WO2007136893A2 - Anti-fgf19 antibodies and methods using same - Google Patents

Anti-fgf19 antibodies and methods using same Download PDF

Info

Publication number
WO2007136893A2
WO2007136893A2 PCT/US2007/061936 US2007061936W WO2007136893A2 WO 2007136893 A2 WO2007136893 A2 WO 2007136893A2 US 2007061936 W US2007061936 W US 2007061936W WO 2007136893 A2 WO2007136893 A2 WO 2007136893A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cancer
fgf19
seq
expression
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2007/061936
Other languages
English (en)
French (fr)
Other versions
WO2007136893A3 (en
Inventor
Luc Desnoyers
Dorothy French
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Original Assignee
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genentech Inc filed Critical Genentech Inc
Priority to EP07797128.1A priority Critical patent/EP1989230B1/en
Priority to CA002637988A priority patent/CA2637988A1/en
Priority to ES07797128.1T priority patent/ES2582652T3/es
Priority to NZ569957A priority patent/NZ569957A/en
Priority to AU2007254005A priority patent/AU2007254005B2/en
Priority to JP2008554523A priority patent/JP5209505B2/ja
Priority to HK09100473.7A priority patent/HK1120273B/en
Publication of WO2007136893A2 publication Critical patent/WO2007136893A2/en
Publication of WO2007136893A3 publication Critical patent/WO2007136893A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/81Packaged device or kit

