AU2006239471A1 - Vaccine - Google Patents
Vaccine Download PDFInfo
- Publication number
- AU2006239471A1 AU2006239471A1 AU2006239471A AU2006239471A AU2006239471A1 AU 2006239471 A1 AU2006239471 A1 AU 2006239471A1 AU 2006239471 A AU2006239471 A AU 2006239471A AU 2006239471 A AU2006239471 A AU 2006239471A AU 2006239471 A1 AU2006239471 A1 AU 2006239471A1
- Authority
- AU
- Australia
- Prior art keywords
- hpv
- vaccine
- protein
- type
- immunogenic fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 229960005486 vaccine Drugs 0.000 title claims description 210
- 239000012634 fragment Substances 0.000 claims description 70
- 108090000623 proteins and genes Proteins 0.000 claims description 69
- 102000004169 proteins and genes Human genes 0.000 claims description 69
- 230000002163 immunogen Effects 0.000 claims description 66
- 208000015181 infectious disease Diseases 0.000 claims description 48
- 239000000203 mixture Substances 0.000 claims description 39
- 238000000034 method Methods 0.000 claims description 38
- 231100000590 oncogenic Toxicity 0.000 claims description 28
- 230000002246 oncogenic effect Effects 0.000 claims description 28
- 230000002265 prevention Effects 0.000 claims description 27
- 239000002671 adjuvant Substances 0.000 claims description 26
- 230000005856 abnormality Effects 0.000 claims description 23
- 230000002380 cytological effect Effects 0.000 claims description 20
- 201000010099 disease Diseases 0.000 claims description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 20
- 239000003814 drug Substances 0.000 claims description 18
- 238000004519 manufacturing process Methods 0.000 claims description 15
- 239000002245 particle Substances 0.000 claims description 14
- 230000003902 lesion Effects 0.000 claims description 13
- 208000037581 Persistent Infection Diseases 0.000 claims description 12
- 101000641175 Human papillomavirus type 18 Major capsid protein L1 Proteins 0.000 claims description 11
- 241000700605 Viruses Species 0.000 claims description 10
- 238000002360 preparation method Methods 0.000 claims description 10
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical group [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims description 8
- 159000000013 aluminium salts Chemical group 0.000 claims description 6
- 229910000329 aluminium sulfate Inorganic materials 0.000 claims description 6
- 239000007764 o/w emulsion Substances 0.000 claims description 5
- 229960002566 papillomavirus vaccine Drugs 0.000 claims description 5
- 229910021502 aluminium hydroxide Inorganic materials 0.000 claims description 4
- 230000015572 biosynthetic process Effects 0.000 claims description 4
- 241000701806 Human papillomavirus Species 0.000 description 299
- 241000341655 Human papillomavirus type 16 Species 0.000 description 56
- 235000018102 proteins Nutrition 0.000 description 47
- 208000022361 Human papillomavirus infectious disease Diseases 0.000 description 39
- 238000004458 analytical method Methods 0.000 description 31
- 229940068196 placebo Drugs 0.000 description 24
- 239000000902 placebo Substances 0.000 description 24
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 18
- 208000009608 Papillomavirus Infections Diseases 0.000 description 17
- 150000007949 saponins Chemical class 0.000 description 17
- 229930182490 saponin Natural products 0.000 description 16
- 235000017709 saponins Nutrition 0.000 description 16
- 206010028980 Neoplasm Diseases 0.000 description 15
- 239000000427 antigen Substances 0.000 description 13
- 102000036639 antigens Human genes 0.000 description 13
- 108091007433 antigens Proteins 0.000 description 13
- 239000002158 endotoxin Substances 0.000 description 13
- 206010008342 Cervix carcinoma Diseases 0.000 description 12
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 12
- 201000011510 cancer Diseases 0.000 description 12
- 201000010881 cervical cancer Diseases 0.000 description 12
- 229920006008 lipopolysaccharide Polymers 0.000 description 12
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 10
- 238000009472 formulation Methods 0.000 description 10
- 238000001514 detection method Methods 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 230000002085 persistent effect Effects 0.000 description 9
- 208000032124 Squamous Intraepithelial Lesions Diseases 0.000 description 8
- 238000002255 vaccination Methods 0.000 description 8
- 206010008263 Cervical dysplasia Diseases 0.000 description 7
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 7
- 238000011282 treatment Methods 0.000 description 7
- 208000007879 Atypical Squamous Cells of the Cervix Diseases 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 230000002159 abnormal effect Effects 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 235000012000 cholesterol Nutrition 0.000 description 5
- 230000005847 immunogenicity Effects 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 241001631646 Papillomaviridae Species 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000009595 pap smear Methods 0.000 description 4
- 230000001681 protective effect Effects 0.000 description 4
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 4
- 238000000729 Fisher's exact test Methods 0.000 description 3
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 3
- 229910052782 aluminium Inorganic materials 0.000 description 3
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 3
- 239000004411 aluminium Substances 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 238000010241 blood sampling Methods 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- 210000003679 cervix uteri Anatomy 0.000 description 3
- 238000003745 diagnosis Methods 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 238000003205 genotyping method Methods 0.000 description 3
- 230000002949 hemolytic effect Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 230000000405 serological effect Effects 0.000 description 3
- 101150070189 CIN3 gene Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101150075239 L1 gene Proteins 0.000 description 2
- 239000000232 Lipid Bilayer Substances 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 101100281510 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) met-6 gene Proteins 0.000 description 2
- 238000002944 PCR assay Methods 0.000 description 2
- 229920004890 Triton X-100 Polymers 0.000 description 2
- 239000013504 Triton X-100 Substances 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000000090 biomarker Substances 0.000 description 2
- 239000010836 blood and blood product Substances 0.000 description 2
- 229940125691 blood product Drugs 0.000 description 2
- 208000019065 cervical carcinoma Diseases 0.000 description 2
- 101150005988 cin2 gene Proteins 0.000 description 2
- 238000002573 colposcopy Methods 0.000 description 2
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 2
- 229960003964 deoxycholic acid Drugs 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 230000008696 hypoxemic pulmonary vasoconstriction Effects 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000007726 management method Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- -1 polyoxyethylene Polymers 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 102220047090 rs6152 Human genes 0.000 description 2
- 230000001568 sexual effect Effects 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000012384 transportation and delivery Methods 0.000 description 2
- SNKAWJBJQDLSFF-NVKMUCNASA-N 1,2-dioleoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC SNKAWJBJQDLSFF-NVKMUCNASA-N 0.000 description 1
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 201000007490 Adenocarcinoma in Situ Diseases 0.000 description 1
- 206010059313 Anogenital warts Diseases 0.000 description 1
- 101150061050 CIN1 gene Proteins 0.000 description 1
- 241000606161 Chlamydia Species 0.000 description 1
- 208000000907 Condylomata Acuminata Diseases 0.000 description 1
- 241000759568 Corixa Species 0.000 description 1
- 101150071673 E6 gene Proteins 0.000 description 1
- 101150013359 E7 gene Proteins 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 241000305071 Enterobacterales Species 0.000 description 1
- 241001316290 Gypsophila Species 0.000 description 1
- 229940033278 HPV-16/18 vaccine Drugs 0.000 description 1
- 206010018910 Haemolysis Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 241000701828 Human papillomavirus type 11 Species 0.000 description 1
- 241000709701 Human poliovirus 1 Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 238000012313 Kruskal-Wallis test Methods 0.000 description 1
- 241001092142 Molina Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 241001454523 Quillaja saponaria Species 0.000 description 1
- 235000009001 Quillaja saponaria Nutrition 0.000 description 1
- 241000607149 Salmonella sp. Species 0.000 description 1
- 241000219287 Saponaria Species 0.000 description 1
- 208000019802 Sexually transmitted disease Diseases 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 241000255993 Trichoplusia ni Species 0.000 description 1
- 108010042365 Virus-Like Particle Vaccines Proteins 0.000 description 1
- 208000000260 Warts Diseases 0.000 description 1
- FHICGHSMIPIAPL-HDYAAECPSA-N [2-[3-[6-[3-[(5R,6aS,6bR,12aR)-10-[6-[2-[2-[4,5-dihydroxy-3-(3,4,5-trihydroxyoxan-2-yl)oxyoxan-2-yl]ethoxy]ethyl]-3,4,5-trihydroxyoxan-2-yl]oxy-5-hydroxy-2,2,6a,6b,9,9,12a-heptamethyl-1,3,4,5,6,6a,7,8,8a,10,11,12,13,14b-tetradecahydropicene-4a-carbonyl]peroxypropyl]-5-[[5-[8-[3,5-dihydroxy-4-(3,4,5-trihydroxyoxan-2-yl)oxyoxan-2-yl]octoxy]-3,4-dihydroxy-6-methyloxan-2-yl]methoxy]-3,4-dihydroxyoxan-2-yl]propoxymethyl]-5-hydroxy-3-[(6S)-6-hydroxy-2,6-dimethylocta-2,7-dienoyl]oxy-6-methyloxan-4-yl] (2E,6S)-6-hydroxy-2-(hydroxymethyl)-6-methylocta-2,7-dienoate Chemical compound C=C[C@@](C)(O)CCC=C(C)C(=O)OC1C(OC(=O)C(\CO)=C\CC[C@](C)(O)C=C)C(O)C(C)OC1COCCCC1C(O)C(O)C(OCC2C(C(O)C(OCCCCCCCCC3C(C(OC4C(C(O)C(O)CO4)O)C(O)CO3)O)C(C)O2)O)C(CCCOOC(=O)C23C(CC(C)(C)CC2)C=2[C@@]([C@]4(C)CCC5C(C)(C)C(OC6C(C(O)C(O)C(CCOCCC7C(C(O)C(O)CO7)OC7C(C(O)C(O)CO7)O)O6)O)CC[C@]5(C)C4CC=2)(C)C[C@H]3O)O1 FHICGHSMIPIAPL-HDYAAECPSA-N 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 150000001399 aluminium compounds Chemical class 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229940001007 aluminium phosphate Drugs 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 208000025009 anogenital human papillomavirus infection Diseases 0.000 description 1
- 201000004201 anogenital venereal wart Diseases 0.000 description 1
- 239000013011 aqueous formulation Substances 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 125000000837 carbohydrate group Chemical group 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical class C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 1
