WO2005123125A1 - Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 - Google Patents
Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 Download PDFInfo
- Publication number
- WO2005123125A1 WO2005123125A1 PCT/EP2005/006461 EP2005006461W WO2005123125A1 WO 2005123125 A1 WO2005123125 A1 WO 2005123125A1 EP 2005006461 W EP2005006461 W EP 2005006461W WO 2005123125 A1 WO2005123125 A1 WO 2005123125A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hpv
- vlps
- types
- vlp
- vaccine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/12—Keratolytics, e.g. wart or anti-corn preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention relates to vaccines against human papillomaviruses
- Papillomaviruses are small DNA tumour viruses, which are highly species specific. So far, over 00 individual human papillomavirus (HPV) genotypes have been described. HPVs are generally specific either for the skin (e.g. HPV-1 and -2) or mucosal surfaces (e.g. HPV-6 and -11) and usually cause benign tumours (warts) that persist for several months or years. Such benign tumours may be distressing for the individuals concerned but tend not to be life threatening, with a few exceptions.
- HPVs human papillomavirus
- HPVs are also associated with cancers, known as oncogenic HPV types.
- the strongest positive association between an HPV and human cancer is that which exists between HPV- 16 and HPV- 18 and cervical carcinoma. Cervical cancer is the most common malignancy in developing countries, with about 500,000 new cases occurring in the world each year.
- HPVs of particular interest with respect to cancer are types 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 68, 73, 82, 26, 53, and 66.
- VLPs HPV virus like particles
- a bivalent vaccine utilizing VLPs has been shown to be effective in prevention of infection with HPV 16 and 18 types in young women (Lancet, vol 364, issue 9447, November 2004, pages 1757- 1765).
- the present invention relates to an immunogenic composition
- an immunogenic composition comprising VLPs from HPV 16 and 18 and at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31, 45 and 52, wherein the dose of the VLP of the at least one other cancer types is reduced relative to that ofHPV 16 or l8.
- the invention relates to an immunogenic composition
- an immunogenic composition comprising VLPs from HPV 16 and at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31 and 52, wherein the dose of the VLP of the at least one other cancer types is reduced relative to that of HPV 16.
- the invention relates to an immunogenic composition
- an immunogenic composition comprising VLPs from HPV 18 and HPV 45, wherein the dose of the HPV 45 VLP is reduced relative to that of HPV 18.
- the invention further relates to an immunogenic composition as defined above in combination with an adjuvant and/or carrier.
- the invention further relates to a vaccine comprising an immunogenic composition as defined above with a pharmaceutically acceptable excipient.
- the invention further relates to a method of preventing HPV infection and/or disease comprising administering to an individual in need thereof a composition or vaccine as defined above.
- the invention further relates to a method for making an immunogenic composition as defined above comprising mixing VLPs from HPV 16 and 18 with at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31, 45, and 52, wherein the dose of the VLP of the at least one other cancer types is reduced relative to that of HPV 16 or 18.
- the above aspects of the invention may also employ HPV capsomers rather than VLPs.
- HPV 16 and 18 VLPs can provide cross protection against infection and/or disease by certain other HPV cancer types, that is HPV 31, HPV 45 and HPV 52. Data is provided in the examples herein.
- Cross protection may be considered as the protection afforded by a vaccine containing one HPV type against infection (incident or persistent) and/or disease caused by a different HPV type. Incident and persistent infection are defined as in the Lancet paper by Harper et al. Vol 364, issue 9447, November 2004, pages 1757- 1765. Cross protection may be assessed by considering the vaccine efficacy (V.E.), wherein the V.E. is the % improvement in protection against infection by the vaccine compared to a placebo group for a given type.
- V.E. vaccine efficacy
- HPV vaccines comprising HPV 16 and 18 VLPs can be formulated using a lower dose of other (non-HPV 16/18) cancer type VLPs (31, 45 or 52) than would otherwise be required in the absence of HPV 16 and 18 VLPs, whilst still achieving the same protective response against incident and or persistent HPV infection for that other type.
- Reduction of the dose of other cancer type VLPs in a multivalent vaccine scenario without significant impact on the protection caused by those other types, may be advantageous where the total amount of antigen may be limited; for example, by physical , chemical or regulatory constraints. It also allows more doses of a vaccine to be produced for a given quantity of antigen and can potentially reduce overall vaccine cost.
- the dose of VLP herein is suitably the amount of VLP, measured by weight.
- the dose of (non HPV 16 HPV 18) 'other cancer type' VLPs that need to be used in combination with HPV 16 and/or HPV 18 VLPs can be reduced compared to that level which is required in the absence of such type 16 and or 18 VLPs.
- the invention thus relates to an immunogenic composition
- an immunogenic composition comprising VLPs from HPV 16 and 18 and at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31, 45, and 52, wherein the dose of the VLP of the at least one other cancer types is reduced relative to that of HPV 16 or 18.
- the invention relates to an immunogenic composition
- an immunogenic composition comprising VLPs from HPV 16 and 18 and at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31, 45 and 52, wherein the dose of the VLP of the at least one other cancer type is reduced relative to that which would otherwise be required, in the absence of HPV 16 and 18 VLPs, to generate the same protection against incident and or persistent HPV infection by that other cancer type.
- the dose of the (non HPV 16, 18) other cancer type VLP is sufficient to provide protection against incident and/or persistent infection by that type, and in one aspect of the invention protection against at least incident infection.
- composition of the invention is suitable for protection of infection and/or disease in human subjects.
- a suitable dose can be determined by, for example, trials in humans such as those described in the examples herein.
- Protection vs. incident and or persistent infection by a given HPV type is suitably protection in 50% of a vaccinated population against infection by that type, and in one aspect of the invention is 60% protection, in a further aspect 70% protection, in a further aspect 80% protection, in a further aspect 90% protection, in a further aspect 95% protection, in a further aspect 96% protection, in a further aspect 97% protection, in a further aspect 98% protection, in a further aspect 99% protection and in a yet further aspect 100% protection.
- this protection is assessed over a period of at least 6 months, such as over a period of at least 9 months, at least 1 year, at least 18 months, suitably over a period of 2 years or greater than 2 years.
- the protection is seen against infection or disease caused by HPV 16 and or HPV 18, and in one aspect both HPV 16 and HPV 18 infection and/or disease.
- Prevention of infection may be assessed by analysis of HPV species present in vaccinated individuals, for example by PCR analysis and/or hybridization techniques such as those described in WO03014402 and WO9914377, incorporated herein by reference.
- the non HPV 16/18 cancer type VLPs is type 31, or type 45, or type 52, or a combination thereof.
- the immunogenic composition of the invention comprises VLPs from HPV 16, 18, 31 and 45.
- the immunogenic composition of the invention comprises VLPs from HPV 16, 18, 31 and 52.
- the immunogenic composition of the invention comprises VLPs from HPV 16, 18, 45 and 52.
- the immunogenic composition of the invention comprises VLPs from HPV 16, 18, 31, 52 and 45. Where there are 2 or more other cancer type VLPs (e.g. 31 and 45, 31 and 52, 45 and 52), then at least one of these other cancer types is present at a dose which is reduced to that of HPV 16 or HPV 18.
- the dose of HPV 31 is reduced relative to that of HPV 16. In one aspect the dose of HPV 52 is reduced relative to that of HPV 16.
- the dose of HPV 45 is reduced relative to that of HPV 18.
- the immunogenic compositions as defined above provide protection against incident infection and/or persistent infection and/or disease caused by HPV 16, HPV 18 and one or more of the other (31, 45 or 52) HPV types present in the groups listed above, such as incident infection.
- an immunogenic composition of the invention comprises HPV 16 VLPs but not HPV 18 VLPs then suitably the non HPV 16/18 VLP cancer type is type 31 and/ or type 52.
- an immunogenic composition of the invention comprises HPV 18 VLPs but no HPV 16 VLPs then suitably the non HPV 16/18 VLP cancer type is type 45.
- composition comprises HPV 16 and 18 VLPs in combination with either or both of HPV 31 and HPV 45 VLPs.