Definitions

  • the fibroblast growth factor (FGF) family is composed of 22 structurally related polypeptides that bind to 4 receptor tyrosine kinases (FGFRl -4) and one kinase deficient receptor (FGFR5) (Eswarakumar et al (2005) Cytokine Growth Factor Rev 16, 139-149; Ornitz et al (2001) Genome Biol 2, REVIEWS3005; Sleeman et al (2001) Gene 271, 171-182).
  • FGFs and FGFRs are associated with the pathogenesis of breast, prostate, cervix, stomach and colon cancers (Jeffers et al (2002) Expert Opin Ther Targets 6, 469-482; Mattila et al. (2001) Oncogene 20, 2791- 2804; Ruohola et al. (2001) Cancer Res 61, 4229-4237; Marsh et al (1999) Oncogene 18, 1053-1060; Shimokawa et al (2003) Cancer Res 63, 6116-6120; Jang (2001) Cancer Res 61, 3541-3543; Cappeln (1999) Nat Genet 23, 18- 20; Gowardhan (2005) Br J Cancer 92, 320-327).
  • FGF19 plays a role in cholesterol homeostasis by repressing hepatic expression of cholesterol-7- ⁇ - hydroxylase 1 (Cyp7 ⁇ l), the rate-limiting enzyme for cholesterol and bile acid synthesis (Gutierrez et al (2006) Arterioscler Thromb Vase Biol 26, 301-306; Yu et al (2000) J Biol Chem 275, 15482-15489; Holt, JA, et al. (2003) Genes Dev 17(130):158).
  • FGF19 ectopic expression in a transgenic mouse model increases hepatocytes proliferation, promotes hepatocellular dysplasia and results in neoplasia by 10 months of age (Nicholes et al. (2002).
  • FGFR4 mutation and truncation were correlated with the malignancy and in some cases the prognosis of prostate and lung adenocarcinomas, head and neck squamous cell carcinoma, soft tissue sarcoma, astrocytoma and pituitary adenomas (Jaakkola et al (1993) Int J Cancer 54, 378-382; Morimoto (2003) Cancer 98, 2245-2250; Qian (2004) J Clin Endocrinol Metab 89, 1904-1911; Spinola et al. (2005) J Clin Oncol 23, 7307-7311; Streit et al (2004) Int J Cancer 111, 213-217; Wang (1994) MoI Cell Biol 14, 181-188; Yamada (2002) Neurol Res 24, 244-248).
  • the invention provides an isolated anti-FGF19 antibody, wherein a full length IgG form of the antibody specifically binds human FGF 19 with a k on of 6 X 10 5 (M -1 S "1 ) or better and/or with a K off of 5 X lO ' ⁇ s "1 ) or better.
  • the invention provides an isolated antibody that binds an FGFR4 binding region of FGF19.
  • the invention provides an anti-FGF19 antibody comprising: at least one, two, three, four, five, and/or six hypervariable region (HVR) sequences selected from the group consisting of: (a) HVR-Ll comprising sequence KASQDINSFLS (SEQ ID NO: 1); (b) HVR-L2 comprising sequence YRANRLVD (SEQ ID NO:2); (c) HVR-L3 comprising sequence LQYDEFPLT (SEQ ID NO:3); (d) HVR-Hl comprising sequence TYGVH (SEQ ID NO:5); (e) HVR-H2 comprising sequence VIWPGGGTDYNAAFIS (SEQ ID NO:6); and (f) HVR-H3 comprising sequence KEY ANLYAMDY (SEQ ID NO:7).
  • HVR-Ll comprising sequence KASQDINSFLS (SEQ ID NO: 1);
  • HVR-L2 comprising sequence YRANRLVD (SEQ ID NO:2);
  • DIKMTQSPSSMYASLGERVTIPCKASQDINSFLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSL TISSLEYEDMGIYYCLQYDEFPLTFGAGTKVEIKR (SEQ ID NO:4); and comprises a heavy chain variable domain having the sequence: QVQLKQSGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWPGGGTDYNAAFISRLSITKD NSKSQVFFKMNSLLANDTAIYFCVRKEYANLYAMDYWGQGTLLTVSA (SEQ ID NO:8).
  • the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody. In some embodiments, the antibody is selected from the group consisting of a chimeric antibody, an affinity matured antibody, a humanized antibody, and a human antibody. In some embodiments, the antibody is an antibody fragment. In some embodiments, the antibody is a Fab, Fab', Fab'-SH, F(ab') 2 , or scFv. In one embodiment, the antibody is a chimeric antibody, for example, an antibody comprising antigen binding sequences from a non-human donor grafted to a heterologous non-human, human or humanized sequence (e.g., framework and/or constant domain sequences).
  • a chimeric antibody for example, an antibody comprising antigen binding sequences from a non-human donor grafted to a heterologous non-human, human or humanized sequence (e.g., framework and/or constant domain sequences).
  • Humanized antibodies of the invention include those that have amino acid substitutions in the FR and affinity maturation variants with changes in the grafted CDRs.
  • the substituted amino acids in the CDR or FR are not limited to those present in the donor or recipient antibody.
  • the antibodies of the invention further comprise changes in amino acid residues in the Fc region that lead to improved effector function including enhanced CDC and/or ADCC function and B-cell killing.
  • Other antibodies of the invention include those having specific changes that improve stability.
  • the antibodies of the invention comprise changes in amino acid residues in the Fc region that lead to decreased effector function, e.g. decreased CDC and/or ADCC function and/or decreased B-cell killing.
  • the invention provides an isolated anti-FGF19 antibody that inhibits, reduces, and/or blocks FGF19-induced repression of expression of a CYP7 ⁇ l gene in a cell exposed to FGF19.
  • the invention provides an isolated anti-FGF19 antibody that inhibits, reduces, and/or blocks FGF19-induced phosphorylation of FGFR4, MAPK, FRS2 and/or ERK2 in a cell exposed to FGF19.
  • This second medicament is more than one medicament, and is preferably another antibody, chemotherapeutic agent, cytotoxic agent, anti-angiogenic agent, immunosuppressive agent, prodrug, cytokine, cytokine antagonist, cytotoxic radiotherapy, corticosteroid, anti-emetic, cancer vaccine, analgesic, anti-vascular agent, or growth-inhibitory agent.
  • the second medicament is an anti-estrogen drug such as tamoxifen, fulvestrant, or an aromatase inhibitor, an antagonist to vascular endothelial growth factor (VEGF) or to ErbB or the Efb receptor, or Her-1 or Her-2.
  • VEGF vascular endothelial growth factor
  • the second medicament is tamoxifen, letrozole, exemestane, anastrozole, irinotecan, cetuximab, fulvestrant, vinorelbine, erlotinib, bevacizumab, vincristine, imatinib, sorafenib, lapatinib, or trastuzumab, and preferably, the second medicament is erlotinib, bevacizumab, or trastuzumab.
  • the invention provides an anti-idiotype antibody that specifically binds an anti-FGF19 antibody of the invention. In one aspect, the invention provides nucleic acids encoding an anti-FGF19 antibody of the invention.
  • the invention provides use of an expression vector of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a cancer, a tumor, and/or a cell proliferative disorder.
  • a disorder such as a cancer, a tumor, and/or a cell proliferative disorder.
  • the cancer, a tumor, and/or a cell proliferative disorder is colorectal cancer, hepatocellular carcinoma, lung cancer, breast cancer, or pancreatic cancer.
  • the disorder is a liver disorder, such as cirrhosis.
  • the disorder is a wasting disorder.
  • the invention provides use of a host cell of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a cancer, a tumor, and/or a cell proliferative disorder.
  • a disorder such as a cancer, a tumor, and/or a cell proliferative disorder.
  • the cancer, a tumor, and/or a cell proliferative disorder is colorectal cancer, hepatocellular carcinoma, lung cancer, breast cancer, or pancreatic cancer.
  • the disorder is a liver disorder, such as cirrhosis.
  • the disorder is a wasting disorder.
  • a cell that is targeted in a method of the invention is a hyperproliferative and/or hyperplastic cell.
  • a cell that is targeted in a method of the invention is a dysplastic cell.
  • a cell that is targeted in a method of the invention is a metastatic cell.
  • the cell that is targeted is a cirrhotic liver cell.
  • the invention provides a complex of any of the anti-FGF19 antibodies described herein and FGF19.
  • the complex is in vivo or in vitro.
  • the anti-FGF19 antibody is detectably labeled.
  • Some embodiments involving detection further comprise detection of Wnt pathway activation.
  • detection of Wnt pathway activation comprises one or more of tyrosine phosphorylation of ⁇ -catenin, expression of Wnt target genes, ⁇ -catenin mutation, and E-cadherin binding to ⁇ -catenin. Detection of Wnt pathway activation is known in the art, and some examples are described and exemplified herein.
  • FGF 19 and/or FGFR4 expression may be detected. FGF 19 and/or FGFR4 expression may be increased. It is understood that absence of FGF 19 and/or FGFR4 expression includes insignificant, or de minimus levels.
  • FGF 19 expression in the test biological sample is higher than that observed for a control biological sample (or control or reference level of expression). In some embodiments, FGF19 expression is at least about 2-fold, 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 75-fold, 100-fold, 150-fold higher, or higher in the test biological sample than in the control biological sample.
  • FIGURE 14 Treatment with FGFR4 -directed shRNA suppressed expression of FGFR4 protein and active- ⁇ -catenin in HCTl 16 cells.
  • FGFR4 knockdown vectors were constructed by designing and cloning shRNA sequences into an retroviral inducible expression vector system. The cDNAs were transfected and stable cell lines expressing siRNA were generated in HCTl 16 cells using puromycin selection. Stable cell lines comprising control shRNA and FGFR4-directed shRNA were treated with or without doxycycline (Dox) and FGFR4 protein and active- ⁇ -catenin levels were determined by immunoprecipitation and immunoblotting. Representative blots from three separate experiments are shown.
  • Dox doxycycline
  • the anti-FGF19 antibodies of the invention find utility as reagents for detection and/or isolation of FGF 19, such as detention of FGF 19 in various tissues and cell type.
  • Antigen is diluted with 1OmM sodium acetate, pH 4.8, into 5ug/ml ( ⁇ 0.2uM) before injection at a flow rate of 5ul/minute to achieve approximately 10 response units (RU) of coupled protein.
  • IM ethanolamine is injected to block unreacted groups.
  • two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25ul/min.
  • any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
  • the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
  • Other hydroxyls may also be derivatized to standard protecting groups.
  • each R or R is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical.
  • RNA and DNA refers to all polynucleotides referred to herein, including RNA and DNA.
  • Oligonucleotide generally refers to short, generally single stranded, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length.
  • oligonucleotide and “polynucleotide” are not mutually exclusive. The description above for polynucleotides is equally and fully applicable to oligonucleotides.
  • FGF 19 refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) FGF 19 polypeptide.
  • native sequence specifically encompasses naturally occurring truncated or secreted forms (e.g., an extracellular domain sequence), naturally occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants.
  • wild type FGF 19 generally refers to a polypeptide comprising the amino acid sequence of a naturally occurring FGF 19 protein.
  • wild type FGF 19 sequence generally refers to an amino acid sequence found in a naturally occurring FGF19.
  • Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site.
  • this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association.
  • one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
  • the six CDRs confer antigen-binding specificity to the antibody.
  • hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions; three in the VH (Hl, H2, H3), and three in the VL (Ll, L2, L3).
  • a number of hypervariable region delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
  • NK cells Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins.
  • the antibodies "arm" the cytotoxic cells and are absolutely required for such killing.
  • the primary cells for mediating ADCC, NK cells express Fc ⁇ RJII only, whereas monocytes express Fc ⁇ RI, Fc ⁇ RJI and Fc ⁇ RJII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991).
  • ADCC activity of a molecule of interest may be assessed in vitro, such as that described in US Patent No. 5,500,362 or 5,821,337 or Presta U.S. Patent No. 6,737,056.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al PNAS (USA) 95:652-656 (1998).
  • cancers include squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, gastric cancer, melanoma, and various types of head and neck cancer.
  • treatment refers to clinical intervention in an attempt to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • antibodies of the invention are used to delay development of a disease or disorder.
  • mammals include, but are not limited to, farm animals (such as cows), sport animals, pets (such as cats, dogs and horses), primates, mice and rats.
  • calicheamicin especially calicheamicin gamma II and calicheamicin omegall (see, e.g., Agnew, Chem lntl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophore s), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L- norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin
  • chemo therapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), DIDROCAL® etidronate, NE-58095, ZOMETA® zoledronic acid/zoledronate, FOSAMAX® alendronate, AREDIA® pamidronate, SKELID® tiludronate, or ACTONEL® risedronate; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; LURTOTECAN®
  • Doxorubicin is an anthracycline antibiotic.
  • the full chemical name of doxorubicin is (8S-cis)-10-[(3- amino-2,3,6-trideoxy- ⁇ -L-lyxo-hexapyranosyl)oxy]-7,8,9,10-tetrahydro-6,8,l l-trihydroxy-8-(hydroxyacetyl)-l- methoxy-5,12-naphthacenedione.