- 239000002812 cholic acid derivative Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 125000000600 disaccharide group Chemical group 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 238000011985 exploratory data analysis Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 230000008588 hemolysis Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000010562 histological examination Methods 0.000 description 1
- 208000021145 human papilloma virus infection Diseases 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 238000009802 hysterectomy Methods 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 239000003022 immunostimulating agent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000002356 laser light scattering Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 238000001325 log-rank test Methods 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 229940127554 medical product Drugs 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 238000001531 micro-dissection Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 238000013439 planning Methods 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000036555 skin type Effects 0.000 description 1
- 229940045946 sodium taurodeoxycholate Drugs 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 238000013517 stratification Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- AWDRATDZQPNJFN-VAYUFCLWSA-N taurodeoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCS(O)(=O)=O)C)[C@@]2(C)[C@@H](O)C1 AWDRATDZQPNJFN-VAYUFCLWSA-N 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 229940124931 vaccine adjuvant Drugs 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/80—Vaccine for a specifically defined cancer
- A61K2039/892—Reproductive system [uterus, ovaries, cervix, testes]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20023—Virus like particles [VLP]
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Communicable Diseases (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Description
WO 2006/114273 PCT/EP2006/003809 VACCINE Field of the Invention 5 The present invention relates to human papillomavirus (HPV) vaccines. Background of the Invention Papillomaviruses are small DNA tumour viruses, which are highly species specific. So far, over 100 individual human papillomavirus (HPV) genotypes have 10 been described. HPVs are generally specific either for the skin (e.g. HPV-1 and -2) or mucosal surfaces (e.g. HPV-6 and -11) and usually cause benign tumrnours (warts) that persist for several months or years. Such benign tumours may be distressing for the individuals concerned but tend not to be life threatening, with a few exceptions. Some HPVs are also associated with cancers, known as oncogenic HPV types. 15 The strongest positive association between an HPV and human cancer is that which exists between HPV-16 and HPV-18 and cervical carcinoma. Cervical cancer is the most common malignancy in developing countries, with about 500,000 new cases occurring in the world each year. Other HPV types which can cause cancer are types 31, 33, 35, 39, 45, 51, 52, 20 56, 58, 59, 66 and 68 (referred to as "oncogenic-HPV types"). Types 16 and 18 are those which have the highest association with cervical cancer. Types 31 and 45 are the types with the next highest association with a cancer risk (Munoz N, Bosch FX, de Sanjose S et al. International Agency for Research on Cancer Multicenter Cervical Cancer Study Group. NEngl JMed 2003; 348: 518-27.) 25 HPV virus like particles (VLPs) have been suggested as potential vaccines for treatment of HPV. Animal studies have shown that VLPs produce no cross protection against infection for other HPV types - see, for example Suzich, J. A., et al, Proc Natl Acad Sci, 92: 11553-11557, 1995, and Breitburd, Seminars in Cancer Biology, vol 9, 1999, pp 431 - 445. 30 WO2004/056389 discloses that an HPV 16, 18 VLP vaccine can provide cross protection against infection by HPV types other than 16 and 18. Statistically significant WO 2006/114273 PCT/EP2006/003809 2 protection was observed against certain groups of HPV types. However, the level of cross protection against individual types within groups was not disclosed. There is still a need for a vaccine that protects against multiple HPV types. 5 Summary of the invention The present invention relates to a multivalent HPV vaccine, the vaccine comprising an L1 protein or immunogenic fragment thereof from at least 3 different oncogenic HPV types, those types including HPV 16 and HPV 18, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof from an HPV type 10 selected from the list consisting of HPV 31, HPV 45, HPV 52 or any combination thereof. The present invention further relates to use of a composition comprising an L1 protein or immunogenic fragment thereof from HPV 16 and HPV 18 in the manufacture of a medicament for prevention of infection and/or disease by one or more 15 of the group consisting of HPV 31, HPV 45 and HPV 52. The present invention further relates to use of a composition comprising an L1 protein or immunogenic fragment thereof from HPV 16 and HPV 18 in the manufacture of a medicament for prevention of cytological abnormalities, and/or reduction of the frequency of cytological abnormalities, and/or prevention of CIN 20 lesions (ASCUS, CIN 1, CIN 2, CIN, cervical cancer) in an individual, the abnormalities or lesions caused by at least one HPV type other than HPV 16 or HPV 18, suitably being caused by HPV type 31, or 45, or 52, or a combination thereof. The invention further relates to a method of prevention and/or treatment of HPV infection and/or disease, the method comprising delivering to an individual in need 25 thereof an effective amount of a composition comprising an L1 protein or immunogenic fragment thereof from at least 3 different oncogenic HPV types, those types including HPV 16 and HPV 18, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof from an HPV type selected from the list consisting of HPV 31, HPV 45, HPV 52 or any combination thereof. 30 The invention further relates to use of a multivalent composition in the manufacture of a medicament for the prevention and/or treatment of HPV infection and/or disease, the multivalent composition comprising an L1 protein or immunogenic WO 2006/114273 PCT/EP2006/003809 3 fragment thereof from at least 3 different oncogenic HPV types, those types including HPV 16 and HPV 18, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof from an HPV type selected from the list consisting of HPV 31, HPV 45, HPV 52 or any combination thereof, and wherein the medicament 5 provides protection against infection and/or disease caused by the omitted HPV type. The invention also relates to a method for manufacture of a vaccine, the method comprising combining an L1 protein or immunogenic fragment thereof from at least 3 different oncogenic HPV types, those types including types HPV 16 and HPV 18, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof 10 from an HPV type selected from the list consisting of HPV 31, HPV 45, HPV 52 or any combination thereof. Detailed description The general existence of cross protection afforded by HPV 16 and HPV 18 15 against both incident and persistent infection, as assessed in relation to certain groups of HPV types, has been disclosed in WO2004/056389. We have surprisingly discovered that the cross protection against certain (non HPV16, HPV 18) HPV types ( as assessed by the efficacy of an HPV 16 and HPV 18 vaccine against those types), is higher than against certain other (non HPV16, HPV 18) 20 HPV types. Cross protection may be considered as the protection afforded by a vaccine containing one HPV type against infection (incident or persistent) and/or disease caused by a different HPV type. Cross protection may be assessed by considering the vaccine efficacy (V.E.), wherein the V.E. is the % improvement in protection against infection or disease by the vaccine compared to a placebo group for a given type. 25 Infection may be incident or persistent infection. Disease may be abnormal cytology, ASCUS, CIN1, CIN2, CIN3 or cervical cancer related to HPV infection. Infection may be assessed by PCR, for example. Disease may be assessed by, for example, histological examination or analysis of biomarkers such as p l16. Such a finding has potential implications for vaccine design. For example, the 30 level of cross protection afforded by HPV 16 and HPV 18 L1 containing vaccines against certain other HPV types, such as HPV 31, HPV 45 and HPV 52, allows L1 components from these HPV types to be omitted from a vaccine comprising HPV 16 WO 2006/114273 PCT/EP2006/003809 4 and HPV 18 while still providing a vaccine which provides some protection against incident and/or persistent infection and/or disease related to those omitted types. After HPV types 16 (found in 53.5% of cervical cancer) and 18 (found in 17.2% of cervical cancer), types 45 (6.7%) and 31 (2.9%) are the next most significant in 5 terms of their frequency in cervical cancers (Mufioz et al. supra). HPV 33 (2.6%) is next, followed by HPV 52 (2.3%). Thus, when designing a multivalent HPV vaccine against cervical cancer containing at least HPV 3 types then types 31 and 45 would generally be included by the skilled person after types 16 and 18 from a statistical perspective. 10 The ability to omit antigens from certain HPV types potentially allows inclusion of L1 protein from other HPV types, or indeed antigens from other viruses or pathogens, into a vaccine in a scenario where the total amount of antigen in a vaccine may be limited, for example by physical, chemical, regulatory or other constraints. In particular other HPV types include oncogenic HPV types such as HPV 31, 15 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68. The present invention relates to a multivalent HPV vaccine, the vaccine comprising an L1 protein or immunogenic fragment thereof from at least 3 different 20 oncogenic HPV types, those types including HPV 16 and HPV 18, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof from an HPV type selected from the list consisting of HPV 31, HPV 45, HPV 52 or any combination thereof. In one aspect of the invention the vaccine does not contain an L1 protein or 25 immunogenic fragment thereof from HPV 31. In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by HPV 31. In one aspect of the invention the vaccine of the invention does not contain an L1 protein or immunogenic fragment thereof from HPV 45. 30 In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by HPV 45.