- composition comprises at least HPV 16 VLPs in combination with HPV 31 VLPs.
- composition of the invention can comprise, in addition to VLPs at reduced dose, other HPV VLPs at any suitable dose.
- the composition of the invention can comprise additional "high risk" cancer types such as one or more of HPV 33, 35, 39, 51, 56, 58, 59, 66, or 68.
- the composition can comprise additional so called "genital warts” types such as HPV 6 and/or 11, or so called “skin” types such as HPV 5 and/or 8.
- additional VLPs are present at the same dose or higher than HPV 16 and /or HPV 18.
- the composition comprises HPV 39 and/or HPV 51 VLPs, and the dose of at least one of these is reduced relative to HPV 16 and/or HPV 18.
- the amount of any additional VLP is selected so as to provide some degree of protection against infection or disease against the additional type(s).
- compositions of the invention comprise the following dose of VLPs:
- the combined VLP vaccine of the invention is able to offer effective protection against infection by each HPV VLP type represented in the vaccine.
- the immune response against a given VLP type in the combination is at least 50 % of the immune response of that same VLP type when measured individually, preferably 100% or substantially 100%.
- the combined vaccine of the invention preferably stimulates an immune response which is at least 50% of that provided by a combined HPV 16 / HPV 18 VLP vaccine.
- the immune response generated by the vaccine of the invention is at a level in which the protective effect of each VLP type is still seen.
- the immune response may suitably be measured, for example, by antibody responses using standard techniques such as ELISA, and by clinical trials as described herein.
- the composition of the invention does not comprise a heat shock protein or fragment thereof.
- composition of the invention does not comprise an HPV L2 protein or peptide. In another aspect the composition of the invention does comprise an HPV L2 protein or peptide.
- VLPs HPV VLPs and methods for the production of VLPs are well known in the art.
- VLPs typically are constructed from the LI and optionally L2 structural proteins of the virus, see for example WO9420137, WO9629413 and WO9405792. Any suitable HPV VLP may be used in the present invention such as an LI or LI + L2 VLP.
- VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering.
- the VLP is an LI only VLP.
- the VLP may comprise full length LI protein.
- the LI protein used to form the VLP is a truncated LI protein.
- Truncated HPV LI proteins are disclosed in, for example, US6361778, incorporated herein by reference.
- the truncation removes a nuclear localisation signal.
- the truncation is a C terminal truncation.
- the C terminal truncation removes less than 50 amino acids, suitably preferably less than 40 amino acids.
- the HPV 16 LI sequence starts at the second methionine codon, for example as shown in the sequence below, or analogous positions in other HPV types.
- VLP is an HPV 16 VLP then in one aspect the C terminal truncation removes 34 amino acids from HPV 16 LI sequence. Where the VLP is an HPV 18 VLP then in one aspect the C terminal truncation removes 35 amino acids from the HPV 18 LI sequence.
- HPV 16 sequence is the following sequence: MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIK PNNNKI 60
- HPV 16 sequence may also be that disclosed in WO9405792 or US6649167, for example, suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
- HPV 18 sequence is the following sequence:
- HPV 18 sequence is disclosed in WO9629413, which may be suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
- HPV 16 and HPV 18 sequences are well known in the art and may be suitable for use in the present invention.
- Suitable truncations of HPV 31, HPV 45 and HPV 52 may also be made, suitably removing equivalent C terminal portions of the LI protein to those described above as assessed by sequence alignment. Truncated LI proteins are disclosed in, for example, WO9611272 and US6066324, herein incorporated by reference.
- truncated LI proteins are suitably functional LI protein derivatives, capable of raising an immune response (if necessary, when suitably adjuvanted), said immune response being capable of recognising a VLP consisting of the full length LI protein and/or the HPV type from which the LI protein was derived.
- VLPs of the invention may also comprise other types of functional protein derivatives, including mutants of the full length or truncated HPV LI proteins such as deletion, substitution, or insertion mutants.
- the LI protein or derivative may also be a fusion protein, such as the fusion of the LI protein with L2 or an early protein.
- the LI protein or functional protein derivative is able to form a VLP, and VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering.
- VLPs may be made in any suitable cell substrate such as yeast cells or insect cells e.g. baculovirus cells, and techniques for preparation of VLPS are well known in the art, such as WO9913056 and US6245568, and references therein, the entire contents of which are hereby incorporated by reference.
- VLPs are made by disassembly and reassembly techniques, which can provide for more stable and/or homogeneous papillomavirus VLPs.
- disassembly and reassembly techniques which can provide for more stable and/or homogeneous papillomavirus VLPs.
- McCarthy et al, 1998 “Quantitative Disassembly and Reassembly of Human Papillomavirus Type 11 Viruslike Particles in Vitro" J. Virology 72(1):33-41, describes the disassembly and reassembly of recombinant LI HPV 11 VLPs purified from insect cells in order to obtain a homogeneous preparation of VLP's.
- WO9913056 and US6245568 also describe disassembly/reassembly processes for making HPV VLPs.
- the HPV VLPS of the invention are made as described WO9913056 or US6245568.
- the VLPs of the invention may be combined with an adjuvant or imunostimulant such as, but not limited to, detoxified lipid A from any source and non-toxic derivatives of lipid A, saponins and other reagents capable of stimulating a THl type response.
- enterobacterial lipopolysaccharide is a potent stimulator of the immune system, although its use in adjuvants has been curtailed by its toxic effects.
- LPS enterobacterial lipopolysaccharide
- MPL monophosphoryl lipid A
- a further detoxified version of MPL results from the removal of the acyl chain from the 3-position of the disaccharide backbone, and is called 3-O-Deacylated monophosphoryl lipid A (3D-MPL). It can be purified and prepared by the methods taught in GB 2122204B, which reference also discloses the preparation of diphosphoryl lipid A, and 3-O-deacylated variants thereof.
- the 3D-MPL is in the form of an emulsion having a small particle size less than 0.2 ⁇ m in diameter, and its method of manufacture is disclosed in WO 94/21292.
- Aqueous formulations comprising monophosphoryl lipid A and a surfactant have been described in WO9843670A2.
- the bacterial lipopolysaccharide derived adjuvants to be formulated in the compositions of the present invention may be purified and processed from bacterial sources, or alternatively they may be synthetic.
- purified monophosphoryl lipid A is described in Ribi et al 1986 (supra)
- 3-O-Deacylated monophosphoryl or diphosphoryl lipid A derived from Salmonella sp. is described in GB 2220211 and US 4912094.
- Other purified and synthetic lipopolysaccharides have been described (Hilgers et al, 1986, Int. Arch. Allergy.
- the bacterial lipopolysaccharide adjuvant is 3D-MPL.
- the LPS derivatives that may be used in the present invention are those immunostimulants that are similar in structure to that of LPS or MPL or 3D-MPL.
- the LPS derivatives may be an acylated monosaccharide, which is a sub-portion to the above structure of MPL.
- Saponins are taught in: Lacaille-Dubois, M and Wagner H. (1996. A review of the biological and pharmacological activities of saponins. Phytomedicine vol 2 pp 363- 386). Saponins are steroid or triterpene glycosides widely distributed in the plant and marine animal kingdoms. Saponins are noted for forming colloidal solutions in water which foam on shaking, and for precipitating cholesterol. When saponins are near cell membranes they create pore-like structures in the membrane which cause the membrane to burst. Haemolysis of erythrocytes is an example of this phenomenon, which is a property of certain, but not all, saponins.
- Saponins are known as adjuvants in vaccines for systemic administration.
- the adjuvant and haemolytic activity of individual saponins has been extensively studied in the art (Lacaille-Dubois and Wagner, supra).
- Quil A derived from the bark of the South American tree Quillaja Saponaria Molina
- Serrev TherDrug Carrier Syst 1996, 12 (l-2):l-55
- EP 0 362 279 Bl are known as adjuvants in vaccines for systemic administration.
- IDS Immune Stimulating Complexes
- Quil A fractions of Quil A are haemolytic and have been used in the manufacture of vaccines (Morein, B., EP 0 109 942 Bl; WO 96/11711; WO 96/33739).