  • compositions including pharmaceutical compositions, comprising an anti- FGF 19 antibody; and polynucleotides comprising sequences encoding an anti-FGF19 antibody.
  • compositions comprise one or more antibodies that bind to FGF 19, and/or one or more polynucleotides comprising sequences encoding one or more antibodies that bind to FGF19.
  • suitable carriers such as pharmaceutically acceptable excipients including buffers, which are well known in the art.
  • the anti-FGF19 antibodies of the invention can be made by using combinatorial libraries to screen for synthetic antibody clones with the desired activity or activities.
  • synthetic antibody clones are selected by screening phage libraries containing phage that display various fragments of antibody variable region (Fv) fused to phage coat protein. Such phage libraries are panned by affinity chromatography against the desired antigen. Clones expressing Fv fragments capable of binding to the desired antigen are adsorbed to the antigen and thus separated from the non-binding clones in the library. The binding clones are then eluted from the antigen, and can be further enriched by additional cycles of antigen adsorption/elution.
  • Fv antibody variable region
  • Additional enrichment for anti-FGF19 reactive cell populations can be obtained by using a suitable screening procedure to isolate B cells expressing FGF19-specific membrane bound antibody, e.g., by cell separation with FGF 19 affinity chromatography or adsorption of cells to fluorochrome-labeled FGF 19 followed by flow- activated cell sorting (FACS).
  • FACS flow- activated cell sorting
  • the use of spleen cells and/or B cells or other PBLs from an unimmunized donor provides a better representation of the possible antibody repertoire, and also permits the construction of an antibody library using any animal (human or non-human) species in which FGF19 is not antigenic.
  • stem cells are harvested from the subject to provide nucleic acids encoding unrearranged antibody gene segments.
  • the immune cells of interest can be obtained from a variety of animal species, such as human, mouse, rat, lagomorpha, luprine, canine, feline, porcine, bovine, equine, and avian species, etc.
  • WO 9607754 (published 14 March 1996) described a method for inducing mutagenesis in a complementarity determining region of an immunoglobulin light chain to create a library of light chain genes. Another effective approach is to recombine the VH or VL domains selected by phage display with repertoires of naturally occurring V domain variants obtained from unimmunized donors and screen for higher affinity in several rounds of chain reshuffling as described in Marks et al, Biotechnol, 10: 779-783 (1992). This technique allows the production of antibodies and antibody fragments with affinities in the 10 "9 M range.
  • Host cells are transfected and preferably transformed with the above -described expression or cloning vectors of this invention and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • Prokaryotic host cells used to produce FGF 19 can be cultured as described generally in Sambrook et al, supra.
  • the mammalian host cells used to produce FGF 19 can be cultured in a variety of media, which is well known in the art and some of which is described herein.
  • the efficiency of selection depends on many factors, including the kinetics of dissociation during washing, and whether multiple antibody fragments on a single phage can simultaneously engage with antigen.
  • Antibodies with fast dissociation kinetics (and weak binding affinities) can be retained by use of short washes, multivalent phage display and high coating density of antigen in solid phase. The high density not only stabilizes the phage through multivalent interactions, but favors rebinding of phage that has dissociated.
  • the present invention encompasses antibody fragments.
  • antibody fragments In certain circumstances there are advantages of using antibody fragments, rather than whole antibodies.
  • the smaller size of the fragments allows for rapid clearance, and may lead to improved access to solid tumors.
  • Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. Fab, Fv and ScFv antibody fragments can all be expressed in and secreted from E.
  • Antibody fragments can be isolated from the antibody phage libraries discussed above.
  • Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (Carter et al., Bio/Technology 10: 163-167 (1992)).
  • F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
  • Fab and F(ab') 2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • variable domains both light and heavy
  • sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable -domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework for the humanized antibody (Sims et al. (1993) J. Immunol. 151:2296; Chothia et al. (1987) J. MoI. Biol. 196:901.
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • Gene shuffling can also be used to derive human antibodies from non-human, e.g. rodent, antibodies, where the human antibody has similar affinities and specificities to the starting non-human antibody.
  • this method which is also called "epitope imprinting" either the heavy or light chain variable region of a non-human antibody fragment obtained by phage display techniques as described above is replaced with a repertoire of human V domain genes, creating a population of non-human chain/human chain scFv or Fab chimeras.
  • antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHl), containing the site necessary for light chain binding, present in at least one of the fusions.
  • DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co -trans fected into a suitable host organism.
  • Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
  • one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
  • Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (US Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/00373, and EP 03089).
  • Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in US Patent No. 4,676,980, along with a number of cross-linking techniques.
  • bispecific antibodies can be prepared using chemical linkage.
  • Brennan et al, Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
  • the Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
  • a useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science,
  • the carbohydrate attached thereto may be altered.
  • antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L.). See also US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
  • Antibodies with a bisecting N-acetylglucosamine (GIcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al. and US Patent No. 6,602,684, Umana et al.
  • the antibodies of the invention bind FGF 19, and in some embodiments, may modulate one or more aspects of FGF19-associated effects, including but not limited to FGFR4 activation, FGFR4 downstream molecular signaling, disruption of FGFR4 binding to FGF 19, FGFR4 multimerization, expression of a CYP7 ⁇ l gene, phosphorylation of FGFR4, MAPK, FRS2 and/or ERK2, activation of ⁇ -catenin, FGF19-promoted cell migration, and/or disruption of any biologically relevant FGF 19 and/or FGFR4 biological pathway, and/or treatment and/or prevention of a tumor, cell proliferative disorder or a cancer; and/or treatment or prevention of a disorder associated with FGF19 expression and/or activity (such as increased FGF19 expression and/or activity).
  • FGF19-associated effects including but not limited to FGFR4 activation, FGFR4 downstream molecular signaling, disruption of FGFR4 binding to FGF 19, FGFR4 multi
  • the purified antibodies can be further characterized by a series of assays including, but not limited to, N- terminal sequencing, amino acid analysis, non-denaturing size exclusion high pressure liquid chromatography (HPLC), mass spectrometry, ion exchange chromatography and papain digestion.
  • assays including, but not limited to, N- terminal sequencing, amino acid analysis, non-denaturing size exclusion high pressure liquid chromatography (HPLC), mass spectrometry, ion exchange chromatography and papain digestion.
  • DIKMTQSPSSMYASLGERVTIPCKASQDINSFLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSL TISSLEYEDMGIYYCLQYDEFPLTFGAGTKVEIKR (SEQ ID NO:4) and a heavy chain variable domain having the sequence: QVQLKQSGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWPGGGTDYNAAFISRLSITKD NSKSQVFFKMNSLLANDTAIYFCVRKEYANLYAMDYWGQGTLLTVSA (SEQ ID NO:8) for binding to FGF19.
  • any necessary supplements besides carbon, nitrogen, and inorganic phosphate sources may also be included at appropriate concentrations introduced alone or as a mixture with another supplement or medium such as a complex nitrogen source.
  • the culture medium may contain one or more reducing agents selected from the group consisting of glutathione, cysteine, cystamine, thiogly collate, dithioerythritol and dithiothreitol.
  • an inducible promoter is used in the expression vector of the invention, protein expression is induced under conditions suitable for the activation of the promoter.
  • PhoA promoters are used for controlling transcription of the polypeptides.
  • the transformed host cells are cultured in a phosphate- limiting medium for induction.
  • the phosphate-limiting medium is the C.R.A.P medium (see, e.g., Simmons et al, J. Immunol. Methods (2002), 263: 133-147).
  • a variety of other inducers may be used, according to the vector construct employed, as is known in the art.
  • the expressed polypeptides of the present invention are secreted into and recovered from the periplasm of the host cells.
  • Protein recovery typically involves disrupting the microorganism, generally by such means as osmotic shock, sonication or lysis. Once cells are disrupted, cell debris or whole cells may be removed by centrifugation or filtration. The proteins may be further purified, for example, by affinity resin chromatography. Alternatively, proteins can be transported into the culture media and isolated therein. Cells may be removed from the culture and the culture supernatant being filtered and concentrated for further purification of the proteins produced. The expressed polypeptides can be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assay.
  • PAGE polyacrylamide gel electrophoresis
  • various fermentation conditions can be modified.
  • additional vectors overexpressing chaperone proteins such as Dsb proteins (DsbA, DsbB, DsbC, DsbD and or DsbG) or FkpA (a peptidylprolyl cis,trans-isomerase with chaperone activity) can be used to co-transform the host prokaryotic cells.
  • the chaperone proteins have been demonstrated to facilitate the proper folding and solubility of heterologous proteins produced in bacterial host cells. Chen et al.
  • E. coli strains deficient for proteolytic enzymes and transformed with plasmids overexpressing one or more chaperone proteins are used as host cells in the expression system of the invention.
  • Hi. Antibody Purification Standard protein purification methods known in the art can be employed. The following procedures are exemplary of suitable purification procedures: fractionation on immunoaffinity or ion-exchange columns, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation-exchange resin such as DEAE, chromato focusing, SDS-PAGE, ammonium sulfate precipitation, and gel filtration using, for example, Sephadex G-
  • a vector for use in a eukaryotic host cell may also contain a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide of interest.
  • the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
  • mammalian signal sequences as well as viral secretory leaders, for example, the herpes simplex gD signal are available.
  • Selection genes may contain a selection gene, also termed a selectable marker.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, where relevant, or (c) supply critical nutrients not available from complex media.
  • antibiotics or other toxins e.g., ampicillin, neomycin, methotrexate, or tetracycline
  • b complement auxotrophic deficiencies, where relevant, or (c) supply critical nutrients not available from complex media.
  • One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.
  • Suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the antibody nucleic acid, such as DHFR, thymidine kinase, metallothionein-I and -II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, etc.
  • Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the antibody polypeptide nucleic acid.
  • Promoter sequences are known for eukaryotes.
  • Virtually alleukaryotic genes have an AT -rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated.
  • Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide.
  • N may be any nucleotide.
  • AATAAA sequence At the 3' end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
  • the enhancer may be spliced into the vector at a position 5' or 3' to the antibody polypeptide - encoding sequence, but is preferably located at a site 5' from the promoter.
  • Expression vectors used in eukaryotic host cells will typically also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding an antibody.
  • One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94/11026 and the expression vector disclosed therein.
  • Chinese hamster ovary cellsADHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)) ; mouse Sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980) ); monkey kidney cells (CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51);
  • TRI cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
  • the host cells used to produce an antibody of this invention may be cultured in a variety of media.