WO 2006/114273 PCT/EP2006/003809 5 In one aspect of the invention the vaccine does not contain an L1 protein or immunogenic fragment thereof from HPV 52. In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by HPV 52. 5 In one aspect of the invention the vaccine of the invention does not contain an L1 protein or immunogenic fragment thereof from HPV 31 and 45. In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by both HPV 31 and 45. In one aspect of the invention the vaccine does not contain an L1 protein or 10 immunogenic fragment thereof from HPV 31 and 52. In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by both HPV 31 and 52. In one aspect of the invention the vaccine of the invention does not contain an L1 protein or immunogenic fragment thereof from HPV 45 and 52. 15 In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by both HPV 52 and 45. In one aspect of the invention the vaccine is capable of providing protection against incident and /or persistent HPV infection by HPV 31 and HPV 45 and HPV52. Suitably the vaccine is capable of protection against persistent infection. 20 Suitably the vaccine is capable of protection against incident infection. Incident and persistent cervical infection are defined in Example 1. We have also determined that a vaccine comprising HPV 16 L1 and HPV 18 L1 proteins (for example, as described in example 1) provides protection against 25 cytological abnormalities caused by certain other oncogenic HPV types such as HPV 52, and is significantly protective with respect to such abnormalities caused by a group ofHPV high risk types (defined as 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68). Cytological abnormalities are suitably detected by the well known Pap smear technique. 30 Thus the invention further relates to use of a combination of an L1 protein or immunogenic fragment thereof from HPV 16 and HPV 18 in the preparation of a composition for the prevention of cytological abnormalities or reduction of the WO 2006/114273 PCT/EP2006/003809 6 frequency of cytological abnormalities in an individual caused by other (non HPV 16, HPV 18) HPV types, suitably oncogenic HPV types, and in the prevention of histologically-confirmed CIN lesions (CIN 1, CIN 2, CIN 3) and cervical cancer associated with infection by HPV types which are not HPV 16 or 18. Said use is in 5 addition to the prevention or reduction of such events caused by the HPV types in the vaccine, HPV 16 and 18. Suitably the prevention of cytological abnormalities, reduction of the frequency of cytological abnormalities or prevention of histological-confirmed CIN lesions is prevention against those abnormalities or lesions caused by types not included in the 10 combination, suitably selected from the list of HPV 31, HPV 45 and HPV 52, or is prevention against those abnormalities or lesions caused by the group of 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68. Said use is in addition to the prevention or reduction of such events caused by the HPV types in the vaccine, HPV 16 and 18. Suitably the composition comprising HPV 16 and HPV 18 for use as above is 15 the multivalent HPV vaccine of the invention, the vaccine comprising an L1 protein or immunogenic fragment thereof from at least 3 different oncogenic HPV types, those types including HPV 16 and HPV 18, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof from an HPV type selected from the list consisting of HPV 31, HPV 45, HPV 52 or any combination thereof. 20 The vaccine of the invention comprises L1 or immunogenic fragment from HPV 16, HPV 18 and at least one other oncogenic HPV type. The oncogenic HPV types are those types associated with a risk of cervical cancer and those oncogenic types that might be included in the vaccine of the invention in addition to HPV 16 and HPV 18 include, but are not limited to, HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 25 and 68, with the proviso that the vaccine does not comprise all of HPV 31, 45 and 52. The vaccine of the invention suitably comprises an HPV 33 L1 protein or immunogenic fragment thereof. The vaccine of the invention suitably comprises an HPV 58 L1 protein or immunogenic fragment thereof. 30 The vaccine of the invention suitably comprises an HPV 59 L1 protein or immunogenic fragment thereof.
WO 2006/114273 PCT/EP2006/003809 7 The vaccine of the invention suitably comprises an HPV 16 L1 protein or immunogenic fragment thereof, HPV 18 L1 protein or immunogenic fragment thereof, HPV 33 L1 protein or immunogenic fragment thereof and HPV 58 L1 protein or immunogenic fragment thereof. 5 L1 proteins or protein fragments from additional HPV types can be included in the vaccine of the invention, such as skin types (in particular HPV 5 and 8) and types associated with genital warts, such as HPV 6 and 11. Types 6 and 11 are not considered oncogenic types herein. In one aspect of the invention the vaccine may include an HPV early antigen, 10 for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7, or E8. In an alternative aspect the vaccine may lack an HPV early antigen, for example an antigen selected from the list consisting of HPV El, E2, E3, E4, E5, E6, E7, or E8. In one aspect the vaccine of the invention is trivalent (contains an HPV L1 or 15 fragment thereof from 3 different oncogenic HPV types). In a further aspect the vaccine is tetravalent. In a further aspect the vaccine is pentavalent. In a further aspect the vaccine is heptavalent. In a further aspect the vaccine is septavalent. In a further aspect the vaccine is octavalent. Higher order valancies are also contemplated herein. In further aspects the vaccine is at least tetravalent, pentavalent, heptavalent, 20 septavalent or octavalent with respect to oncogenic HPV types. Preferably the combination of HPV components within the vaccine does not significantly impact the immunogenicity of any one HPV component. In particular it is preferred that there is no biologically relevant interference between HPV antigens in the combination of the invention, such that the combined vaccine of the invention is 25 able to offer effective protection against infection or disease caused by each HPV genotype represented in the vaccine. Suitably the immune response against a given HPV type in the combination is at least 50 % of the immune response of that same HPV type when measured individually, preferably 100% or substantially 100%. For responses to the HPV 16 and HPV 18, the combined vaccine of the invention 30 preferably stimulates an immune response which is at least 50% of that provided by a combined HPV 16 / HPV 18 vaccine. Suitably the immune response generated by the vaccine of the invention is at a level in which the protective effect of each HPV type is WO 2006/114273 PCT/EP2006/003809 8 still seen. The immune response may suitably be measured, for example, by antibody responses, in either preclinical or human experiments. Measurement of antibody responses is well known in the art, and disclosed in (for example) W003/077942. 5 We have determined that a vaccine comprising HPV 16 L1 and HPV 18 L1 proteins (e.g. see example 1) provides cross protection against infection or disease caused by certain HPV types. As well as providing novel compositions, this information allows new uses to be developed. In particular, the invention relates to use of a composition comprising HPV 16 10 and HPV 18 L1 protein, or immunogenic fragment thereof, in the manufacture of a medicament for prevention of infection by HPV 31. The invention further relates to use of a composition comprising HPV 16 and HPV 18 L1 protein, or immunogenic fragment thereof, in the manufacture of a medicament for prevention of infection by HPV 45. 15 The invention further relates to use of a composition comprising HPV 16 and HPV 18 L1 protein, or immunogenic fragment thereof in the manufacture of a medicament for prevention of infection by HPV 52. In one aspect the invention relates to use of a vaccine comprising HPV 16 L1 proteins, or immunogenic fragment thereof, in the preparation of a medicament for the 20 prevention of infection and/or disease caused by HPV 31, or HPV 52, or any combination thereof. In one aspect the invention relates to use of a vaccine comprising HPV 18 L1 proteins, or immunogenic fragment thereof, in the preparation of a medicament for the prevention of infection and/or disease caused by HPV 45. 25 The composition for said use may lack an antigenic component from the HPV type for which cross protection is provided. Alternatively the composition for said use may comprise such an antigenic component, e.g. the L1 protein or fragment thereof from said cross protected type. In the latter case the use of the composition comprising HPV 16 and HPV 18 L1 protein, or immunogenic fragment thereof, provides both cross 30 protection (e.g. against HPV 31, 45 and 52) and homologous protection (e.g. against HPV 16 and HPV 18).