- the haemolytic saponins QS21 and QS17 HPLC purified fractions of Quil A have been described as potent systemic adjuvants, and the method of their production is disclosed in US Patent No.5,057,540 and EP 0 362 279 Bl.
- Other saponins which have been used in systemic vaccination studies include those derived from other plant species such as Gypsophila and Saponaria (Bomford et al., Vaccine, 10(9):572-577, 1992).
- An enhanced system involves the combination of a non-toxic lipid A derivative and a saponin derivative particularly the combination of QS21 and 3D-MPL as disclosed in WO 94/00153, or a less reactogenic composition where the QS21 is quenched with cholesterol as disclosed in WO 96/33739.
- the adjuvant is a particularly potent adjuvant formulation involving QS21 and 3D-MPL in an oil in water emulsion is described in WO 95/17210.
- composition adjuvanted with detoxified lipid A or a non-toxic derivative of lipid A more preferably adjuvanted with a monophosphoryl lipid A or derivative thereof.
- composition additionally comprises a saponin, more preferably QS21.
- the adjuvant formulation additionally comprises an oil in water emulsion.
- the present invention also provides a method for producing a vaccine formulation comprising mixing a VLP present invention together with a pharmaceutically acceptable excipient, such as 3D-MPL.
- Additional components that are preferably present in an adjuvanted composition according to the invention include non-ionic detergents such as the octoxynols and polyoxyethylene esters as described herein, particularly t-octylphenoxy polyethoxyethanol (Triton X-100) and polyoxyethylene sorbitan monooleate (Tween 80); and bile salts or cholic acid derivatives as described herein, in particular sodium deoxycholate or taurodeoxycholate.
- the adjuvant formulation comprises 3D-MPL, Triton X-100, Tween 80 and sodium deoxycholate, which may be combined with an HPV VLP to provide a suitable vaccine.
- the composition comprises a vesicular adjuvant formulation comprising cholesterol, a saponin and an LPS derivative.
- the adjuvant formulation can comprise a unilamellar vesicle comprising cholesterol, having a lipid bilayer suitably comprising dioleoyl phosphatidyl choline, wherein the saponin and the LPS derivative are associated with, or embedded within, the lipid bilayer.
- these adjuvant formulations comprise QS21 as the saponin, and 3D-MPL as the LPS derivative, wherein the ratio of QS21 :cholesterol is from 1 :1 to 1 :100 weight/weight, and most preferably 1 :5 weight/weight.
- Such adjuvant formulations are described in EP 0 822 831 B, the disclosure of which is incorporated herein by reference.
- compositions of the invention are used in combination with aluminium, and are suitably adsorbed or partially adsorbed onto aluminium adjuvants.
- the adjuvant is an aluminium salt, which in one aspect is in combination with 3D MPL, such as aluminium phosphate and 3D MPL.
- the adjuvant is aluminium hydroxide, optionally in combination with 3D MPL.
- composition is the combination of VLPs with an aluminium salt or with an aluminium salt + 3D MPL.
- aluminium salt is aluminium hydroxide.
- the composition of the invention may also comprise aluminium or an aluminium compound as a stabiliser.
- the present invention generally relates to combinations of VLPs.
- the essential component of the VLP is an LI protein.
- LI proteins associate to form pentamers (capsomers) which then tessellate (assemble) to form VLPs.
- the present invention relates also to immunogenic compositions as described above comprising LI proteins, or capsomers comprising LI proteins, in the place of VLPs as described herein.
- the LI proteins are capable of stimulating a protective immune response.
- the LI proteins are conformationally correct.
- the invention thus also relates to the use of functional LI derivatives as described above, such as LI truncates, deletion, substitution or insertion mutants, and fusion proteins, suitably those which are capable of provoking an immune response capable of recognising an HPV virus.
- Capsomers comprising such proteins are also included in the present invention.
- Capsomers as immunogenic agents are described in, for example, WO0204007.
- WO9901557 also discloses HPV capsomer containing compositions. LI proteins, derivatives and capsomers may be used in the same way as described for VLPs above.
- an immunogenic composition comprising an LI protein, or functional derivative thereof, from HPV 16 and 18 and at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31, 45 and 52, wherein the dose of the LI protein, or derivative thereof, of the at least one other cancer type is reduced relative to that of HPV 16 or 18.
- the invention can be seen to relate to an immunogenic composition
- an immunogenic composition comprising an HPV capsomer from HPV 16 and 18 and at least one other HPV cancer type, the other cancer type being selected from the list consisting of HPV types 31, 45 and 52, wherein the dose of the capsomer of the at least one other cancer type is reduced relative to that of HPV 16 or 18.
- the invention relates to an immunogenic composition as discussed above in combination with a pharmaceutically acceptable excipient. Suitable excipients are well known in the art and include buffers and water, for example.
- compositions and vaccines of the invention may be provided and delivered by any of a variety of routes such as oral, topical, subcutaneous, mucosal (typically intravaginal), intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository.
- routes such as oral, topical, subcutaneous, mucosal (typically intravaginal), intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository.
- composition or vaccine may be formulated or co- administered with an HPV early antigen, for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7 and E8.
- an HPV early antigen for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7 and E8.
- composition or vaccine may also be formulated or co-administered with non-HPV antigens.
- these non-HPV antigens can provide protection against other diseases, most preferably sexually transmitted diseases such as herpes simplex virus, EBV, chlamydia and HIV.
- the composition or vaccine comprises gD or a truncate thereof from HSV, suitably a C terminal truncate from HSV-2 known as gD2t. In this way the composition or vaccine provides protection against both HPV and HSV.
- each vaccine dose comprises 1-100 ⁇ g of each VLP, in one aspect 5-80 ⁇ g, in a further aspect 5- 30 ⁇ g each VLP, in a further aspect 5-20 ⁇ g of each VLP with yet further aspects being specifically 5 ⁇ g, 6 ⁇ g, lO ⁇ g, 15 ⁇ g or 20 ⁇ g.
- Doses suitable for use in humans typically include 20- 40 ⁇ g of HPV 16 and HPV 18 VLPs, with reduced doses of the other HPV cancer types (31, 45, 52) as described herein, suitably at a level of less than 20 ⁇ g per VLP, suitably at a level that is able to provoke a protective immune response in at least some vaccinated individuals.
- compositions suitable for use in humans may comprise lower quantities of HPV 16 and/or 18, provided such doses are protective in humans as can be assessed using trials outlined herein. Such doses may be appropriate where the VLPs of the invention are combined with strong adjuvants, for example.
- composition of the invention comprises 20 ⁇ g of HPV 16, 20 ⁇ g of HPV 18 and between 5 - 18 ⁇ g of each VLP from the other cancer type (31, 45 or 52), for example 5- 15 ⁇ g, and in a further aspect specifically 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 ⁇ g of VLP from each non HPV 16/18 cancer type.
- composition of the invention comprises 10-15 ⁇ g of HPV 16, 10-15 ⁇ g of HPV 18 and between 5 - 9 ⁇ g of each VLP from the other cancer type (31, 45 or 52), and in one aspect specifically 5, 6, 7, 8 or 9 ⁇ g of VLP from each non HPV 16/18 cancer type.
- the ratio by weight of HPV 16 VLP to other cancer type (31, 45 or 52) VLP is in the range of 1 : 0.9 - 1 : 0.1 (HPV 16: other type), suitably in the range of 1 : 0.9 - 1:0.3, suitably 1: 0.8 - 1: 0.4.
- the ratio by weight of HPV 18 VLP to other cancer type (31, 45 or 52) VLP is from 1 : 0.9 - 1 : 0.1, (HPV 18: other type), suitably in the range of 1 : 0.9 - 1:0.3, suitably 1: 0.8 - 1: 0.4.
- a reduced dose is suitably 10 - 90 % of the dose of HPV 16 or HPV 18 VLPs, and in one aspect is 20 - 80 % of the dose of HPV 16 or HPV 18 VLPs, in a further aspect 30 - 70%, in a yet further aspect 30 - 60%, and specifically 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% of the HPV 16 or HPV 18 dose.