  • Commercially available media such as Ham's FlO (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI- 1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells.
  • Cantuzumab mertansine an antibody drug conjugate composed of the huC242 antibody linked via the disulfide linker SPP to the maytansinoid drug moiety, DMl, is advancing into Phase II trials for the treatment of cancers that express CanAg, such as colon, pancreatic, gastric, and others.
  • a ricin immunotoxin can be prepared as described in Vitetta et al., Science, 238: 1098 (1987).
  • Carbon- 14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody.
  • MX-DTPA 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
  • Conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, maytansinoids, dolastatins, aurostatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity are also contemplated herein. i. Maytansine and maytansinoids
  • Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
  • the immunoconjugate comprises an antibody of the invention conjugated to dolastatins or dolostatin peptidic analogs and derivatives, the auristatins (US Patent Nos. 5635483; 5780588).
  • Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (US 5663149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965).
  • Structural analogues of calicheamicin which may be used include, but are not limited to, ⁇ /, (X 2 1 , (X 3 1 , N-acetyl- ⁇ /, PSAG and ⁇ (Hinman et al., Cancer Research 53:3336-3342 (1993), Lode et al., Cancer
  • two or more angiogenesis inhibitors may optionally be co-administered to the patient in addition to VEGF antagonist and other agent.
  • one or more additional therapeutic agents e.g., anticancer agents, can be administered in combination with anti-FGF19 antibody, the VEGF antagonist, and an anti- angiogenesis agent.
  • the cancer is lung cancer, such as small-cell lung cancer
  • the second medicament is a VEGF inhibitor such as bevacizumab, or an EGFR inhibitor such as, e.g., erlotinib or a c-Kit inhibitor such as e.g., imatinib.
  • the cancer is liver cancer, such as hepatocellular carcinoma
  • the second medicament is an EGFR inhibitor such as erlotinib, a chemotherapeutic agent such as doxorubicin or irinotecan, a taxane such as paclitaxel, thalidomide and/or interferon.
  • a preferred chemotherapeutic agent for front-line therapy of cancer is taxotere, alone in combination with other second medicaments. Most preferably, if chemotherapy is administered, it is given first, followed by the antibodies herein.
  • WO98/45332 WO 96/30046; WO94/10202; EP 0666868B1; US Patent Applications 20030206899, 20030190317, 20030203409, and 20050112126; Popkov et al, Journal of Immunological Methods 288: 149-164 (2004); and, WO2005012359.
  • Additional agents can be administered in combination with VEGF antagonist and an anti-FGF19 antibody for blocking or reducing relapse tumor growth or relapse cancer cell growth.
  • the antibodies of the invention (and adjunct therapeutic agent) is/are administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • the antibodies are suitably administered by pulse infusion, particularly with declining doses of the antibody. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
  • An initial higher loading dose, followed by one or more lower doses may be administered.
  • An exemplary dosing regimen comprises administering an initial loading dose of about 4 mg/kg, followed by a weekly maintenance dose of about 2 mg/kg of the antibody.
  • other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
  • the sample is first fixed and is then dehydrated through an ascending series of alcohols, infiltrated and embedded with paraffin or other sectioning media so that the tissue sample may be sectioned.
  • one may section the tissue and fix the sections obtained.
  • the tissue sample may be embedded and processed in paraffin by conventional methodology
  • the paraffin embedded sections may be attached to positively charged slides and/or slides coated with poly-L-lysine. If paraffin has been used as the embedding material, the tissue sections are generally deparaffinized and rehydrated to water.
  • the tissue sections may be deparaffinized by several conventional standard methodologies. For example, xylenes and a gradually descending series of alcohols may be used (See e.g., "Manual of Histological Staining Method of the Armed Forces Institute of Pathology", supra).
  • commercially available deparaffinizing non-organic agents such as Hemo-De7 (CMS, Houston, Texas) may be used.
  • Analytical methods for FGF 19 all use one or more of the following reagents: labeled FGF 19 analogue, immobilized FGF19 analogue, labeled anti-FGF19 antibody, immobilized anti-FGF19 antibody and steric conjugates.
  • the labeled reagents also are known as "tracers.”
  • the label used is any detectable functionality that does not interfere with the binding of FGF 19 and anti- FGF19 antibody.
  • Numerous labels are known for use in immunoassay, examples including moieties that may be detected directly, such as fluorochrome, chemiluminescent, and radioactive labels, as well as moieties, such as enzymes, that must be reacted or derivatized to be detected.
  • the label used is any detectable functionality that does not interfere with the binding of FGF 19 and anti- FGF 19 antibody.
  • Numerous labels are known for use in immunoassay, examples including moieties that may be detected directly, such as fluorochrome, chemiluminescent, and radioactive labels, as well as moieties, such as enzymes, that must be reacted or derivatized to be detected.
  • radioisotopes 32 P, 14 C, 125 1, 3 H, and 131 I examples include the radioisotopes 32 P, 14 C, 125 1, 3 H, and 131 I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No.
  • Preferred labels herein are enzymes such as horseradish peroxidase and alkaline phosphatase.
  • the conjugation of such label, including the enzymes, to the antibody is a standard manipulative procedure for one of ordinary skill in immunoassay techniques. See, for example, O'Sullivan et al, "Methods for the Preparation of Enzyme-antibody Conjugates for Use in Enzyme Immunoassay," in Methods in Enzymology, ed. JJ. Langone and H. Van Vunakis, Vol. 73 (Academic Press, New York, New York, 1981), pp. 147-166. Immobilization of reagents is required for certain assay methods. Immobilization entails separating the anti-
  • IHC may be performed in combination with additional techniques such as morphological staining and/or fluorescence in-situ hybridization.
  • Two general methods of IHC are available; direct and indirect assays.
  • binding of antibody to the target antigen e.g., FGF19
  • This direct assay uses a labeled reagent, such as a fluorescent tag or an enzyme-labeled primary antibody, which can be visualized without further antibody interaction.
  • a labeled primary antibody binds to the antigen and then a labeled secondary antibody binds to the primary antibody.
  • a chromogenic or fluorogenic substrate is added to provide visualization of the antigen. Signal amplification occurs because several secondary antibodies may react with different epitopes on the primary antibody.
  • the primary and/or secondary antibody used for immunohisto chemistry typically will be labeled with a detectable moiety.
  • Numerous labels are available which can be generally grouped into the following categories: Aside from the sample preparation procedures discussed above, further treatment of the tissue section prior to, during or following IHC may be desired, For example, epitope retrieval methods, such as heating the tissue sample in citrate buffer may be carried out (see, e.g., Leong et al. Appl. Immunohistochem. 4(3):201 (1996)).
  • test sample FGF19 is inversely proportional to the amount of bound tracer as measured by the amount of marker substance.
  • Dose-response curves with known amounts of FGF 19 are prepared and compared with the test results to quantitatively determine the amount of FGF19 present in the test sample. These assays are called ELISA systems when enzymes are used as the detectable markers.
  • a conjugate of an enzyme with the FGF19 is prepared and used such that when anti-FGF19 antibody binds to the FGF 19 the presence of the anti-FGF19 antibody modifies the enzyme activity.
  • the FGF 19 or its immunologically active fragments are conjugated with a bifunctional organic bridge to an enzyme such as peroxidase. Conjugates are selected for use with anti-FGF19 antibody so that binding of the anti-FGF19 antibody inhibits or potentiates the enzyme activity of the label. This method per se is widely practiced under the name of EMIT.
  • Steric conjugates are used in steric hindrance methods for homogeneous assay. These conjugates are synthesized by covalently linking a low-molecular-weight hapten to a small FGF 19 fragment so that antibody to hapten is substantially unable to bind the conjugate at the same time as anti-FGF19 antibody. Under this assay procedure the FGF 19 present in the test sample will bind anti-FGF19 antibody, thereby allowing anti -hapten to bind the conjugate, resulting in a change in the character of the conjugate hapten, e.g., a change in fluorescence when the hapten is a fluorophore.
  • the invention provides methods to detect (e.g., presence or absence of or amount) a polynucleotide(s) (e.g., FGF19 polynucleotides) in a biological sample from an individual, such as a human subject.
  • a polynucleotide(s) e.g., FGF19 polynucleotides
  • a variety of methods for detecting polynucleotides can be employed and include, for example, RT-PCR, taqman, amplification methods, polynucleotide microarray, and the like.
  • Methods for the detection of polynucleotides are well known and include, for example, hybridization assays using complementary DNA probes (such as in situ hybridization using labeled FGF 19 riboprobes), Northern blot and related techniques, and various nucleic acid amplification assays (such as RT-PCR using complementary primers specific for FGF 19, and other amplification type detection methods, such as, for example, branched DNA, SPIA, Ribo-SPIA, SISBA, TMA and the like).
  • complementary DNA probes such as in situ hybridization using labeled FGF 19 riboprobes
  • Northern blot and related techniques
  • nucleic acid amplification assays such as RT-PCR using complementary primers specific for FGF 19, and other amplification type detection methods, such as, for example, branched DNA, SPIA, Ribo-SPIA, SISBA, TMA and the like.
  • Biological samples from mammals can be conveniently assayed for, e.g., FGF19 mRNAs using Northern, dot blot or PCR analysis.
  • RT-PCR assays such as quantitative PCR assays are well known in the art.
  • a method for detecting FGF 19 mRNA in a biological sample comprises producing cDNA from the sample by reverse transcription using at least one primer; amplifying the cDNA so produced using an FGF 19 polynucleotide as sense and antisense primers to amplify FGF 19 cDNAs therein; and detecting the presence or absence of the amplified FGF 19 cDNA.
  • such methods can include one or more steps that allow one to determine the amount (levels) of FGF19 mRNA in a biological sample (e.g. by simultaneously examining the levels a comparative control mRNA sequence of a housekeeping gene such as an actin family member).
  • the sequence of the amplified FGF19 cDNA can be determined.
  • the Affymetrix GeneChip® system is a commercially available microarray system which comprises arrays fabricated by direct synthesis of oligonucleotides on a glass surface.
  • Probe/Gene Arrays Oligonucleotides, usually 25 mers, are directly synthesized onto a glass wafer by a combination of semiconductor-based photolithography and solid phase chemical synthesis technologies. Each array contains up to 400,000 different oligos and each oligo is present in millions of copies. Since oligonucleotide probes are synthesized in known locations on the array, the hybridization patterns and signal intensities can be interpreted in terms of gene identity and relative expression levels by the Affymetrix Microarray Suite software.
  • FGF 19 gene deletion, gene mutation, or gene amplification is detected.
  • Gene deletion, gene mutation, or amplification may be measured by any one of a wide variety of protocols known in the art, for example, by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA (Thomas, Proc. Natl. Acad. Sci. USA, 77:5201-5205 (1980)), dot blotting (DNA analysis), or in situ hybridization (e.g., FISH), using an appropriately labeled probe, cytogenetic methods or comparative genomic hybridization (CGH) using an appropriately labeled probe.
  • these methods may be employed to detect FGF19 ligand gene deletion, ligand mutation, or gene amplification.
  • detecting FGF19 expression encompasses detection of FGF 19 gene deletion, gene mutation or gene amplification.
  • the invention provides methods for selecting treatment for an individual, the methods comprising: (a) detecting FGF 19 and FGFR4 expression in the biological sample, if any; and (b) subsequence to step (a), selecting treatment for the individual, wherein the selection of treatment is based on the FGF19 and FGFR4 expression detected in step (a).
  • increased FGF19 expression in the individual's biological sample relative to a reference value or control sample is detected.
  • decreased FGF 19 expression in the individual's biological sample relative to a reference value or control sample is detected in the individual.
  • increased FGFR4 expression in the individual's biological sample relative to a reference value or control sample is detected.