WO 2006/114273 PCT/EP2006/003809 9 The composition in one aspect is a multivalent composition comprising L 1 proteins or immunogenic fragments thereof from HPV 16, HPV 18 and at least one other oncogenic HPV type, wherein an L1 protein or immunogenic fragment thereof from one or more HPV types selected from the group consisting of HPV 31, HPV 45, 5 and HPV 52 is omitted from the vaccine and wherein the vaccine provides protection against infection caused by the omitted HPV type. Where the vaccine or composition of the invention comprises an immunogenic fragment of Ll, then suitable immunogenic fragments of HPV L1 include truncations, deletions, substitution, or insertion mutants of Ll. Such immunogenic fragments are 10 suitably capable of raising an immune response (if necessary, when adjuvanted), said immune response being capable of recognising an L1 protein such as a virus like particle, from the HPV type from which the L1 protein was derived. A suitable immunogenic fragment of HPV 16 is capable of cross protection against at least one of HPV 31 and HPV 52, and in an aspect of the invention, capable 15 of cross protection against both. A suitable immunogenic fragment of HPV 18 is capable of cross protection against HPV 45. Cross protection obtainable by immunogenic fragments of HPV 16 and/or HPV 18 can be assessed by trials in humans, for example as outlined in Example 1. 20 Similarly, different vaccines according to the present invention can be tested using standard techniques, for example as in Example 1, or in standard preclinical models, to confirm that the vaccine is immunogenic. Suitable immunogenic L1 fragments include truncated L1 proteins. In one aspect the truncation removes a nuclear localisation signal. In another aspect the 25 truncation is a C terminal truncation. In a further aspect the C terminal truncation removes fewer than 50 amino acids, such as fewer than 40 amino acids. Where the L1 is from HPV 16 then in another aspect the C terminal truncation removes 34 amino acids from HPV 16 Ll. Where the L1 is from HPV 18 then in a further aspect the C terminal truncation removes 35 amino acids from HPV 18 Ll. Truncated L1 Proteins 30 are described in US 6,060,324, US 6,361,778, and US 6,599,508 incorporated herein by reference.
WO 2006/114273 PCT/EP2006/003809 10 In one aspect the HPV 16 amino acid sequence is the following sequence: (SEQ ID NO: 1) MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNNKI 60 LVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGVGISGH 120 5 PLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAV 180 NPGDCPPLELINTVIQDGDMVDTGFGAMDFTrLQANKSEVPLDICTSICKYPDYIKMVSE 240 PYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMV 300 TSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNF 360 KEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRF 420 10 VTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQ 471 In another aspect the invention relates to virus like particles consisting only of HPV 16 L1 having the amino sequence above, and to compositions containing such VLPs. 15 The HPV 16 sequence may also be that disclosed in WO9405792 or US6649167, for example, suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison. 20 In one aspect the HPV 18 amino acid sequence is the following sequence: (SEQ ID NO: 2) MALWRPSDNTVYLPPPSVARVVNTDDYVTRTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQ 60 DIPKVSAYQYRVFRVQLPDPNKFGLPDNSIYNPETQRLVWACVGVEIGRGQPLGVGLSGH 120 PFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPL 180 25 SQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSAD 240 PYGDSMFFCLRREQLFARHFWNRAGTMGDTVPPSLYIKGTGMRASPGSCVYSPSPSGSIV 300 TSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTRSTNLTICASTQSPVPGQYDATK 360 FKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYR 420 FVQSVA1TCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQ 472 30 In another aspect the invention relates to virus like particles consisting only of HPV 18 L1 having the amino sequence above, and to compositions containing such VLPs. An alternative HPV 18 sequence is disclosed in WO9629413, which may be 35 suitably truncated. Suitable truncates are truncated at a position equivalent to that shown above, as assessed by sequence comparison.
WO 2006/114273 PCT/EP2006/003809 11 Other HPV 16 and HPV 18 sequences are well known in the art and may be suitable for use in the present invention. Suitable truncations of HPV 31, HPV 45 and HPV 52 may also be made, suitably removing equivalent C terminal portions of the L1 protein to those described 5 above as assessed by sequence alignment. Truncated L1 proteins are disclosed in, for example, WO9611272 and US6066324, herein incorporated by reference. The L1 protein or fragment of the invention may optionally be in the form of a fusion protein, such as the fusion of the L1 protein with L2 or an early protein. 10 The HPV L1 protein is suitably in the form of a capsomer or virus like particle (VLP). In one aspect HPV VLPs may be used in the present invention. HPV VLPs and methods for the production of VLPs are well known in the art. VLPs typically are constructed from the L1 and optionally L2 structural proteins of the virus, see for example WO9420137, US5985610, W09611272, US6599508B1, US6361778B1, EP 15 595935. Any suitable HPV VLP may be used in the present invention which provides cross protection, such as an L1 or L1 + L2 VLP. Suitably the VLP is an LI-only VLP. In one aspect of the invention the vaccine comprises HPV 16 and HPV 18 L1 only VLPs, suitably in combination with an L1 VLP selected from HPV 31, 33, 35, 39, 20 45, 51, 52, 56, 58, 59, 66 and 68, with the proviso that the vaccine does not comprise VLPs from all of HPV 31, 45 and 52. VLP formation can be assessed by standard techniques such as, for example, electron microscopy and dynamic laser light scattering. The VLP may comprise full length L1 protein. In one aspect the L1 protein 25 used to form the VLP is a truncated L1 protein, as described above. VLPs may be made in any suitable cell substrate such as yeast cells or insect cells e.g. baculovirus cells, and techniques for preparation of VLPs are well known in the art, such as WO9913056, US 6416945B1 , US 6261765B1 and US6245568, and references therein, the entire contents of which are hereby incorporated by reference. 30 VLPS are suitably made by disassembly and reassembly techniques, which can provide for more stable and/or homogeneous papillomavirus VLPs. For example, McCarthy et al, 1998 "Quantitative Disassembly and Reassembly of Human WO 2006/114273 PCT/EP2006/003809 12 Papillomavirus Type 11 Virus like Particles in Vitro" J. Virology 72(1):33-41, describes the disassembly and reassembly of recombinant L1 HPV 11 VLPs purified from insect cells in order to obtain a homogeneous preparation of VLPs. WO9913056 and US6245568 also describe disassembly/reassembly processes for making HPV 5 VLPs. In one aspect HPV VLPS are made as described WO9913056 or US6245568. The HPV L1 the invention may be combined with an adjuvant or imunostimulant such as, but not limited to, detoxified lipid A from any source and non 10 toxic derivatives of lipid A, saponins and other reagents capable of stimulating a TH 1 type response. It has long been known that enterobacterial lipopolysaccharide (LPS) is a potent stimulator of the immune system, although its use in adjuvants has been curtailed by its toxic effects. A non-toxic derivative of LPS, monophosphoryl lipid A (MPL), produced 15 by removal of the core carbohydrate group and the phosphate from the reducing-end glucosamine, has been described by Ribi et al (1986, Immunology and Immunopharmacology of bacterial endotoxins, Plenum Publ. Corp., NY, p407-419) and has the following structure: HO H-0 .2",6 -/ 4-- o a o. •oel H NO H'J H ""S '"'- ' - " "n nc ("Ht : I _.- iO t* N O .. NH C I O I I Cm C-O OH 0 (CH2) I CO I I 0 (CH2ho Cf 2 ) C2 OCH3 I II I C C 3 CM-HOH (CHI C C ONO I (C( )2)10 IC = CH) (CH2)toC CH) C=0 (CH3) WO 2006/114273 PCT/EP2006/003809 13 A further detoxified version of MPL results from the removal of the acyl chain from the 3-position of the disaccharide backbone, and is called 3-O-Deacylated monophosphoryl lipid A (3D-MPL). It can be purified and prepared by the methods taught in GB 2122204B, which reference also discloses the preparation of diphosphoryl 5 lipid A, and 3-O-deacylated variants thereof. A suitable form of 3D-MPL is in the form of an emulsion having a small particle size less than 0.2tm in diameter, and its method of manufacture is disclosed in WO 94/21292. Aqueous formulations comprising monophosphoryl lipid A and a surfactant have been described in WO9843670A2. 10 The bacterial lipopolysaccharide derived adjuvants to be formulated in the compositions of the present invention may be purified and processed from bacterial sources, or alternatively they may be synthetic. For example, purified monophosphoryl lipid A is described in Ribi et al 1986 (supra), and 3-O-Deacylated monophosphoryl or diphosphoryl lipid A derived from Salmonella sp. is described in GB 2220211 and US 15 4912094. Other purified and synthetic lipopolysaccharides have been described (Hilgers et al., 1986, Int.Arch.Allergy.Immunol., 79(4):392-6; Hilgers et al., 1987, Immunology, 60(1):141-6; and EP 0 549 074 Bl). In one aspect the bacterial lipopolysaccharide adjuvant is 3D-MPL. Accordingly, the LPS derivatives that may be used in the present invention are 20 those immunostimulants that are similar in structure to that of LPS or MPL or 3D MPL. In another aspect of the present invention the LPS derivatives may be an acylated monosaccharide, which is a sub-portion to the above structure of MPL. Saponins are taught in: Lacaille-Dubois, M and Wagner H. (1996. A review of the biological and pharmacological activities of saponins. Phytomedicine vol 2 pp 363 25 386). Saponins are steroid or triterpene glycosides widely distributed in the plant and marine animal kingdoms. Saponins are noted for forming colloidal solutions in water which foam on shaking, and for precipitating cholesterol. When saponins are near cell membranes they create pore-like structures in the membrane which cause the membrane to burst. Haemolysis of erythrocytes is an example of this phenomenon, 30 which is a property of certain, but not all, saponins.