- composition is suitably used to prevent one or more of: HPV- 16 and or HPV- 18 infection, persistent HPV- 16 and/or HPV- 18 infection and HPV- 16 and or HPV- 18 associated cervical neoplasia.
- the use of the immunogenic composition of the invention is used to prevent cervical neoplasia and/or incident infection and/or persistent infection associated with infection by other (non HPV 16, 18) oncogenic types.
- the immunogenic composition of the invention is used in the active immunization of adults and adolescent females from the age of 10 years onwards.
- the composition or vaccine is suitably used for the vaccination of adolescent girls aged 10-15, preferably 10-13 years.
- the composition or vaccine may also be administered to older adult women following an abnormal pap smear or after surgery following removal of a lesion caused by HPV, or who are seronegative and DNA negative for HPV cancer types.
- Females of 10 - 55 years are another suitable target group.
- the vaccine may be used in girls and women of all ages, from infants upwards, and in a further aspect may be given to boys or men.
- the vaccine may be used therapeutically in women who are seropositive for the HPV virus.
- composition of the invention is used to prevent or treat cervical cancer, or CIN 1, CI II or CIN III disease states caused by HPV infection.
- the vaccine is delivered in a 2 or 3 dose regime, for example in a 0, 1 month regime or a 0, 2 month regime, or a 0, 2, 6 month regime or a 0,1 and 6 month regime respectively.
- the vaccination regime incorporates a booster injection after 3 to 10 years, or 5 - 10 years, such as preferably 3, 4, 5, 6, 7, ,8, 9 or 10 years.
- the composition or vaccine of the invention is a liquid vaccine formulation, although the vaccine may be lyophilised and reconstituted prior to administration. Topical formulations such as intravaginal creams may also be used, for example.
- compositions and vaccines of the invention comprise certain HPV components as laid out above.
- the vaccine consists essentially of, or consists of, said components.
- the present invention is hereby illustrated by reference to the following non-limiting examples relating to the cross protection by HPV 16 and HPV 18 VLPs, and showing production of HPV VLPs:
- the women at enrolment were: 1) seronegative for HPV- 16 and HPV-18; 2) negative for high risk HPV infection of the cervix (detected by HPV PCR); 3) had 6 or fewer lifetime sexual partners and 4) had normal PAP smears.
- the mixture comprised, per 0.5 ml dose, 20 ⁇ g of HPV- 16 LI VLP, 20 ⁇ g of HPV- 18 LI VLP and was adjuvanted with 500 ⁇ g of aluminum hydroxide and 50 ⁇ g of 3D MPL.
- the placebo group was injected with 500 ⁇ g of aluminum hydroxide alone.
- V.E. The vaccine efficacy (V.E.) against high risk cancer HPV types was assessed, wherein the V.E. is the % improvement in protection against infection by the vaccine compared to a placebo group.
- Cross protection was assessed by detecting the presence of nucleic acid specific for various oncogenic types in the vaccinees and control group. Detection was carried out using techniques as described in WO03014402, and references therein, particularly for non-specific amplification of HPV DNA and subsequent detection of DNA types using a LiPA system as described in WO 99/14377, and in Kleter et al, [Journal of Clinical Microbiology (1999), 37 (8): 2508-2517], the whole contents of which are herein incorporated by reference.
- Any suitable method can, however, be used for the detection of HPV DNA in a sample, such as type specific PCR using primers specific for each HPV type of interest.
- Suitable primers are known to the skilled person, or can be easily constructed given that the sequences of the oncogenic HPV types are known.
- Vaccine efficacy was assessed against infections for all of the 12 high risk cancer types, HPV- 16 phylogenetic-related types (the groups of; 31, 35, and 58; 31, 33, 35, 52 and 58) and HPV-18 phylogenetic related types (45 and 59).
- Tables 2 and 3 relate to the "ATP" (According To Protocol) group for those patients who complied with all the criteria of the trial.
- Table 2 is a midpoint analysis with data taken from all patients at the timepoint at which at least 50% of the cohort were 18 months after their first vaccination.
- Table 3 gives the final results, all data being from subjects at 18 months post first vaccination (month 0).
- In the ATP group all patients received 3 doses of vaccine at 0, 1 and 6 months and were seronegative at 6 months.
- Table 2 demonstrates that HPV 16 and HPV 18 provide statistically significant cross protection against the group of high risk cancer types 31,33,35,39,45,51,52,56,58,59, 66 and 68.
- Table 3 demonstrates that, except for the HPV-18 related types (which show a very strong trend), there is statistically significant cross-protection against the groups of: HPV 31, 35, 58; HPV 31, 33, 35, 52, 58; and the 12 high risk (non HPV-16/18) types evaluated.
- Example 3 Data presented in Example 3 provides further data obtained in the same study, and focuses on cross protection provided against certain specific types. Table 1
- Table 2 vaccine efficacy after three doses in preventing incident heterologous infections.
- Table 2 Vaccine efficacy against infection with HPV- 16 phylogenetically related types, HPV-18 phylogenetically related types, HPV- 16 and/or HPV-18 phylogenetically related types and all high-risk types exclusive of HPV- 16 and HPV-18 - ATP cohort (month 6-18)
- HPV-16 and/or HPV-18 related HPV-16 and/or HPV-18 phylogenetically related types 35, 31, 58, 45, 59 without considering other HPV types
- HPV 16 and HPV 18 VLPs may be produced in the following manner:
- HPV 16 and HPV 18 LI VLPs are detailed herein. LI proteins from other HPV genotypes may be readily produced by similar methods, already known in the art.
- HPV 16 and HPV 18 VLPs were carried out using standard protocols - for example, see WO9913056.
- HPV 16/18 proteins were expressed in Trichoplusia ni (High FiveTM) cells (at a density of- 350000 cells/ml) infected with recombinant Baculovirus (MOI of 0.3) encoding the HPV 16 or 18 LI gene of interest. Cells were harvested approximately 72 hours post infection.
- the antigen (Ll-16/18) was extracted from Hi5 cells in a three step process of concentration, extraction, clarification.
- the concentration step removes up to 90% of the culture medium, and was performed by tangential flow filtration.
- the extraction step was performed with a hypotonic buffer (Tris 20mM, pH 8.5). A volume equal to the culture volume was used to perform the extraction. A contact time of minimum half an hour under smooth agitation was used.
- the clarification was performed by tangential flow filtration.
- the purification process was carried out at room temperature, ⁇ -mercaptoethanol (4% w/w) was added to the extract in order to disassemble the VLP's into capsomers, for both antigens, Ll-16/18. Glycerol was added up to a concentration of w/w 10% just prior to the addition of ⁇ -mercaptoethanol.
- the clarified extract (protein at a concentration of ⁇ 1 g/ml, with the LI protein at ⁇ 150 mg/ml) is applied to an anion exchange column (Di Methyl Amino Ethyl). Elution is performed with (Tris 20mM
- the eluate of the first step is diluted with 1 volume of H 2 O/BME 4%.
- the diluted eluate is then applied to a second anion exchange column (Tri Methyl Amino Ethyl). Elution is performed with (20mM Tris
- the antigen is eluted in approximately 4 column volumes and the elution profile is monitored at 280 nm.
- the eluate of the TMAE step is applied to a hydroxyapatite (HA) column.
- HA hydroxyapatite
- the HA eluate is diluted in order to reach the following conditions: (NaH 2 PO 4 25mM I NaCl lOmM 14%BME) buffer, pH 7.5 ⁇ 0.2 .
- the ultrafiltration is performed with a tangential flow ultrafiltration system equipped with polyethersulfone membranes (Centramate cassette 0.1 m 2 , lOOkD).
- the Planova eluate is treated to reach the following conditions: (NaH 2 PO 4 lOOmM
- the ultrafiltration permeate is applied to an Octyl Sepharose column.
- This chromatography step is run in the negative mode with approximately 5 column volumes of (Na 3 PO 4 20mM
- the purified LI -18 antigen solution is sterilised by filtration on a 0.22 ⁇ m membrane.
- the clarified extract is applied to an anion exchange column (Di Methyl Amino Ethyl). Elution is performed with (Tris 20mM
- the eluate of the first step is diluted with 1 volume of H O/BME 4%.