  • any suitable antibody may be used for detection and/or diagnosis, including monoclonal and/or polyclonal antibodies, a human antibody, a chimeric antibody, an affinity-matured antibody, a humanized antibody, and/or an antibody fragment.
  • an anti-FGF 19 antibody described herein is use for detection.
  • FGF19 and/or FGFR4 polypeptide expression is detected using immunohistochemistry (IHC).
  • IHC immunohistochemistry
  • FGF 19 expression is scored at 2 or higher using an IHC.
  • FGF 19 and/or FGFR4 expression may be detected. FGF 19 and/or FGFR4 expression may be increased. It is understood that absence of FGF 19 and/or FGFR4 expression includes insignificant, or de minimus levels.
  • FGF 19 expression in the test biological sample is higher than that observed for a control biological sample (or control or reference level of expression). In some embodiments, FGF19 expression is at least about 2-fold, 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 75-fold, 100-fold, 150-fold higher, or higher in the test biological sample than in the control biological sample.
  • FGF19 polypeptide expression is determined in an immunohisto chemistry ("IHC") assay to score at least 2 or higher for staining intensity. In some embodiments, FGF 19 polypeptide expression is determined in an IHC assay to score at least 1 or higher, or at least 3 or higher for staining intensity. In some embodiments, FGF 19 expression in the test biological sample is lower than that observed for a control biological sample (or control expression level).
  • IHC immunohisto chemistry
  • FGF 19 expression is detected in serum and FGFR4 expression is detected in a tumor sample. In some embodiments, FGF19 expression and FGFR4 expression are detected in a tumor sample. In some embodiments, FGF 19 expression is detected in serum or a tumor sample, and FGFR4 downstream molecular signaling and/or FGFR4 expression is detected in a tumor sample. In some embodiments, FGF 19 expression is detected in serum or a tumor sample, and Wnt pathway activation is detected in a tumor sample. In some embodiments, FGF 19 expression is detected in serum or a tumor sample, and FGFR4 downstream molecular signaling and/or FGFR4 expression and/or Wnt pathway activation is detected in a tumor sample.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically - acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • a pharmaceutically - acceptable buffer such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as phosphate-buffered saline,
  • Tissue samples (50 mg) were homogenized in 500 ⁇ l extraction buffer (20 mM Tris pH 8, 137 mM NaCl, 1 mM EGTA, 1% Triton X-100, 10% glycerol, 1.5 mM MgC ⁇ , complete protease inhibitor cocktail (Roche Applied Sciences)). Total proteins from cultured cells were extracted on ice for 30 min with the extraction buffer. Lysates were centrifuged (10,000 X g, 15 min) and then cleared with Cibacron blue-agarose and Protein G-agarose (GE Healthcare Life Sciences) overnight at 4 0 C. Lysates (100 ⁇ g protein) were incubated in 1 ml PBS/0.
  • Receptor pull down assay FGFR-Fc chimeric proteins 400 ng were incubated with 400 ng FGF 19 or 400 ng FGFl and heparin (200 ng) in
  • Balb/c mice were sequentially immunized with FGF19-His.
  • Balb/c mice were immunized into each hind footpad 9 times (at two week intervals) with 2.0 ⁇ g of hu FGF-19-His resuspended in MPL-TDM (Ribi Immunochemical Research, Inc., Hamilton, Mont.).
  • MPL-TDM Ribi Immunochemical Research, Inc., Hamilton, Mont.
  • spleens were harvested and popliteal lymph node cells were fused with murine myeloma cells P3X63Ag8.U. l (ATCC CRL1597), using 35% polyethylene glycol. Hybridomas were selected in HAT medium.
  • VL and VH domains were amplified using RT-PCR with the degenerate primers to heavy and light chain.
  • the forward primers were specific for the N-terminal amino acid sequence of the VL and VH region.
  • the LC and HC reverse primers were designed to anneal to a region in the constant light (CL) and constant heavy domain 1 (CHl), which is highly conserved across species.
  • Amplified VL and VH were cloned into mammalian expression vectors. The polynucleotide sequence of the inserts was determined using routine sequencing methods.
  • HEP3B cells were starved overnight in serum free Dulbecco's Modified Essential Media:Ham F12 (50:50) and treated with 100 ng/ml FGF19 for 6 h in the presence or the absence of antibodies 1A6, IAl or isotype-matched control antibody (each at concentrations ranging from 10 ug/ml to 0.04 ug/ml).
  • CYP7 ⁇ l expression was evaluated by semi- quantitative RT-PCR using gene specific primers and probes (Taqman ABI PRISM 7700, Applied Biosystems) and normalized to GAPDH expression. Triplicate sets of data were averaged for each condition.
  • Equal amounts of proteins (100 ⁇ g protein) were incubated with 1 ⁇ g of anti-FGFR4 antibody (clone 1G7; Genentech inc.) or anti- FRS2 (UpState) antibody immobilized onto protein A-Sepharose for 2 h at 4° C with gentle rotation.
  • Matrix was washed with lysis buffer and immunocomplexes eluted in 2x Laemmli buffer, boiled, and microcentrifuged. Proteins were electrophoresed on SDS-PAGE, transferred to nitrocellulose membrane, and probed with phosphotyrosine antibody (1:1000 dilution, 4G10, UpState).
  • Fenestra-LC a liver specific contrast agent.
  • Fenestra-LC is an iodinated triglyceride that mimics chylomicron remnants and exploits endogenous lipid metabolic pathways resulting in hepatocyte contrast accumulation. These agents have been previously been previously employed as means to identify hepatic liver tumors. (Lee et al., 1997; Weichert et al, 1996) At 6-months of age, FGF19 transgenic mice were injected with Fenestra LC (Advanced Research Technologies Inc.
  • mice were euthanized and livers resected for gross analysis, weighing, ex-vivo micro-CT analysis ( ⁇ CT 40 system; Scanco Medical, Bassersdorf, Switzerland), and histological staining.
  • ⁇ CT 40 system Scanco Medical, Bassersdorf, Switzerland
  • histological staining Whole livers were lightly blotted on gauze and submerged in soybean oil (Sigma-Aldrich, St. Louis, MO) in preparation for micro-CT imaging.
  • 90-minute scans were obtained at 30- ⁇ m isotropic voxel size, with 512 projections at an integration time of 300 ms, energy of 45 keV, and tube current of 177 ⁇ A.
  • volumetric image files were analyzed using image analysis software from AnalyzeDirect (Lenexa, KS).
  • An intensity threshold of -16 Houndsfield Units (HU) was used to segment the tissue mass from the background signal (soybean oil).
  • a second threshold (26 HU) was employed to estimate hepatic tissue volumes associated with functional hepatic tissue that accumulated the contrast agent resulting in hyper-intense regions defining normal hepatic tissue.
  • HCTl 16 cells (ATCC, Rockville, MD) were routinely maintained at 37°C and 5% CO2 in RPMI 1640 containing 10% tetracycline-free fetal bovine serum and 4 mmol/L L-glutamine. Serum-starved cells were incubated with either vehicle or FGF19 (25-100 ng/ml, 10 min). In separate experiments, cells were treated with either control antibody (gpl20) or FGF19 antibody (1A6, 10 ⁇ g/ml) for 3-24 hrs.
  • control antibody gpl20
  • FGF19 antibody 1A6, 10 ⁇ g/ml
  • ⁇ -catenin activation cells were pretreated with a proteasome inhibitor, MG132 (Biomol, Plymouth Meeting, PA) at 1 ⁇ M concentration for 4 hr followed by anti-FGF19 mab 1A6 treatment for 24 hrs to evaluate phosphorylation of Ser33/ Ser 37, Ser 45 and Thr41 on ⁇ -catenin. After incubation, cells were washed in cold PBS and lysed for either protein or RNA analysis.
  • MG132 Biomol, Plymouth Meeting, PA
  • the antibodies used for immunoprecipitation and immunob lotting were anti- ⁇ -catenin mAbs from BD Transduction (San Diego, CA), anti-active- ⁇ -catenin antibody directed against N-terminally dephosphorylated ⁇ -catenin, anti-phospho tyro sine (4G10) and anti-E-cadherin antibody from UpState Biotech (Charlottesville, VA), anti-phospho- ⁇ - catenin (Ser33/Ser37 and Ser45/Thr41 specific) antibody from Cell Signaling (Danvers, MA), and anti-FGFR4 mAb (1G7) (Genentech, Inc.). Where indicated, the membranes were stripped (Pierce) and reprobed with another antibody.
  • the peptides were digested in trypsin (10 ng/ ⁇ l) in 50 mM sodium bicarbonate pH 8.0 and peptide mixtures (3mL) were loaded onto a 0.25 x 30 mm trapping cartridge packed with Vydac 214MS low-TFA C4 beads. This cartridge was placed in-line with a 0.1 x 100mm resolving column packed with Vydac 218MS Cl 8 beads. The resolving column was constructed using a "picofrit" (New Objective) fused silica capillary pulled to a 15 mm metal-coated tip, which formed a micro-electrospray emitter.
  • FGFR4 shRNA5 Forward GAT CCC CGA ACC GCA TTG GAG GCA TTA TCA AGA GAA ATG CCT CCA ATG CGG TTC TTT TTT GGA AA (SEQ ID NO:43); Reverse: AGC TTT TCC AAA AAA GAA CCG CAT TGG AGG CAT TTC TCT TGA TAA TGC CTC CAA
  • inducible-shRNA cell clones HCTl 16 cells were transfected using LipofectAmine 2000 plus (Invitrogen).
  • puromycin resistance gene encoded in the vector is under the control of a constitutive ⁇ -actin promoter, 5 ⁇ g/mL puromycin was used to select transfected cells expressing shRNA.
  • Stable clones were isolated, treated with 1 ⁇ g/mL doxycycline (BD Clontech, San Jose, CA) for 7 days to induce expression of siRNA. Functional FGFR4 protein knockdown was assessed by Western blotting.
  • FGF 19 and FGFR4 mRNA and protein expression was analyzed in a panel of colon, breast, and liver tumor cell lines. We found FGF19 mRNA expression in a subset of colon cancer cell lines, including Colo201, Colo205, SW620, SW480, and HCTl 16 (Fig. 3A). SNU185, SNU398, MCF7 and all colon cancer cell lines tested expressed FGFR4 mRNA. FGF 19 and FGFR$ protein expression was determined in a panel of cancer cell lines using western blot analysis. With the exception of HT29, which did not express FGF 19 protein, the FGF 19 and FGFR4 protein levels agreed with their mRNA expression in these cell lines (Fig. 3B).
  • FGFR4 (Xie et al., 1999). To examine FGF19's binding specificity more completely we assessed its interaction with all known human FGFRs in their different alternatively spliced forms including the recently identified FGFR5 (FGFRlL) (Sleeman et al., 2001). In a solid phase assay FGF19 dose dependent binding was restricted to FGFR4 (Fig. 4C). In a receptor pull down assay FGFl bound to all FGFRs whereas FGF19 interaction was limited to FGFR4 (Fig. 4D). These results are consistent with previous findings (Ornitz et al., 1996; Xie et al., 1999) and further emphasize the unique binding specificity of FGF19 for FGFR4.
  • Example 7 Generation of anti-FGF 19 monoclonal antibody A panel of anti-FGF19 mouse monoclonal antibodies was generated as described above. The polynucleotide sequence of the inserts was determined using routine sequencing methods. The anti-FGF19 mab 1 A6 VL and VH amino acid sequences are shown in Figure 1.
  • anti-FGF19 mabs IAl and 1A6 bound to FGF19 with a comparable EC50 of 40 pM whereas anti-FGF19 mab IDl bound with an EC50 of 400 pM (Fig. 5A).
  • 1A6 blocked FGF19 binding to FGFR4 with an IC50 of 3 nM (Fig. 5B). IAl, IDl and an irrelevant control antibody did not inhibit this interaction.
  • a mass spectrometric approach was used to localize the epitopes of anti-FGF19 Mab 1A6 and IAl and to evaluate whether FGF 19 conformational components contributed to their binding.
  • FGF 19 was incubated with the agarose-coupled antibodies and the adsorbed protein was then digested with trypsin.
  • the analysis of the total digest demonstrated a complete fragmentation of the adsorbed FGF19, without 1A6 masking of any trypsin cleavage sites (Fig. 6A).
  • the matrix was washed extensively and the bound peptides were eluted and identified by mass spectrometry.
  • the non-specifically adsorbed peptides were identified using an irrelevant control antibody coupled to agarose in a parallel experiment.
  • the epitopes of IAl and IDl are located in a distal portion of FGF19 that is not represented on this model due to its lack of ordered structure.
  • the 1A6 epitope is localized in the FGF19 binding interface with FGFR4 ( Figure 6E).
  • anti-FGF19 antibodies were tested in two tumor xenograph models as described above.
  • the colon cancer cell lines HCTl 16 and colo201 were selected because they expressed both FGF19 and FGFR4 (Fig. 3A) and form tumors in vivo.
  • anti-FGF19 antibody 1A6 showed a blocking activity on the FGF19-induced HCT 116 cells migration in vitro.
  • FGF 19 Over-expression of FGF 19 in the skeletal muscle of transgenic mice resulted in development of hepatocellular carcinomas by 10-12 months of age (Nicholes et al., Am J Pathol. 160:2295-2307, 2002).
  • FGF19 is acting as a tumor promoter in this model
  • DEN-accelerated FGF19 transgenic mice were treated with either 1A6 or control antibody (anti-gpl20) for 6 months.
  • Example 13 FGF 19 treatment induced tyrosine phosphorylation of ⁇ -catenin and caused loss of E-cadherin binding to beta-catenin in HCTl 16 cells
  • HCTl 16 cells with FGF19 did not affect active- ⁇ -catenin levels at any dose or time point, indicating that endogenous FGF 19 activated ⁇ -catenin at saturated levels in an autocrine fashion.
  • treatment of HCTl 16 cells with anti-FGF19 antibody 1A6 significantly reduced active- ⁇ -catenin levels at timepoints as early as 3 hrs following treatment, and sustained decreased active- ⁇ -catenin levels for up to 24 hrs (71.8 ⁇ 1.5% decrease vs gpl20, pO.OOl) when compared with control antibody (gpl20) treated cells (Figure 12).
  • Example 15 Treatment with anti-FGF19 antibody induced Ser33/Ser37/Ser45 and Thr41 phosphorylation
  • Example 16 Reduction of FGFR4 expression using shRNA resulted in reduced active- ⁇ -catenin levels