WO 2006/114273 PCT/EP2006/003809 14 Saponins are known as adjuvants in vaccines for systemic administration. The adjuvant and haemolytic activity of individual saponins has been extensively studied in the art (Lacaille-Dubois and Wagner, supra). For example, Quil A (derived from the bark of the South American tree Quillaja Saponaria Molina), and fractions thereof, are 5 described in US 5,057,540 and "Saponins as vaccine adjuvants", Kensil, C. R., Crit Rev Ther Drug Carrier Syst, 1996, 12 (1-2):1-55; and EP 0 362 279 Bl. Particulate structures, termed Immune Stimulating Complexes (ISCOMS), comprising fractions of Quil A are haemolytic and have been used in the manufacture of vaccines (Morein, B., EP 0 109 942 BI; WO 96/11711; WO 96/33739). The haemolytic saponins QS21 and 10 QS 17 (HPLC purified fractions of Quil A) have been described as potent systemic adjuvants, and the method of their production is disclosed in US Patent No.5,057,540 and EP 0 362 279 B 1. Other saponins which have been used in systemic vaccination studies include those derived from other plant species such as Gypsophila and Saponaria (Bomford et al., Vaccine, 10(9):572-577, 1992). 15 An enhanced system involves the combination of a non-toxic lipid A derivative and a saponin derivative particularly the combination of QS21 and 3D-MPL as disclosed in WO 94/00153, or a less reactogenic composition where the QS21 is quenched with cholesterol as disclosed in WO 96/33739. A particularly potent adjuvant formulation involving QS21 and 3D-MPL in an 20 oil in water emulsion is described in WO 95/17210 and use of this adjuvant forms an aspect of the invention. Accordingly in one embodiment of the present invention there is provided a vaccine adjuvanted with detoxified lipid A or a non-toxic derivative of lipid A, more suitably adjuvanted with a monophosphoryl lipid A or derivative thereof. 25 In one aspect the vaccine additionally comprises a saponin, for example QS21. In one aspect the vaccine formulation comprises an oil in water emulsion. The present invention also provides a method for producing a vaccine formulation comprising mixing an L1 peptide of the present invention together with a pharmaceutically acceptable excipient, such as 3D-MPL. 30 Additional components that may be included present in an vaccine formulation according to the invention include non-ionic detergents such as the octoxynols and polyoxyethylene esters as described herein, particularly t-octylphenoxy WO 2006/114273 PCT/EP2006/003809 15 polyethoxyethanol (Triton X-100) and polyoxyethylene sorbitan monooleate (Tween 80); and bile salts or cholic acid derivatives as described herein, in particular sodium deoxycholate or taurodeoxycholate. Thus, in one aspect of the invention a formulation comprises 3D-MPL, Triton X-100, Tween 80 and sodium deoxycholate, which may be 5 combined with an L2 antigen preparation to provide a suitable vaccine. In one embodiment of the present invention, the vaccine comprises a vesicular adjuvant formulation comprising cholesterol, a saponin and an LPS derivative. In this regard the adjuvant formulation suitably comprises a unilamellar vesicle comprising cholesterol, having a lipid bilayer suitably comprising dioleoyl phosphatidyl choline, 10 wherein the saponin and the LPS derivative are associated with, or embedded within, the lipid bilayer. In one aspect these adjuvant formulations comprise QS21 as the saponin, and 3D-MPL as the LPS derivative, wherein the ratio of QS21 :cholesterol is from 1:1 to 1:100 weight/weight, and in one aspect, a ratio of 1:5 weight/weight. Such adjuvant formulations are described in EP 0 822 831 B, the disclosure of which is 15 incorporated herein by reference. Suitably the vaccines of the invention are used in combination with aluminium, and are suitably adsorbed or partially adsorbed onto aluminium adjuvants. Suitably the adjuvant is an aluminium salt, which may be in combination with 3D MPL, such as aluminium phosphate and 3D MPL. Aluminium hydroxide, optionally in combination 20 with 3D MPL is also suitable. In another aspect of the present invention the vaccine comprises the combination of HPV VLPs with an aluminium salt or with an aluminium salt + 3D MPL. Aluminium hydroxide is suitable as the aluminium salt. The vaccine may also comprise aluminium or an aluminium compound as a 25 stabiliser. In another aspect the adjuvant may be a combination of an oil-in-water emulsion adjuvant and 3D MPL. In one aspect the oil-in-water emulsion comprises a metabolisable oil, a sterol and an emulsifying agent. The vaccines of the invention may be provided by any of a variety of routes 30 such as oral delivery (e.g. see WO9961052 A2), topical, subcutaneous, mucosal (typically intravaginal), intraveneous, intramuscular, intranasal, sublingual, intradermal and via suppository.
WO 2006/114273 PCT/EP2006/003809 16 Optionally the vaccine may also be formulated or co-administered with other HPV antigens or non-HPV antigens. Suitably these non-HPV antigens can provide protection against other diseases, such as sexually transmitted diseases such as herpes simplex virus, EBV, chlamydia and HIV. We particularly prefer that the vaccine 5 comprises gD or a truncate thereof from HSV. In this way the vaccine provides protection against both HPV and HSV. The dosage of the vaccine components will vary with the condition, sex, age and weight of the individual, the administration route and HPV of the vaccine. The quantity may also be varied with the number of VLP types. Suitably the delivery is of 10 an amount of vaccine suitable to generate an immunologically protective response. Suitably each vaccine dose comprises 1-100 gg of each VLP, in one aspect 5-80ptg, in another aspect 5- 30 p.g each VLP, in a further aspect 5-20 ptg of each VLP, in a yet further aspect 5 pg, 61tg, 10pg, 15 [tg or 20p[g. In one aspect the vaccine can comprise HPV L1 protein components, preferably 15 as virus like particles, in different amounts. In one aspect, HPV 16 and HPV 18 VLPs may be provided at a higher dose than other oncogenic types, such as HPV 33 or 58. In one aspect HPV 16 and HPV 18 L1 only VLPs are provided at 20ptg per dose for human use. Other HPV VLPs may be used at a lower dose, such as 15 or 10 pg per dose for human use. 20 For all vaccines of the invention, in one aspect the vaccine is used for the vaccination of adolescent girls aged 10-15, such as 10-13 years. However, older girls above 15 years old and adult women may also be vaccinated. The vaccine may also be administered to women following an abnormal pap smear or after surgery following removal of a lesion caused by HPV, or who are seronegative and DNA negative for 25 HPV cancer types. The vaccine of the invention may be used in men. In one aspect the vaccine is delivered in a 2 or 3 dose regime, for example in a 0, 1 month regime or 0,1 and 6 month regime respectively. Suitably the vaccination regime incorporates a booster injection after 5 to 10 years, such as 10 years. 30 In one aspect the vaccine is a liquid vaccine formulation, although the vaccine may be lyophilised and reconstituted prior to administration.