- the diluted eluate is then applied to a second anion exchange column (Tri Methyl Amino Ethyl). Elution is performed with (20mM Tris
- the antigen is eluted in approximately 5 column volumes and the elution profile is monitored at 280 nm.
- the eluate of the TMAE step is applied to a HA column.
- the HA eluate is diluted in order to reach the following conditions: (NaH 2 PO 4 25mM I NaCl lOmM 14%BME) buffer, pH 7.5 ⁇ 0.2 .
- the ultrafiltration is performed with a tangential flow ultrafiltration system equipped with polyethersulfone membranes (Centramate cassette 0.1 m 2 , lOOkD).
- the Planova eluate is treated to reach the following conditions: (NaH PO 4 lOOmM
- the ultrafiltration eluate is adjusted to the conductivity of the equilibrium buffer, (Na 3 PO 4 20mM
- Elution is performed with (NaH 2 PO 4 20mM
- the antigen is eluted in approximately 3 column volumes and the elution profile is monitored at 280 nm.
- the purified Ll-16 antigen solution is sterilised by filtration on a 0.22 ⁇ m membrane.
- Each VLP type is adsorbed independently to produce a concentrated adsorbed monovalent.
- VLPs from HPV 16 60 ⁇ g are adsorbed on 150 ⁇ g Al 3+ from Al(OH) 3 , at a pH of 6.0 ⁇ 0.2, for one hour at room temperature with gentle stirring. This concentrated adsorbed monovalent is stored at +4°C. Adsorption is checked by centrifuging the preparation and quantifying VLPs in the supernatant.
- VLP 18 concentrated adsorbed monovalent 60 ⁇ g of purified VLPs from HPV 18 are adsorbed on 150 ⁇ g Al 3+ from Al(OH) 3 , at a pH of 6.0 ⁇ 0.2, for one hour at room temperature with gentle stirring. This concentrated adsorbed monovalent is stored at +4°C. Adsorption is checked by centrifuging the preparation and quantifying VLPs in the supernatant.
- Concentrated adsorbed monovalents prepared by the above method may be combined to form a suspension containing 20 ⁇ g each VLP per dose.
- Final vaccine is stored at +4°C.
- VLPs from other cancer types may be added as appropriate, at suitable concentration in accordance with the invention. Sequences of such types are well known in the art and VLPs comprising such proteins can be readily expressed by the skilled person.
- the combined adsorbed bulks, or individual adsorbed bulks may be further mixed with adjuvants such as 3D-MPL.
- the mixture comprised, per 0.5 ml dose, 20 ⁇ g of HPV-16 LI VLP, 20 ⁇ g of HPV-18 LI VLP and was adjuvanted with 500 ⁇ g of aluminum hydroxide and 50 ⁇ g of 3D MPL.
- the placebo group was injected with 500 ⁇ g of aluminum hydroxide alone.
- the HPV 16 VLPs are comprised of a 471 amino acid, C terminally truncated HPV LI protein, with a deletion of 34 amino acids.
- the HPV 18 VLPs are comprised of a C terminally truncated 472 amino acid HPV LI protein, with a deletion of 35 amino acids.
- V.E. The vaccine efficacy (V.E.) against certain cancer HPV types was assessed, wherein the V.E. is the % improvement in protection against infection by the vaccine compared to a placebo group.
- Cross protection was assessed by detecting the presence of nucleic acid specific for various oncogenic types in the vaccinees and control group. Detection was carried out using techniques as described in WO03014402, and references therein, particularly for non-specific amplification of HPV DNA and subsequent detection of DNA types using a LiPA system as described in WO 99/14377, and in Kleter et al, [Journal of Clinical Microbiology (1999), 37 (8): 2508-2517], the whole contents of which are herein specifically incorporated by reference. Any suitable method can, however, be used for the detection of HPV DNA in a sample, such as type specific PCR using primers specific for each HPV type of interest. Suitable primers are known to the skilled person, or can be easily constructed given that the sequences of the oncogenic HPV types are known.
- the primary objective of this study was to assess vaccine efficacy in the prevention of infection with HPV-16, HPV-18, or both (HPV-16/18), between months 6 and 18 in participants who were initially shown to be seronegative for HPV-16/18 by ELISA and negative for HPV-16/18 DNA by PCR.
- Women eligible for the initial phase included healthy women aged 15-25 years, who had had no more than six sexual partners, no history of an abnormal Pap test or ablative or excisional treatment of the cervix, and no ongoing treatment for external condylomata; and who were cytologically negative, seronegative for HPV-16 and HPV- 18 antibodies by ELISA, and HPV-DNA-nega ive by PCR for 14 high-risk HPV types (16, 18, 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68) no more than 90 days before study entry.
- Each dose of the bivalent HPV-16/18 virus-like particle vaccine contained 20 ⁇ g of HPV-16 LI virus-like particle and 20 ⁇ g of HPV-18 LI virus-like particle.
- Each type of virus-like particle was produced on Spodoptera frugiperda Sf-9 and Trichoplusia ni Hi-5 cell substrate with AS04 adjuvant containing 500 ⁇ g aluminum hydroxide and 50 ⁇ g 3-deacylated monophosphoryl lipid A (MPL, Corixa, Montana, USA) provided in a monodose vial.
- the placebo contained 500 g of aluminum hydroxide per dose, and was identical in appearance to the HPV-16/18 vaccine. Every study participant received a 0-5 mL dose of vaccine or placebo at 0 months, 1 month, and 6 months.
- Protocol guidelines recommended colposcopy after two reports of ASCUS, or one report of atypical glandular cells of undetermined significance, LSIL or HSIL, squamous cell carcinoma, adenocarcinoma in situ, or adenocarcinoma. These guidelines also recommended biopsy for any suspected lesions.
- the central histology laboratory made an initial diagnosis from the formalin-fixed tissue specimens for clinical management.
- a panel of three pathologists made a subsequent consensus diagnosis for HPV-16 and HPV-18 associated lesions with the CLN system. This consensus diagnosis also included review of the sections taken at the time of microdissection for PCR detection of lesional HPV DNA.
- HPV DNA isolated from the cytology specimen (MagNaPure Total Nucleic Acid system, Roche Diagnostics, Almere, Netherlands) and from the cervical biopsy specimen (proteinase K extraction) was amplified from an aliquot of purified total DNA with the SPF10 broad-spectrum primers that amplify a 65 bp region of the LI gene.[ B Kleter, LJ van Doom, J ter Schegget et al, Novel short- fragment PCR assay for highly sensitive broad-spectrum detection of anogenital human papillomaviruses. Am JPathol 153 (1998), pp.
- a line probe assay (LiPA Kit HPV INNO LiPA HPV genotyping assay, SPF-10 system version 1, Inno genetics, Gent, Belgium, manufactured by Labo Bio-medical Products, Rijswijk, Netherlands) detected 25 HPV genotypes (6, 11, 16, 18, 31, 33, 34, 35, 39, 40, 42, 43, 44, 45, 51, 52, 53, 56, 58, 59, 66, 68, 70, and 74).
- HPV-DNA test results were concealed from investigators during the study and cytological and histological diagnoses were only revealed for clinical management purposes. Analyses included HPV-16/18 DNA results for cervical specimens and combined cervical and self-obtained cervicovaginal specimens.
- Stratified, block randomisation according to validated algorithms was centralised with an internet randomisation system. Stratification was according to age (15-17, 18-21, and 22-25 years) and region (North America and Brazil). Each vaccine dose was attributed a randomly chosen number based on specific participant information entered into the computerised randomisation system by study personnel. Treatment allocation remains concealed from investigators and the women participating in a long-term follow-up study.
- the intention-to-treat and according-to-protocol cohorts are shown in the figure, in which the reasons for exclusion from analyses are listed in rank order; women who met more than one exclusion criterion were only counted once according to the highest ranking criterion.
