochem Inc. | Methods for the treatment of leptomeningeal carcinomatosis |
| US11396546B2 (en) | 2018-07-13 | 2022-07-26 | Alector Llc | Anti-Sortilin antibodies and methods of use thereof |
| US12297277B2 (en) | 2018-07-13 | 2025-05-13 | Alector Llc | Anti-sortilin antibodies and methods of use thereof |
| US12358991B2 (en) | 2018-07-13 | 2025-07-15 | Alector Llc | Anti-Sortilin antibodies and methods of use thereof |
| EP4362965A4 (en) * | 2021-07-02 | 2025-08-06 | Univ Westlake | USE OF AN LRP1 INHIBITOR IN THE TREATMENT OF A NOTCH SIGNALING-DEPENDENT DISEASE |
Also Published As
| Publication number | Publication date |
|---|---|
| US20120251444A1 (en) | 2012-10-04 |
| JP2010503710A (ja) | 2010-02-04 |
| EP2063905B1 (en) | 2014-07-30 |
| WO2008036682A3 (en) | 2009-04-09 |
| CA2663377A1 (en) | 2008-03-27 |
| EP2063905A2 (en) | 2009-06-03 |
| CN101594878A (zh) | 2009-12-02 |
| KR20090071598A (ko) | 2009-07-01 |
| EP2063905A4 (en) | 2010-05-19 |
| US8795627B2 (en) | 2014-08-05 |
| HK1132930A1 (en) | 2010-03-12 |
| MX2009002893A (es) | 2009-07-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2063905B1 (en) | Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates | |
| JP2010503710A5 (cg-RX-API-DMAC7.html) | ||
| CA2450073C (en) | Compositions and methods for modulating blood-brain barrier transport | |
| EP2132224B1 (en) | Cyclic receptor-associated protein (rap) peptides | |
| AU2002322720A1 (en) | Compositions and methods for modulating blood-brain barrier transport | |
| EP2528613B1 (en) | Receptor associated protein peptide-fucosidase inhibitor conjugates and their use in the treatment of liver tumours | |
| HK1132930B (en) | Treatment of liver disorders by administration of receptor-associated protein (rap)-conjugates | |
| HK1140686B (en) | Compositions for blood-brain barrier transport | |
| HK1139162B (en) | Cyclic receptor-associated protein (rap) peptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200780042719.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 07842713 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2663377 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2009528530 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2009/002893 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007842713 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020097007889 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12441618 Country of ref document: US |