WO 2006/114273 PCT/EP2006/003809 17 The teaching of all references in the present application, including patent applications and granted patents, are herein fully incorporated by reference. The vaccines of the invention comprise certain HPV components as laid out above. In a further aspect of the invention the vaccine consists essentially of, or 5 consists of, said components. The term 'vaccine', as used in the present invention, refers to a composition that comprises an immunogenic component capable of provoking an immune response in an individual, such as a human, optionally when suitably formulated or adjuvant. A vaccine suitably elicits a protective immune response against incident infection, or 10 persistent infection, or cytological abnormality such as ASCUS, CINI, CIN2 , CIN3, or cervical cancer caused by one or more HPV types. The present invention is now described with respect to the following examples which serve to illustrate the invention. 15 Example 1 Precise details of the experiment carried out are provided in Harper et al, the Lancet. 2004 Nov 13;364(9447):1757-65, incorporated herein by reference. In summary, healthy women between the ages of 15 and 25 years were immunised with a mixture of HPV 16 and HPV 18 L1 VLPs. The women at enrolment 20 were: 1) seronegative for HPV-16 and HPV-18; 2) negative for high risk HPV infection of the cervix (detected by HPV PCR); 3) had 6 or fewer lifetime sexual partners and 4) had normal PAP smears. The mixture comprised, per 0.5 ml dose, 20 [tg of HPV-16 L1 VLP, 20 jig of HPV-18 L1 VLP and was adjuvanted with 500 pg of aluminum hydroxide and 50 pg of 25 3D MPL. The placebo group was injected with 500 jg of aluminum hydroxide alone. The vaccine efficacy (V.E.) against certain cancer HPV types was assessed, wherein the V.E. is the % improvement in protection against infection or disease by the vaccine compared to a placebo group. Cross protection was assessed by detecting the presence of nucleic acid specific 30 for various oncogenic types in the vaccinees and control group. Detection was carried out using techniques as described in W003014402, and references therein, particularly for non-specific amplification of HPV DNA and subsequent detection of DNA types WO 2006/114273 PCT/EP2006/003809 18 using a LiPA system as described in WO 99/14377, and in Kleter et al, [Journal of Clinical Microbiology (1999), 37 (8): 2508-2517], the whole contents of which are herein specifically incorporated by reference. Any suitable method can, however, be used for the detection of HPV DNA in a 5 sample, such as type specific PCR using primers specific for each HPV type of interest. Suitable primers are known to the skilled person, or can be easily constructed given that the sequences of the oncogenic HPV types are known. In detail, the methods section of the Lancet paper is reproduced here below, for 10 completeness (continues until section entitled "Initial analysis and results") The primary objective of this study was to assess vaccine efficacy in the prevention of infection with HPV-16, HPV-18, or both (HPV-16/18), between months 6 and 18 in participants who were initially shown to be seronegative for HPV-16/18 by ELISA and 15 negative for HPV-16/18 DNA by PCR. Secondary objectives included: evaluation of vaccine efficacy in the prevention of persistent infection with HPV-16/18, and the evaluation of vaccine efficacy in the prevention of cytologically confirmed low-grade squamous intraepithelial lesions (LSIL), high-grade squamous intraepithelial lesions (HSIL), and histologically confirmed LSIL (CIN 1), HSIL (CIN 2 or 3) squamous cell 20 cancer, or adenocarcinoma associated with HPV-16/18 infection between months 6 and 18, and months 6 and 27. The prevention of atypical squamous cells of undetermined significance (ASCUS) cytology associated with HPV-16/18 infection was added post hoc to the outcome analyses. We also did an exploratory analysis of the histopathological endpoints CIN 1 25 and 2 associated with HPV-16/18 DNA detected by PCR in lesional tissue. Other objectives included the assessment of vaccine immunogenicity, safety, and tolerability. Investigators in North America (Canada and the USA) and Brazil recruited women for this efficacy study through advertisements or previous participation in an HPV cross sectional epidemiology study that took place between July and December, 2000. 30 For each of the 32 study sites, an institutional review board approved the protocol, consent forms, and amendments. Women signed separate written consents for study WO 2006/114273 PCT/EP2006/003809 19 participation and colposcopy. For those under 18 years, parental consent and assent from the participant were obligatory. There were two study phases: an initial phase for vaccination and follow-up that concluded at month 18; and a blinded follow-up extension phase that concluded at 5 month 27. Women eligible for the initial phase (months 0-18) included healthy women aged 15-25 years, who had had no more than six sexual partners, no history of an abnormal Pap test or ablative or excisional treatment of the cervix, and no ongoing treatment for external condylomata; and who were cytologically negative, seronegative 10 for HPV-16 and HPV-18 antibodies by ELISA, and HPV-DNA-negative by PCR for 14 high-risk HPV types (16, 18, 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68) no more than 90 days before study entry. Women who completed the initial phase of the study earliest, and who did not have ablative or excisional therapy of the cervix, or hysterectomy after enrolment, were 15 eligible to participate in the extension phase of the study (months 18-27). Procedures Each dose of the bivalent HPV-16/18 virus-like particle vaccine (GlaxoSmithKline Biologicals, Rixensart, Belgium) contained 20 Pg of HPV-16 LI 20 virus-like particle and 20 Pg of HPV-18 L1 virus-like particle. Each type of virus-like particle was produced on Spodopterafrugiperda Sf-9 and Trichoplusia ni Hi-5 cell substrate with ASO4 adjuvant containing 500 Pg aluminum hydroxide and 50 fg 3 deacylated monophosphoryl lipid A (MPL, Corixa, Montana, USA) provided in a monodose vial. The placebo contained 500 Pg of aluminum hydroxide per dose, and 25 was identical in appearance to the HPV-16/18 vaccine. Every study participant received a 0-5 mL dose of vaccine or placebo at 0 months, 1 month, and 6 months. Health-care providers obtained cervical specimens with a cervical brush and spatula (washed in PreservCyt, Cytyc Corporation, Boxborough, MA, USA) for cytology and HPV DNA testing at screening and months 6, 12, and 18. At months 0 and 6, and 30 subsequently every 3 months, women self-obtained cervicovaginal samples with two sequential swabs (placed in PreservCyt) for HPV DNA testing.[ DM Harper, WW Noll, DR Belloni and BF. Cole, Randomized clinical trial of PCR-determined human WO 2006/114273 PCT/EP2006/003809 20 papillomavirus detection methods: self-sampling versus clinician-directed-biologic concordance and women's preferences. Am J Obstet Gynecol 186 (2002), pp. 365-373] A central laboratory (Quest Diagnostics, Teterboro, NJ, USA) reported cytology results (ThinPrep, Cytyc Corporation) by use of the 1991 Bethesda classification system. 5 Protocol guidelines recommended colposcopy after two reports of ASCUS, or one report of atypical glandular cells of undetermined significance, LSIL or HSIL, squamous cell carcinoma, adenocarcinoma in situ, or adenocarcinoma. These guidelines also recommended biopsy for any suspected lesions. The central histology laboratory made an initial diagnosis from the formalin-fixed 10 tissue specimens for clinical management. A panel of three pathologists made a subsequent consensus diagnosis for HPV-16 and HPV-18 associated lesions with the CIN system. This consensus diagnosis also included review of the sections taken at the time of microdissection for PCR detection of lesional HPV DNA. HPV DNA isolated from the cytology specimen (MagNaPure Total Nucleic Acid 15 system, Roche Diagnostics, Almere, Netherlands) and from the cervical biopsy specimen (proteinase K extraction) was amplified from an aliquot of purified total DNA with the SPF10 broad-spectrum primers that amplify a 65 bp region of the L1 gene.[ B Kleter, LJ van Doom, J ter Schegget et al., Novel short-fragment PCR assay for highly sensitive broad-spectrum detection of anogenital human papillomaviruses. 20 Am JPathol 153 (1998), pp. 1731-1739: LJ van Doom, W Quint, B Kleter et al., Genotyping of human papillomavirus in liquid cytology cervical specimens by the PGMY line blot assay and the SPF(10) line probe assay. J Clin Microbiol 40 (2002), pp. 979-983 and WG Quint, G Scholte, LJ van Doom, B Kleter, PH Smits and J. Lindeman, Comparative analysis of human papillomavirus infections in cervical 25 scrapes and biopsy specimens by general SPF(10) PCR and HPV genotyping. JPathol 194 (2001), pp. 51-58] The amplification products were detected by a DNA enzyme immunoassay. A line probe assay (LiPA Kit HPV INNO LiPA HPV genotyping assay, SPF-10 system version 1, Innogenetics, Gent, Belgium, manufactured by Labo Bio medical Products, Rijswijk, Netherlands) detected 25 HPV genotypes (6, 11, 16, 18, 31, 30 33, 34, 35, 39, 40, 42, 43, 44, 45, 51, 52, 53, 56, 58, 59, 66, 68, 70, and 74). [B Kleter, LJ van Doom, L Schrauwen et al., Development and clinical evaluation of a highly sensitive PCR-reverse hybridization line probe assay for detection and identification of WO 2006/114273 PCT/EP2006/003809 21 anogenital human papillomavirus. J Clin Microbiol 37 (1999), pp. 2508-2517] Any specimen that was positive by DNA enzyme immunoassay was tested by type-specific HPV-16 and HPV-18 PCR. HPV-16 type-specific PCR primers amplified a 92 bp segment of the E6/E7 gene and HPV-18 type-specific PCR primers amplified a 126 bp 5 segment of the L1 gene. [MF Baay, WG Quint, J Koudstaal et al., Comprehensive study of several general and type-specific primer pairs for detection of human papillomavirus DNA by PCR in paraffin-embedded cervical carcinomas. J Clin Microbiol 34 (1996), pp. 745-747] We defined incident cervical infection with HPV-16/18 as at least one positive PCR 10 result for HPV-16 or HPV-18 during the trial, and persistent infection with HPV-16/18 as at least two positive HPV-DNA PCR assays for the same viral genotype separated by at least 6 months.