- the cohort for safety analysis included all enrolled women who received at least one dose of vaccine or placebo and complied with specified, minimal protocol requirements (see figure below:). Immunogenicity was assessed in a subset of the according-to-protocol safety cohort, which included women with serology results at months 0, 7, and 18, who received all three doses of study vaccine or placebo according to schedule, complied with the blood sampling schedule, and did not become positive for HPV-16/18-DNA during the trial. Seropositivity rates between the vaccine and placebo groups were compared with Fisher's exact test (pO OOl judged significant). Geometric mean titres were compared with ANOVA and Kruskal-Wallis test.
- N number of subjects in specific cohort
- % Vaccine efficacy is 1 - (A B) x 100, adjusted for relative size of vaccine and placebo group, wherein
- A % women in vaccine group with incident infection, persistent infection or cytological abnormality, as approp ⁇ ate for the table
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Virology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Communicable Diseases (AREA)
- Mycology (AREA)
- Dermatology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (63)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HRP20120930TT HRP20120930T1 (hr) | 2004-06-16 | 2005-06-14 | Cjepivo protiv hpv16 i hpv18 i još najmanje jednog tipa hpv, kojeg se bira između hpv31, 45 ili 52 |
| SI200531633T SI1758609T1 (sl) | 2004-06-16 | 2005-06-14 | Cepivo proti HPV16 in HPV18 in vsaj še enemu tipu HPV, izbranemu izmed HPV 31, 45 ali 52 |
| EP05757953A EP1758609B1 (en) | 2004-06-16 | 2005-06-14 | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 |
| ES05757953T ES2394448T3 (es) | 2004-06-16 | 2005-06-14 | Vacuna contra VPH16 yVPH18 y al menos otro tipo de VPH seleccionado de entre VPH 31, 45 o 52 |
| PL05757953T PL1758609T3 (pl) | 2004-06-16 | 2005-06-14 | Szczepionka przeciw HPV16 i HPV18 oraz co najmniej jednemu HPV innego typu wybranemu spośród HPV 31, 45 lub 52 |
| JP2007515878A JP2008502633A (ja) | 2004-06-16 | 2005-06-14 | Hpv16およびhpv18ならびにhpv31、45または52から選ばれる少なくとも1つの別のhpv型に対するワクチン |
| BRPI0512042A BRPI0512042B8 (pt) | 2004-06-16 | 2005-06-14 | composição imunogênica, vacina, uso de uma composição ou vacina, método para produzir uma composição imunogênica, e, uso de vlps ou capsômeros de hpv 16 e 18 com vlps ou capsômeros de pelo menos um outro hpv do tipo causador de câncer |
| CA2566620A CA2566620C (en) | 2004-06-16 | 2005-06-14 | Vaccine against hpv16 and hpv18 and at least another hpv type slected from hpv 31, 45 or 52 |
| CN2005800195155A CN1976718B (zh) | 2004-06-16 | 2005-06-14 | 抗hpv16和hpv18和至少一种另外的选自hpv31、45或52的hpv类型的疫苗 |
| AU2005253723A AU2005253723B2 (en) | 2004-06-16 | 2005-06-14 | Vaccine against HPV16 and HPV18 and at least another HPV type selected from HPV 31, 45 or 52 |
| DK05757953.4T DK1758609T3 (da) | 2004-06-16 | 2005-06-14 | Vaccine mod HPV 16 og HPV 18 og mindst en anden HPV-type udvalgt blandt HPV 31, 45 eller 52 |
| KR1020127027786A KR101359943B1 (ko) | 2004-06-16 | 2005-06-14 | Hpv 16과 hpv 18 및 적어도 hpv 31, 45 또는 52로부터 선택된 또 다른 hpv 유형에 대한 백신 |
| US11/570,603 US7758866B2 (en) | 2004-06-16 | 2005-06-14 | Vaccine against HPV16 and HPV18 and at least another HPV type selected from HPV 31, 45 or 52 |
| MXPA06014515A MXPA06014515A (es) | 2004-06-16 | 2005-06-14 | Vacuna contra vph16 y vph18 y al menos otro tipo de vph seleccionado de vph 31, 45 o 52. |
| EP06724609A EP1877086A2 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| KR1020077027492A KR20080005583A (ko) | 2005-04-26 | 2006-04-24 | 백신 |
| KR1020077027497A KR20080005585A (ko) | 2005-04-26 | 2006-04-24 | 백신 |
| CA002606206A CA2606206A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| AU2006239471A AU2006239471A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| EA200702079A EA013326B1 (ru) | 2005-04-26 | 2006-04-24 | Вакцина |
| US11/912,687 US20090181052A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| JP2008508138A JP2008539182A (ja) | 2005-04-26 | 2006-04-24 | ワクチン |
| PE2006000425A PE20061434A1 (es) | 2005-04-26 | 2006-04-24 | Vacuna multivalente de vph |
| PCT/EP2006/003918 WO2006114312A2 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| AU2006239422A AU2006239422A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| EA200702077A EA013325B1 (ru) | 2005-04-26 | 2006-04-24 | Вакцина |
| EP06753410A EP1879614A2 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| SG201000794-6A SG159525A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| TW095114574A TW200716169A (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| TW095114585A TW200716170A (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| MX2007013472A MX2007013472A (es) | 2005-04-26 | 2006-04-24 | Vacuna. |
| BRPI0610032-5A BRPI0610032A2 (pt) | 2005-04-26 | 2006-04-24 | uso de uma proteìna l1 do papilomavìrus humano ou fragmento imunogêico da mesma de um primeiro tipo de hpv, programa de vacinação para proteção contra a infecção e/ou doença por hiv, método para prevenção da infecção e/ou doença por hpv, composição de vacina, e, kit |
| BRPI0610396-0A BRPI0610396A2 (pt) | 2005-04-26 | 2006-04-24 | vacina de hpv multivalente, métodos para proteger um paciente contra a infecção, para prevenir ou reduzir a freqüênca de anormalidades citológicas em um paciente, para prevenir a formação de lesões cin histologicamente confirmadas e para fabricar a vacina, e, usos de uma composição, de uma vacina e de uma composição de vacina |
| MX2007013475A MX2007013475A (es) | 2005-04-26 | 2006-04-24 | Vacuna. |
| PCT/EP2006/003809 WO2006114273A2 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| AR20060101619A AR054259A1 (es) | 2005-04-26 | 2006-04-24 | Vacuna contra virus de papiloma humano (hpv) |
| PE2006000426A PE20061320A1 (es) | 2005-04-26 | 2006-04-24 | Vacuna contra virus de papiloma humano (hpv) |
| CA002606092A CA2606092A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| ARP060101618A AR053715A1 (es) | 2005-04-26 | 2006-04-24 | Vacuna multivalente de vph |
| SG201000826-6A SG159529A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
| JP2008508156A JP2008539184A (ja) | 2005-04-26 | 2006-04-24 | ワクチン |
| UY29499A UY29499A1 (es) | 2005-04-26 | 2006-04-26 | Vacunas multivalentes del papilomavirus humano (vph) |
| IL179138A IL179138A0 (en) | 2004-06-16 | 2006-11-09 | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31,45, or 52 |
| NO20070195A NO20070195L (no) | 2004-06-16 | 2007-01-11 | Vaksine mot HPV16 og HPV18 og minst en annen HPV-type valgt fra HPV31, 45 eller 52 |
| IL186591A IL186591A0 (en) | 2005-04-26 | 2007-10-11 | Vaccine |
| IL186586A IL186586A0 (en) | 2005-04-26 | 2007-10-11 | Vaccine |
| NO20075194A NO20075194L (no) | 2005-04-26 | 2007-10-11 | vaksine |