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2007/061936 2006-02-10 2007-02-09 Anti-fgf19 antibodies and methods using same Ceased WO2007136893A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP07797128.1A EP1989230B1 (en) 2006-02-10 2007-02-09 Anti-fgf19 antibodies and methods using same
CA002637988A CA2637988A1 (en) 2006-02-10 2007-02-09 Anti-fgf19 antibodies and methods using same
ES07797128.1T ES2582652T3 (es) 2006-02-10 2007-02-09 Anticuerpos anti-FGF19 y métodos de uso de los mismos
NZ569957A NZ569957A (en) 2006-02-10 2007-02-09 Anti-FGF19 antibodies and methods using same
AU2007254005A AU2007254005B2 (en) 2006-02-10 2007-02-09 Anti-FGF19 antibodies and methods using same
JP2008554523A JP5209505B2 (ja) 2006-02-10 2007-02-09 抗fgf19抗体およびその使用方法
HK09100473.7A HK1120273B (en) 2006-02-10 2007-02-09 Anti-fgf19 antibodies and methods using same

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US77231006P 2006-02-10 2006-02-10
US60/772,310 2006-02-10
US78060806P 2006-03-09 2006-03-09
US60/780,608 2006-03-09
US88586607P 2007-01-19 2007-01-19
US60/885,866 2007-01-19