[ H Richardson, G Kelsall, P Tellier et al., The natural history of type specific human papillomavirus infections in female university students. Cancer Epidemiol Biomarkers Prev 12 (2003), pp. 485-490 and AB Moscicki, JH Ellenberg, S 15 Farhat and J. Xu, Persistence of human papillomavirus infection in HIV-infected and uninfected adolescent girls: risk factors and differences, by phylogenetic type. Jlnfect Dis 190 (2004), pp. 37-45] HPV-DNA test results were concealed from investigators during the study and cytological and histological diagnoses were only revealed for clinical management purposes. Analyses included HPV-16/18 DNA results for cervical 20 specimens and combined cervical and self-obtained cervicovaginal specimens. We collected serum from study participants at months 0, 1, 6, 7, 12, and 18 for assessment of immunogenicity. Serological testing for antibodies to HPV-16 and HPV 18 virus-like particles was by ELISA. Recombinant HPV-16 or HPV-18 virus-like particles were used as coating antigens for antibody detection (see webappendix 25 http://image.thelancet.com/extras/04artl0103webappendix.pdf). Seropositivity was defined as a titre greater than or equal to the assay cut-off titre established at 8 ELISA units/mL for HPV-16 and 7 ELISA units/mL for HPV-18. Typical natural titres were determined by use of blood samples obtained from women in the preceding epidemiology study who were found to be seropositive for HPV-16 or HPV-18 by 30 ELISA. Women recorded symptoms experienced during the first 7 days after vaccination on diary cards with a three-grade scale of symptom intensity. Additionally, WO 2006/114273 PCT/EP2006/003809 22 they reported to study personnel by interview all adverse events within the first 30 days after vaccination. Information on serious adverse events and pregnancies was collected throughout the study. 5 Statistical methods Assuming a 6% cumulative incidence rate of both HPV-16 and HPV-18 type infections over 12 months, we estimated that 500 women per treatment group would provide 80% power to assess a lower limit of the 95% CI of the vaccine efficacy above zero. We assumed an 80% retention rate over 18 months. Interim analyses for efficacy, 10 safety, and immunogenicity were done for future study planning purposes only; the O'Brien and Fleming method was used to adjust the value for the final analysis after interim analyses occurred (overall r-=0-05; two-sided test).[ PC O'Brien and TR. Fleming, A multiple testing procedure for clinical trials. Biometrics 35 (1979), pp. 549 556] 15 Stratified, block randomisation according to validated algorithms was centralised with an internet randomisation system. Stratification was according to age (15-17, 18-21, and 22-25 years) and region (North America and Brazil). Each vaccine dose was attributed a randomly chosen number based on specific participant information entered into the computerised randomisation system by study personnel. Treatment allocation 20 remains concealed from investigators and the women participating in a long-term follow-up study. The intention-to-treat and according-to-protocol cohorts are shown in the figure, in which the reasons for exclusion from analyses are listed in rank order; women who met more than one exclusion criterion were only counted once according to the highest 25 ranking criterion. We refer to the sets of participants entered in the intention-to-treat and according-to-protocol analyses as cohorts, although the information used to restrict subject inclusion in the according-to-protocol was only known after follow-up. We did both according-to-protocol and intention-to-treat analyses for efficacy. Calculation of vaccine efficacy in the according-to-protocol 18-month analysis was 30 based on the proportion of participants with HPV-16/18 infection in the vaccinated versus placebo groups. Vaccine efficacy was defined as 1 minus the ratio between these two proportions; 95% CIs measured the precision of the efficacy estimates. p values WO 2006/114273 PCT/EP2006/003809 23 were calculated with the two-sided Fisher's exact test. Corresponding rates were expressed as the numbers of cases with the outcome divided by the numbers of participants at risk. The according-to-protocol 18-month cohort included enrolled women who received three scheduled doses of vaccine and complied with the protocol 5 as described in the figure. Calculation of vaccine efficacy in the intention-to-treat and according-to protocol 27-month analyses was based on the Cox proportional hazard model using the time-to-occurrence of cases with HPV-16/18 infection in the vaccinated versus placebo groups. This allowed controlling for the accrued person-time data in each group. 10 Vaccine efficacy was calculated using 1 minus the hazard ratio and p values calculated using the log rank test. Corresponding rates were expressed as the number of cases divided by the total person-time. All enrolled women who received at least one dose of vaccine or placebo, were negative for high-risk HPV-DNA at month 0, and had any data available for outcome measurement were included in the intention-to-treat cohort. 15 The according-to-protocol 27-month cohort included outcome results from the according-to-protocol 18-month cohort and results that occurred during the extension phase (from 18 months to 27 months). Calculation of p values for the safety analysis was performed using Fisher's exact test comparisons. The cohort for safety analysis included all enrolled women who 20 received at least one dose of vaccine or placebo and complied with specified, minimal protocol requirements (see protocol below:) WO 2006/114273 PCT/EP2006/003809 24 4939 assessed for eligibility 1113 randomised + +_ 560 randomized to vaccine 553 r and o mize d t o placeb o [ 560 included in ITT cohort 553 included in ITT cohort 540 included in ATP cohort (saftey analysis) 541 included in ATP cohort (saftey analysis) 20 excluded 12 excluded 10 concomitant of placebo dose as 11 concomitant vaccine adminstration replacement for lost/damaged vial I randomisation code broken at site I randomisation code broken at site 366 included in ATP cohort (vaccine efficacy 355 included in ATP cohort (vaccine efficacy analysis) for months 6-18, 27 analysis) for months 6-18, 27 Primary analysis incident HPV-16/18 infections Primary analysis incident HPV-16/18 infections 174 excluded from month 6-18 analysis 186 excluded from month 6-18 analysis 2 eligibility criteria not met 6 eligibility criteria not met 79 initially seropositive for HPV- 16/18 positive 73 initially seropositive for HPV- 16/18 positive for high-risk HPV DNA; or abnormal cytology for high-risk HPV DNA; or abnormal cytology 0 medication administration violating protocol 1 medication administration violating protocol 41 non-compliance with vaccine schedule administration of blood product 9 missing HPV DNA results or serology results 45 non-compliance with vaccine schedule at screening 12 missing HPV DNA results or serology results 7 had positive HPV-16/18 DNA results at 6 at screening months 18 had positive HPV-16/18 DNA results at 6 36 dropped out before month 18 months 36 dropped out before month 18 316 completed month 21 visit 291 completed month 21 visit 209 completed month 24 visit 188 completed month 24 visit 81 completed month 27 visit 59 completed month 27 visit 384 included in ATP cohort for months 6-18 344 included in ATP cohort for months 6-18 Secondary analysis immunogenisity Secondary analysis immunogenisity 156 excluded 197 excluded 2 eligibility criteria not met 6 eligibility criteria not met 23 initially seropositive or unknown antibody 20 initially seropositive or unknown antibody status status 0 medication administration violating protocol 1 medication administration violating protocol 40 had positive HPV-16/18 DNA results during of blood product the study period 85 had positive HPV-16/18 DNA results during 52 non-compliance with vaccine schedule 4 the study period 35 non-compliance with blood sampling 51 non-compliance with vaccine schedule schedule 29 non-compliance with blood sampling 4 serological data missing schedule 5 serological data missing WO 2006/114273 PCT/EP2006/003809 25 Immunogenicity was assessed in a subset of the according-to-protocol safety cohort, which included women with serology results at months 0, 7, and 18, who received all 5 three doses of study vaccine or placebo according to schedule, complied with the blood sampling schedule, and did not become positive for HPV-16/18-DNA during the trial. Seropositivity rates between the vaccine and placebo groups were compared with Fisher's exact test (p<0-001 judged significant). Geometric mean titres were compared with ANOVA and Kruskal-Wallis test. 10 Block randomisation and statistical analyses were done with SAS version 8.2 (SAS Institute, Cary, North Carolina). Initial analysis and results Results of the initial analysis on cross protection are presented in patent 15 application WO2004/056389, the whole contents of which herein incorporated by reference. An initial analysis was carried out on an "ITT" (Intention To Treat cohort, representing all individuals who received at least one dose of vaccine). This data is shown in Table A. 20 The results presented in Tables B and C-relate to the "ATP" (According To Protocol) group for those patients who complied with all the criteria of the trial. Table B is a midpoint analysis with data taken from all patients at the timepoint at which at least 50% of the cohort were 18 months after their first vaccination. Table C gives the final results, all data being from subjects at 18 months post first vaccination (month 0). 25 In the ATP group all patients received 3 doses of vaccine at 0, 1 and 6 months and were seronegative at 6 months. As demonstrated by the data presented in table A, immunization with a mixture of HPV 16 and HPV18 VLPs provided apparent cross-protection against other HPV types. At this point the sample sizes are too small to provide for a rigorous statistical 30 analysis, however the data demonstrate a positive trend and suggest that immunization with HPV 16 and HPV 18 VLPs will be efficacious against infection with other HPV types.