| NO20075185A NO20075185L (no) | 2005-04-26 | 2007-10-11 | Vaksine |
| MA30331A MA29679B1 (fr) | 2005-04-26 | 2007-10-29 | Vaccin |
| MA30332A MA29680B1 (fr) | 2005-04-26 | 2007-10-29 | Vaccin |
| NL300771C NL300771I2 (enExample) | 2004-06-16 | 2015-11-30 | |
| NL300774C NL300774I2 (enExample) | 2004-06-16 | 2015-11-30 | |
| NL300773C NL300773I2 (enExample) | 2004-06-16 | 2015-11-30 | |
| FR15C0080C FR15C0080I2 (fr) | 2004-06-16 | 2015-12-04 | Vaccin contre les virus hpv16 et hpv18 et au moins un autre type de hpv selectionne parmi hpv 31, 45 ou 52 |
| FR15C0082C FR15C0082I2 (fr) | 2004-06-16 | 2015-12-04 | Vaccin contre les virus hpv16 et hpv18 et au moins un autre type de hpv selectionne parmi hpv 31, 45 ou 52 |
| FR15C0084C FR15C0084I2 (fr) | 2004-06-16 | 2015-12-04 | Vaccin contre les virus hpv16 et hpv18 et au moins un autre type de hpv selectionne parmi hpv 31, 45 ou 52 |
| LTPA2015046C LTC1758609I2 (lt) | 2004-06-16 | 2015-12-07 | Vakcina prieš HPV16 ir HPV18 ir mažiausiai vieną kitą HVP tipą, parinktą iš HVP 31,45 arba 52 |
| CY2015048C CY2015048I2 (el) | 2004-06-16 | 2015-12-07 | Εμβολιο εναντι hpv16 και hpv18 και τουλαχιστον ενος αλλου τυπου hpv ο οποιος επιλεγεται απο hpv 31,45 ή 52 |
| CY2015049C CY2015049I1 (el) | 2004-06-16 | 2015-12-07 | Εμβολιο εναντι hpv16 και hpv18 και τουλαχιστον ενος αλλου τυπου hpv ο οποιος επιλεγεται απο hpv 31,45 ή 52 |
| CY2015047C CY2015047I2 (el) | 2004-06-16 | 2015-12-07 | Εμβολιο εναντι hpv16 και hpv18 και τουλαχιστον ενος αλλου τυπου hpv ο οποιος επιλεγεται απο hpv 31,45 ή 52 |
| LU92900C LU92900I2 (fr) | 2004-06-16 | 2015-12-08 | Gardasil-9/vaccination contre les stéréotypes 16,18 et 31 nom de produit: hpv l1 vlps 16+18+31 |
| LU92899C LU92899I2 (fr) | 2004-06-16 | 2015-12-08 | Gardasil-9/vaccination contre les stéréotypes 16,18 et 31 nom de produit: hpv l1 vlps 16+18+31 |
| LU92898C LU92898I2 (fr) | 2004-06-16 | 2015-12-08 | Gardasil-9/vaccination contre les stéréotypes 16,18 et 31 nom de produit: hpv l1 vlps 16+18+31 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB0413510.9 | 2004-06-16 | ||
| GBGB0413510.9A GB0413510D0 (en) | 2004-06-16 | 2004-06-16 | Vaccine |
| US11/114,301 US20050287161A1 (en) | 2002-12-20 | 2005-04-26 | Vaccine |
| US11/114,301 | 2005-04-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2005123125A1 true WO2005123125A1 (en) | 2005-12-29 |
Family
ID=35160037
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2005/006461 Ceased WO2005123125A1 (en) | 2004-06-16 | 2005-06-14 | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 |
Country Status (18)
| Country | Link |
|---|---|
| EP (1) | EP1758609B1 (enExample) |
| JP (1) | JP2008502633A (enExample) |
| KR (1) | KR20070029254A (enExample) |
| AR (1) | AR049354A1 (enExample) |
| AU (1) | AU2005253723B2 (enExample) |
| BR (1) | BRPI0512042B8 (enExample) |
| CA (1) | CA2566620C (enExample) |
| FR (2) | FR15C0084I2 (enExample) |
| IL (1) | IL179138A0 (enExample) |
| LU (3) | LU92900I2 (enExample) |
| MA (1) | MA28692B1 (enExample) |
| MX (1) | MXPA06014515A (enExample) |
| NO (1) | NO20070195L (enExample) |
| PE (1) | PE20060434A1 (enExample) |
| PL (1) | PL1758609T3 (enExample) |
| RU (1) | RU2420313C2 (enExample) |
| SG (1) | SG153837A1 (enExample) |
| WO (1) | WO2005123125A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006114273A3 (en) * | 2005-04-26 | 2007-03-15 | Glaxosmithkline Biolog Sa | Vaccine |
| WO2010012780A1 (en) * | 2008-07-31 | 2010-02-04 | Glaxosmithkline Biologicals S.A. | Vaccine against hpv |
| EP2593548A4 (en) * | 2010-07-15 | 2013-11-27 | British Columbia Cancer Agency | COMPOSITION OF HUMAN PAPILLOMA VIRUS ANTIGEN E7 AND USES THEREOF |
| EP3269388A1 (en) | 2012-10-30 | 2018-01-17 | Pfizer Inc. | Recombinant particle based vaccines against human cytomegalovirus infection |
| US10882887B2 (en) | 2016-03-15 | 2021-01-05 | Instituteof Basic Medical Sciences, Chinese Academy Of Medical Sciences | Papillomavirus chimeric protein and application thereof |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX2011013566A (es) * | 2009-06-19 | 2012-06-28 | Eyegene Inc | Vacunas para cancer cervical. |
| AU2015335652B2 (en) * | 2014-10-24 | 2020-07-02 | Hpvvax, Llc. | Cancer and skin lesion treatment |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001097840A1 (en) * | 2000-06-21 | 2001-12-27 | Medimmune, Inc. | Chimeric human papillomavirus (hpv) l1 molecules and uses therefor |
| EP1410805A1 (en) * | 1999-09-07 | 2004-04-21 | GlaxoSmithKline Biologicals S.A. | Vaccine against HPV |
| WO2004056389A1 (en) * | 2002-12-20 | 2004-07-08 | Glaxosmithkline Biologicals Sa | Hpv-16 and -18 l1 vlp vaccine |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9921147D0 (en) * | 1999-09-07 | 1999-11-10 | Smithkline Beecham Biolog | Novel composition |
| GB0110431D0 (en) * | 2001-04-27 | 2001-06-20 | Glaxosmithkline Biolog Sa | Novel compounds |
| GB0206360D0 (en) * | 2002-03-18 | 2002-05-01 | Glaxosmithkline Biolog Sa | Viral antigens |
| GB0206359D0 (en) * | 2002-03-18 | 2002-05-01 | Glaxosmithkline Biolog Sa | Viral antigens |
-
2005
- 2005-06-14 PL PL05757953T patent/PL1758609T3/pl unknown
- 2005-06-14 RU RU2006143804/10A patent/RU2420313C2/ru active
- 2005-06-14 BR BRPI0512042A patent/BRPI0512042B8/pt not_active IP Right Cessation
- 2005-06-14 PE PE2005000677A patent/PE20060434A1/es not_active Application Discontinuation
- 2005-06-14 MX MXPA06014515A patent/MXPA06014515A/es active IP Right Grant
- 2005-06-14 AR ARP050102434A patent/AR049354A1/es not_active Application Discontinuation
- 2005-06-14 WO PCT/EP2005/006461 patent/WO2005123125A1/en not_active Ceased
- 2005-06-14 SG SG200904200-3A patent/SG153837A1/en unknown
- 2005-06-14 CA CA2566620A patent/CA2566620C/en not_active Expired - Lifetime
- 2005-06-14 KR KR1020077001065A patent/KR20070029254A/ko not_active Ceased
- 2005-06-14 JP JP2007515878A patent/JP2008502633A/ja active Pending
- 2005-06-14 EP EP05757953A patent/EP1758609B1/en not_active Expired - Lifetime
- 2005-06-14 AU AU2005253723A patent/AU2005253723B2/en active Active
-
2006
- 2006-11-09 IL IL179138A patent/IL179138A0/en unknown
- 2006-12-28 MA MA29576A patent/MA28692B1/fr unknown
-
2007
- 2007-01-11 NO NO20070195A patent/NO20070195L/no not_active Application Discontinuation
-
2015
- 2015-12-04 FR FR15C0084C patent/FR15C0084I2/fr active Active
- 2015-12-04 FR FR15C0082C patent/FR15C0082I2/fr active Active
- 2015-12-08 LU LU92900C patent/LU92900I2/xx unknown
- 2015-12-08 LU LU92899C patent/LU92899I2/xx unknown
- 2015-12-08 LU LU92898C patent/LU92898I2/xx unknown
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1410805A1 (en) * | 1999-09-07 | 2004-04-21 | GlaxoSmithKline Biologicals S.A. | Vaccine against HPV |
| WO2001097840A1 (en) * | 2000-06-21 | 2001-12-27 | Medimmune, Inc. | Chimeric human papillomavirus (hpv) l1 molecules and uses therefor |