Publications (2)

Publication Number Publication Date
WO2007136893A2 true WO2007136893A2 (en) 2007-11-29
WO2007136893A3 WO2007136893A3 (en) 2008-05-15

Family

ID=38723925

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2007/061936 Ceased WO2007136893A2 (en) 2006-02-10 2007-02-09 Anti-fgf19 antibodies and methods using same

Country Status (10)

Country Link
US (4) US7678373B2 (https=)
EP (1) EP1989230B1 (https=)
JP (1) JP5209505B2 (https=)
AR (1) AR059432A1 (https=)
AU (1) AU2007254005B2 (https=)
CA (1) CA2637988A1 (https=)
ES (1) ES2582652T3 (https=)
NZ (1) NZ569957A (https=)
TW (1) TWI388568B (https=)
WO (1) WO2007136893A2 (https=)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7678373B2 (en) 2006-02-10 2010-03-16 Genentech, Inc. Anti-FGF19 antibodies and methods using same
JP2011527322A (ja) * 2008-07-08 2011-10-27 サノフイ−アベンテイス Fgf−r4受容体特異的拮抗薬
US8236307B2 (en) 2007-08-03 2012-08-07 Genentech, Inc. Humanized anti-FGF19 antagonists and methods using same
WO2015059668A1 (en) 2013-10-25 2015-04-30 Novartis Ag Ring-fused bicyclic pyridyl derivatives as fgfr4 inhibitors
WO2016054483A1 (en) 2014-10-03 2016-04-07 Novartis Ag Use of ring-fused bicyclic pyridyl derivatives as fgfr4 inhibitors
WO2016151499A1 (en) 2015-03-25 2016-09-29 Novartis Ag Formylated n-heterocyclic derivatives as fgfr4 inhibitors
US9873748B2 (en) 2013-12-23 2018-01-23 Genentech, Inc. Bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1
WO2018055503A1 (en) 2016-09-20 2018-03-29 Novartis Ag Combination comprising a pd-1 antagonist and an fgfr4 inhibitor
WO2018083603A1 (en) 2016-11-02 2018-05-11 Novartis Ag Combinations of fgfr4 inhibitors and bile acid sequestrants
WO2020156539A1 (en) * 2019-02-02 2020-08-06 Huahui Health Ltd. Anti-fgf19 antibodies
EP4509142A1 (en) 2023-08-16 2025-02-19 Ona Therapeutics S.L. Fgfr4 as target in cancer treatment

Families Citing this family (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6737056B1 (en) * 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
DE10254601A1 (de) 2002-11-22 2004-06-03 Ganymed Pharmaceuticals Ag Differentiell in Tumoren exprimierte Genprodukte und deren Verwendung
EP2083081A1 (en) 2005-07-22 2009-07-29 Five Prime Therapeutics, Inc. Compositions and methods of treating disease with FGFR fusion proteins
WO2007142241A1 (ja) * 2006-06-05 2007-12-13 Hiroshima University 抗cd38抗体を細胞表面に有する免疫担当細胞
EP1918376A1 (en) * 2006-11-03 2008-05-07 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. FGFR4 promotes cancer cell resistance in response to chemotherapeutic drugs
CL2008000947A1 (es) * 2007-04-02 2008-10-10 Genentech Inc Uso de un antagonista de la proteina beta-klotho (klb) para tratar trastornos asociados a la expresion o actividad de klb.
US20090309617A1 (en) * 2007-08-24 2009-12-17 Ye Fang Biosensor antibody functional mapping
US20090226459A1 (en) * 2008-01-29 2009-09-10 Cold Spring Harbor Laboratory Role of fgf-19 in cancer diagnosis and treatment
CA2722854A1 (en) * 2008-04-30 2009-11-05 Wntresearch Ab Restoration of estrogen receptor-.alpha. activity
CA2727278A1 (en) 2008-06-16 2010-01-21 Immunogen, Inc. Novel synergistic effects
WO2010006214A1 (en) * 2008-07-09 2010-01-14 Ambrx, Inc. Fgf-21 neutralizing antibodies and their uses
EP2318529B1 (en) 2008-08-04 2017-10-18 Five Prime Therapeutics, Inc. Fgfr extracellular domain acidic region muteins
WO2010033913A1 (en) * 2008-09-22 2010-03-25 Icb International, Inc. Antibodies, analogs and uses thereof
US20100136584A1 (en) * 2008-09-22 2010-06-03 Icb International, Inc. Methods for using antibodies and analogs thereof
US8445445B2 (en) 2009-09-15 2013-05-21 Five Prime Therapeutics, Inc. Method of promoting hair growth using FGFR4 extracellular domains
KR101952453B1 (ko) * 2009-10-15 2019-02-26 제넨테크, 인크. 수용체 특이성이 변경된 키메라 섬유모세포 성장 인자
LT2498799T (lt) 2009-11-13 2016-11-10 Five Prime Therapeutics, Inc. Fgfr1 ekstraląstelinio domeno baltymų panaudojimas gydymui vėžio su nuo ligando priklausančiomis, aktyvuojančiomis fgfr2 mutacijomis
CN102770456B (zh) * 2009-12-04 2018-04-06 弗·哈夫曼-拉罗切有限公司 多特异性抗体、抗体类似物、组合物和方法
WO2011084711A2 (en) 2009-12-17 2011-07-14 Five Prime Therapeutics, Inc. Hair growth methods using fgfr3 extracellular domains
JP4881428B2 (ja) * 2009-12-25 2012-02-22 株式会社東芝 電子機器
US8481038B2 (en) 2010-11-15 2013-07-09 Five Prime Therapeutics, Inc. Treatment of cancer with elevated dosages of soluble FGFR1 fusion proteins
US8951972B2 (en) 2010-12-09 2015-02-10 Five Prime Therapeutics, Inc. FGFR1 extracellular domain combination therapies for lung cancer
JP6211931B2 (ja) 2011-03-09 2017-10-11 セル・シグナリング・テクノロジー・インコーポレイテツド モノクローナル抗体を作製するための方法および試薬
US20140294820A1 (en) * 2011-06-24 2014-10-02 University Of Miami Fibroblast growth factor receptor inhibition for the treatment of disease
CN107823630A (zh) 2011-11-14 2018-03-23 戊瑞治疗有限公司 治疗癌症的方法
US10112987B2 (en) 2012-01-09 2018-10-30 Icb International, Inc. Blood-brain barrier permeable peptide compositions comprising a vab domain of a camelid single domain heavy chain antibody against an amyloid-beta peptide
US10112988B2 (en) 2012-01-09 2018-10-30 Icb International, Inc. Methods of assessing amyloid-beta peptides in the central nervous system by blood-brain barrier permeable peptide compositions comprising a vab domain of a camelid single domain heavy chain antibody against an anti-amyloid-beta peptide
JP2015506944A (ja) * 2012-01-18 2015-03-05 ジェネンテック, インコーポレイテッド Fgf19修飾薬を使用する方法
WO2013167153A1 (en) 2012-05-09 2013-11-14 Ganymed Pharmaceuticals Ag Antibodies useful in cancer diagnosis
SG11201408538PA (en) 2012-07-13 2015-02-27 Roche Glycart Ag Bispecific anti-vegf/anti-ang-2 antibodies and their use in the treatment of ocular vascular diseases
JP6499079B2 (ja) 2012-11-13 2019-04-10 バイオエヌテック アーゲーBioNTech AG クローディンを発現するガン疾患を処置するための剤
PL3082858T3 (pl) * 2013-12-20 2021-09-27 Angiobiomed Gmbh Środek wiążący adrenomedulinę do zastosowania w terapii nowotworu
RU2729161C2 (ru) * 2014-10-23 2020-08-04 ЭнДжиЭм БАЙОФАРМАСЬЮТИКАЛЗ, ИНК. Фармацевтические композиции, содержащие варианты пептидов, и способы их применения
ES2972458T3 (es) 2016-02-10 2024-06-12 Bioinvent Int Ab Combinación de anticuerpo humano anti-FGFR4 y sorafenib
US10813933B2 (en) * 2016-05-17 2020-10-27 Japanese Foundation For Cancer Research Therapeutic agent for lung cancer that has acquired EGFR-TKI resistance
US20190218285A1 (en) * 2018-01-18 2019-07-18 Molecular Cloning Laboratories (MCLAB) LLC Long-Acting Therapeutic Fusion Proteins
CN109251983B (zh) * 2018-08-15 2022-03-25 深圳市罗湖区人民医院 Frs2基因的拷贝数扩增及其应用、检测拷贝数扩增的特异性引物对
MY195550A (en) 2018-10-29 2023-01-31 Hoffmann La Roche Antibody Formulation
EP3865155B1 (en) * 2020-02-13 2022-11-30 Orano Med Process for site-specific modification of an antibody
CN116726005B (zh) * 2022-03-03 2026-02-13 上海市第六人民医院 一种治疗运动损伤的药物及筛选方法和应用
KR20250012564A (ko) 2022-05-19 2025-01-24 타이라 바이오사이언시스, 인크. Ppar 효현제 및 fgfr4 저해제를 이용한 치료법

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5859205A (en) * 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US20020042367A1 (en) * 1997-11-25 2002-04-11 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20020012961A1 (en) * 1999-04-15 2002-01-31 Genentech, Inc. Fibroblast growth factor- 19
US20020155543A1 (en) * 1997-11-25 2002-10-24 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20040126852A1 (en) * 1997-11-25 2004-07-01 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity
KR20050009764A (ko) 1997-11-25 2005-01-25 제넨테크, 인크. 섬유아세포 성장 인자-19
US20050026832A1 (en) * 1997-11-25 2005-02-03 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US7459540B1 (en) 1999-09-07 2008-12-02 Amgen Inc. Fibroblast growth factor-like polypeptides
EP1214409B1 (en) 1999-09-08 2006-05-17 Genentech, Inc. Fibroblast growth factor-19 (fgf-19) nucleic acids and polypeptides and methods of use for the treatment of obesity
MXPA02009224A (es) 2000-03-22 2003-03-12 Amgen Inc Moleculas similares a receptor de factor de crecimiento de fibroblastos y usos de las mismas.
US20030143539A1 (en) 2000-12-08 2003-07-31 Francois Bertucci Gene expression profiling of primary breast carcinomas using arrays of candidate genes
AU2002330039A1 (en) 2001-09-17 2003-04-01 Eos Biotechnology, Inc. Methods of diagnosis of cancer compositions and methods of screening for modulators of cancer
WO2003065006A2 (en) 2002-01-31 2003-08-07 Millennium Pharmaceuticals, Inc. Methods and compositions for treating cancer
EP1553912A4 (en) * 2002-06-07 2007-08-08 Genentech Inc COMPOSITIONS AND METHODS FOR TUMOR DIAGNOSIS AND TREATMENT
US20050198642A1 (en) * 2004-03-04 2005-09-08 International Business Machines Corporation Mechanism for assigning home nodes to newly created threads
US7837626B2 (en) * 2005-08-05 2010-11-23 Siemens Medical Solutions Usa, Inc. Contrast agent manipulation with medical ultrasound imaging
ES2582652T3 (es) 2006-02-10 2016-09-14 Genentech, Inc. Anticuerpos anti-FGF19 y métodos de uso de los mismos

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7678373B2 (en) 2006-02-10 2010-03-16 Genentech, Inc. Anti-FGF19 antibodies and methods using same
US7846691B2 (en) 2006-02-10 2010-12-07 Genentech, Inc. Polynucleotide encoding an anti-FGF19 antibody
US8241633B2 (en) 2006-02-10 2012-08-14 Genentech, Inc. Anti-FGF19 antibodies and methods using same
US8293241B2 (en) 2006-02-10 2012-10-23 Genentech, Inc. Anti-FGF19 antibodies and methods using same
US8236307B2 (en) 2007-08-03 2012-08-07 Genentech, Inc. Humanized anti-FGF19 antagonists and methods using same
US8409579B2 (en) 2007-08-03 2013-04-02 Genentech, Inc. Humanized anti-FGF19 antagonists and methods using same
JP2011527322A (ja) * 2008-07-08 2011-10-27 サノフイ−アベンテイス Fgf−r4受容体特異的拮抗薬
WO2015059668A1 (en) 2013-10-25 2015-04-30 Novartis Ag Ring-fused bicyclic pyridyl derivatives as fgfr4 inhibitors
US9873748B2 (en) 2013-12-23 2018-01-23 Genentech, Inc. Bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1
US9884919B2 (en) 2013-12-23 2018-02-06 Genentech, Inc. Methods of treatment with bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1
US10246518B2 (en) 2013-12-23 2019-04-02 Genentech, Inc. Nucleic acids encoding bispecific antibodies binding to beta-Klotho and fibroblast growth factor receptor 1
US10882921B2 (en) 2013-12-23 2021-01-05 Genentech, Inc. Host cell comprising nucleic acids encoding bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1 and antibody production
WO2016054483A1 (en) 2014-10-03 2016-04-07 Novartis Ag Use of ring-fused bicyclic pyridyl derivatives as fgfr4 inhibitors
WO2016151499A1 (en) 2015-03-25 2016-09-29 Novartis Ag Formylated n-heterocyclic derivatives as fgfr4 inhibitors
WO2018055503A1 (en) 2016-09-20 2018-03-29 Novartis Ag Combination comprising a pd-1 antagonist and an fgfr4 inhibitor
WO2018083603A1 (en) 2016-11-02 2018-05-11 Novartis Ag Combinations of fgfr4 inhibitors and bile acid sequestrants
WO2020156539A1 (en) * 2019-02-02 2020-08-06 Huahui Health Ltd. Anti-fgf19 antibodies
US20220041706A1 (en) * 2019-02-02 2022-02-10 Huahui Health Ltd. Anti-fgf19 antibodies
US12421307B2 (en) 2019-02-02 2025-09-23 Huahui Health Ltd. Anti-FGF19 antibodies
EP4509142A1 (en) 2023-08-16 2025-02-19 Ona Therapeutics S.L. Fgfr4 as target in cancer treatment
WO2025036876A2 (en) 2023-08-16 2025-02-20 ONA Therapeutics S.L. New anti-cancer approaches

Also Published As

Publication number Publication date
CA2637988A1 (en) 2007-11-29
US20120128675A1 (en) 2012-05-24
HK1120273A1 (zh) 2009-03-27
JP2009525764A (ja) 2009-07-16
TW200808827A (en) 2008-02-16
US8293241B2 (en) 2012-10-23
US20100129381A1 (en) 2010-05-27
TWI388568B (zh) 2013-03-11
AU2007254005B2 (en) 2012-11-29
EP1989230B1 (en) 2016-06-01
US7846691B2 (en) 2010-12-07
ES2582652T3 (es) 2016-09-14
JP5209505B2 (ja) 2013-06-12
EP1989230A2 (en) 2008-11-12
US20110086032A1 (en) 2011-04-14
AR059432A1 (es) 2008-04-09
WO2007136893A3 (en) 2008-05-15
US20070248604A1 (en) 2007-10-25
US7678373B2 (en) 2010-03-16
AU2007254005A1 (en) 2007-11-29
NZ569957A (en) 2012-03-30
US8241633B2 (en) 2012-08-14

Similar Documents

Publication Publication Date Title
EP1989230B1 (en) Anti-fgf19 antibodies and methods using same
US20220089780A1 (en) Klotho beta
CA2693852C (en) Humanized anti-fgf19 antagonists and methods using same
AU2014203654B2 (en) Klotho-beta for use in treating cancer, liver disorders, gallstones, wasting syndrome and obesity-related diseases
HK1120273B (en) Anti-fgf19 antibodies and methods using same
HK1260779A1 (en) A klotho-beta agonist antibody for use in the treatment of diabetes mellitus or insulin resistance
HK1178787A (en) A klotho-beta agonist antibody for use in the treatment of diabetes mellitus or insulin resistance
HK1178787B (en) A klotho-beta agonist antibody for use in the treatment of diabetes mellitus or insulin resistance

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 2637988

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 569957

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2007254005

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2008554523

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2007254005

Country of ref document: AU

Date of ref document: 20070209

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2007797128

Country of ref document: EP