| WO2004056389A1 (en) * | 2002-12-20 | 2004-07-08 | Glaxosmithkline Biologicals Sa | Hpv-16 and -18 l1 vlp vaccine |
Non-Patent Citations (6)
| Title |
|---|
| BILLICH A: "HPV VACCINE MEDIMMUNE/GLAXOSMITHKLINE", CURRENT OPINION IN INVESTIGATIONAL DRUGS, CURRENT DRUGS, LONDON, GB, vol. 4, no. 2, February 2003 (2003-02-01), pages 210 - 213, XP009029755, ISSN: 0967-8298 * |
| GIROGLOU T ET AL: "Immunological analyses of human papillomavirus capsids", VACCINE, BUTTERWORTH SCIENTIFIC. GUILDFORD, GB, vol. 19, no. 13-14, 2001, pages 1783 - 1793, XP002248440, ISSN: 0264-410X * |
| GLAXOSMITHKLINE HPV VACCINE STUDY GROUP HARPER D M ET AL: "Efficacy of a bivalent L1 virus-like particle vaccine in prevention of infection with human papillomavirus types 16 and 18 in young women: a randomised controlled trial", LANCET THE, LANCET LIMITED. LONDON, GB, vol. 364, no. 9447, 13 November 2004 (2004-11-13), pages 1757 - 1765, XP004746625, ISSN: 0140-6736 * |
| REINIS MILAN: "Technology evaluation: HPV vaccine (quadrivalent), Aventis Pasteur MSD/CSL.", CURRENT OPINION IN MOLECULAR THERAPEUTICS. APR 2004, vol. 6, no. 2, April 2004 (2004-04-01), pages 206 - 211, XP009056594, ISSN: 1464-8431 * |
| RODEN R B S ET AL: "ASSESSMENT OF THE SEROLOGICAL RELATEDNESS OF GENITAL HUMAN PAPILLOMAVIRUSES BY HEMAGGLUTINATION INHIBITION", JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 70, no. 5, May 1996 (1996-05-01), pages 3298 - 3301, XP002946729, ISSN: 0022-538X * |
| VILLA L L ET AL: "Prophylactic quadrivalent human papillomavirus (types 6, 11, 16, and 18) L1 virus-like particle vaccine in young women: a randomised double-blind placebo-controlled multicentre phase II efficacy trial", LANCET ONCOLOGY, LANCET PUBLISHING GROUP, LONDON, GB, vol. 6, no. 5, May 2005 (2005-05-01), pages 271 - 278, XP004870902, ISSN: 1470-2045 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006114273A3 (en) * | 2005-04-26 | 2007-03-15 | Glaxosmithkline Biolog Sa | Vaccine |
| JP2008539182A (ja) * | 2005-04-26 | 2008-11-13 | グラクソスミスクライン バイオロジカルズ ソシエテ アノニム | ワクチン |
| EA013325B1 (ru) * | 2005-04-26 | 2010-04-30 | Глаксосмитклайн Байолоджикалс С.А. | Вакцина |
| WO2010012780A1 (en) * | 2008-07-31 | 2010-02-04 | Glaxosmithkline Biologicals S.A. | Vaccine against hpv |
| EP2593548A4 (en) * | 2010-07-15 | 2013-11-27 | British Columbia Cancer Agency | COMPOSITION OF HUMAN PAPILLOMA VIRUS ANTIGEN E7 AND USES THEREOF |
| EP3269388A1 (en) | 2012-10-30 | 2018-01-17 | Pfizer Inc. | Recombinant particle based vaccines against human cytomegalovirus infection |
| US10882887B2 (en) | 2016-03-15 | 2021-01-05 | Instituteof Basic Medical Sciences, Chinese Academy Of Medical Sciences | Papillomavirus chimeric protein and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| BRPI0512042B1 (pt) | 2019-01-22 |
| KR20070029254A (ko) | 2007-03-13 |
| FR15C0082I2 (fr) | 2016-10-28 |
| EP1758609A1 (en) | 2007-03-07 |
| LU92898I2 (fr) | 2016-03-08 |
| SG153837A1 (en) | 2009-07-29 |
| BRPI0512042A (pt) | 2008-02-06 |
| IL179138A0 (en) | 2007-03-08 |
| AU2005253723A1 (en) | 2005-12-29 |
| LU92900I2 (fr) | 2016-03-08 |
| MXPA06014515A (es) | 2007-03-23 |
| NO20070195L (no) | 2007-01-15 |
| CA2566620A1 (en) | 2005-12-29 |
| JP2008502633A (ja) | 2008-01-31 |
| RU2006143804A (ru) | 2008-08-20 |
| BRPI0512042B8 (pt) | 2021-05-25 |
| AR049354A1 (es) | 2006-07-19 |
| RU2420313C2 (ru) | 2011-06-10 |
| FR15C0084I1 (enExample) | 2016-01-08 |
| LU92899I2 (fr) | 2016-03-08 |
| MA28692B1 (fr) | 2007-06-01 |
| FR15C0082I1 (fr) | 2016-01-08 |
| FR15C0084I2 (fr) | 2016-10-28 |
| PL1758609T3 (pl) | 2013-02-28 |
| EP1758609B1 (en) | 2012-10-03 |
| CA2566620C (en) | 2014-03-11 |
| PE20060434A1 (es) | 2006-06-08 |
| AU2005253723B2 (en) | 2011-01-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20050287161A1 (en) | Vaccine | |
| JP2012102132A (ja) | Hpv16およびhpv18ならびにhpv31、45または52から選ばれる少なくとも1つの別のhpv型に対するワクチン | |
| EP1758609B1 (en) | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 | |
| US20090181052A1 (en) | Vaccine | |
| US7758866B2 (en) | Vaccine against HPV16 and HPV18 and at least another HPV type selected from HPV 31, 45 or 52 | |
| US7858098B2 (en) | Vaccine | |
| CN100418577C (zh) | Hpv-16和hpv-18l1vlp疫苗 | |
| CN101217976A (zh) | 疫苗 | |
| EP1879614A2 (en) | Vaccine | |
| CN101217975A (zh) | 疫苗 | |
| BRPI0610032A2 (pt) | uso de uma proteìna l1 do papilomavìrus humano ou fragmento imunogêico da mesma de um primeiro tipo de hpv, programa de vacinação para proteção contra a infecção e/ou doença por hiv, método para prevenção da infecção e/ou doença por hpv, composição de vacina, e, kit | |
| BRPI0610396A2 (pt) | vacina de hpv multivalente, métodos para proteger um paciente contra a infecção, para prevenir ou reduzir a freqüênca de anormalidades citológicas em um paciente, para prevenir a formação de lesões cin histologicamente confirmadas e para fabricar a vacina, e, usos de uma composição, de uma vacina e de uma composição de vacina |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| DPEN | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed from 20040101) | ||
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 179138 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2566620 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3436/KOLNP/2006 Country of ref document: IN Ref document number: 2005253723 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 551693 Country of ref document: NZ Ref document number: 06120701 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006/10057 Country of ref document: ZA Ref document number: 200610057 Country of ref document: ZA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/014515 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11570603 Country of ref document: US Ref document number: 2007515878 Country of ref document: JP Ref document number: 200580019515.5 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12006502540 Country of ref document: PH |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2005253723 Country of ref document: AU Date of ref document: 20050614 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1200700020 Country of ref document: VN |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005253723 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005757953 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2007000025 Country of ref document: DZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020077001065 Country of ref document: KR Ref document number: 2006143804 Country of ref document: RU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005757953 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020077001065 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 11570603 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: PI0512042 Country of ref document: BR |