WO 2006/114273 PCT/EP2006/003809 26 This was confirmed as the study progressed. Table B demonstrates that HPV 16 and HPV 18 provide statistically significant cross protection against the group of high risk cancer types 5 31,33,35,39,45,51,52,56,58,59, 66 and 68. Table C demonstrates that, except for the HPV-18 related types (which show a very strong trend), there is statistically significant cross-protection against the groups of: HPV 31, 35, 58; HPV 31, 33, 35, 52, 58; and the 12 high risk (non HPV-16/18) types evaluated. 10 Further analysis was carried out on the specific cross protection against specific types. Vaccine efficacy was assessed against infections and diseases related to the 12 high risk cancer types 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66 and 68, HPV-16 phylogenetic-related types (the groups of; 31, 35, and 58; 31, 33, 35, 52 and 58) and 15 HPV-18 phylogenetic related types (45 and 59). An analysis was carried out on an"ATP" (According To Protocol) group for those patients who complied with all the criteria of the trial. In the ATP group all patients received 3 doses of vaccine at 0, 1 and 6 months and were seronegative at 6 months. 20 As demonstrated by the data presented in Table D, immunization with a mixture of HPV16 and HPV18 VLPs provided statistically significant cross protection against incident infection by HPV types 31, 52 and 45 compared to the control. Statistically significant cross protection against incident infection was also observed against the group of all HPV 16 related types (HPV-31, 33, 35, 52 and 58) 25 and the group of all high risk types, excluding 16 and 18 (HPV 31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68). Statistically significant cross protection against persistent infection was also observed against types 31 and 52 and was also observed against the group of all HPV 16 related types (see Table E). 30 Statistically significant cross protection was observed against cytological abnormalities associated with HPV 52 and was also observed against cytological abnormalities associated with the group of all HPV 16 related types (HPV-31, 33, 35, WO 2006/114273 PCT/EP2006/003809 27 52, and 58) and the group of all high risk types, excluding 16 and 18 (31, 33, 35, 39, 45, 51, 52, 56, 58, 59, 66, and 68) (Table F). Table A HPV types analysed HPV 31, 35, HPV 31, 33, HPV 45, 59 HPV 31, 33, 35, 58 35, 52, 58 39, 45, 51, 52, 56, 58, 59, 66, 68. Number of women 5 17 3 27 infected (vaccine group) % women infected 1.1 3.8 0.7 6.3 (vaccine group) =A Number of women 11 24 6 40 infected (placebo group) % women infected 2.4 5.4 1.3 9.4 (placebo group) =B % vaccine efficacy 55.1 30.3 50.6 34.6 1 - (A/B) x 100, adjusted for relative size of vaccine and placebo group 95% confidence limits -29.1 -29.7 -97.7 -6.5 -lower limit 95% confidence limits 84.4 62.6 87.6 59.9 -upper limit P 0.127 0.252 0.309 0.086 5 Samples were taken at 9, 12, 15 and 18 months from patients and tested for HPV infection by the types specified above.
WO 2006/114273 PCT/EP2006/003809 28 Table B - vaccine efficacy after three doses in preventing incident heterologous infections. Vaccine efficacy against infection with HPV-16 phylogenetically related types, HPV-18 phylogenetically related types, HPV-16 and/or HPV-18 phylogenetically 5 related types and all high-risk types exclusive of HPV-16 and HPV-18 - ATP cohort (month 6-18) Infection Type Attack rate Vaccine efficacy Vaccine Placebo N n AR N n AR % 95% CI p-value HPV-16 related 433 12 2.8 438 24 5.5 49.4 0.2 74.4 0.060 HPV-16 related* 423 29 6.9 423 46 10.9 37.0 1.6 59.6 0.052 HPV-18 related 442 9 2.0 449 16 3.6 42.9 -27.9 74.5 0.223 HPV-16/18 related 433 21 4.9 438 41 9.4 48.2 13.8 68.9 0.012 HPV-16/18 423 34 8.0 423 56 13.2 39.3 9.0 59.5 0.019 related* High-risk** 385 53 13.8 386 88 22.8 39.6 17.755.7 0.001 N = number of subjects in specific cohort n = number of subjects with incident HPV infection AR = Attack rate = n / N 10 95% CI = 95% confidence interval lower limit = 1- exp ( log (arv / arp) + 1.96 * sqrt (1/nv - 1/Nv + 1/np - 1/Np)) upper limit = 1- exp ( log (arv / arp) - 1.96 * sqrt (1/nv - 1/Nv + 1/np - 1/Np)) when number of cases in vaccine = 0 : lower limit* = 1- exp ( log (arv* / arp*) + 1.96 * sqrt (1/(nv+0.5) - 1/(Nv+0.5) + 15 1/(np+0.5) - 1/(Np+0.5))) WO 2006/114273 PCT/EP2006/003809 29 upper limit* = 1- exp ( log (arv* / arp*) - 1.96 * sqrt (1/(nv+0.5) - 1/(Nv+0.5) + 1/(np+0.5) - 1/(Np+0.5))) with: arv = attack rate in vaccine recipients arp = attack rate in placebo recipients 5 nv = number of cases in vaccine recipients Nv = number of cases and non-cases in vaccine recipients np= number of cases in placebo recipients Np = number of cases and non-cases in placebo recipients HPV-16 related: HPV-16 phylogenetically related types 35, 31, 58 without considering other HPV 10 types HPV-16 related*: HPV-16 phylogenetically related types 35, 31, 58, 33, 52 without considering other HPV types HPV-18 related: HPV-18 phylogenetically related types 45, 59 without considering other HPV types HPV-16 and/or HPV-18 related: HPV-16 and/or HPV-18 phylogenetically related types 35, 31, 58, 15 45, 59 without considering other HPV types HPV-16 and/or HPV-18 related*: HPV-16 and/or HPV-18 phylogenetically related types 35, 31, 58, 33, 52, 45, 59 without considering other HPV types ** = High-risk types exclusive of HPV-16 and HPV-18 WO 2006/114273 PCT/EP2006/003809 30 Table C HPV types analysed HPV 31, HPV 31, 33, HPV 45, 59 HPV 31, 33, 35, 39, 35, 58 35, 52, 58 45, 51, 52, 56, 58, 59, 66, 68. Total number of number of 412 403 421 368 subjects with information available per group Number of women infected 11 28 10 58 (vaccine group) % women infected (vaccine 2.7 6.9 2.4 15.8 group) =A Number of women infected 26 48 15 90 (placebo group). % women infected (placebo 6.3 12.2 3.6 25.3 group) =B % vaccine efficacy 57.9 43.0 33.5 37.7 1 - (A/B) x 100, adjusted for relative size of vaccine and placebo group 95% confidence limits 15.9 11.0 -46.3 16.2 -lower limit 95% confidence limits 78.9 63.5 69.8 53.6 -upper limit P 0.012 0.015 0.319 0.002 Samples were taken at 18 months from patients and tested for HPV infection by the types specified above.
WO 2006/114273 PCT/EP2006/003809 31 Table D 111i1 U ilmNEW WO 2006/114273 PCT/EP2006/003809 32 Table E Vc EHMifMi- WO 2006/114273 PCT/EP2006/003809 33 Table F In tables D, E and F, 5 N = number of subjects in specific cohort AR = Attack rate = n (number of subjects with HPV either incident infection, persistent infection or cytological abnormality, as appropriate for the table) / N 10 % Vaccine efficacy is 1 - (A/B) x 100, adjusted for relative size of vaccine and placebo group, wherein A = % women in vaccine group with incident infection, persistent infection or cytological abnormality, as appropriate for the table 15 B = % women in placebo group with incident infection, persistent infection or cytological abnormality, as appropriate for the table.
Claims (45)
1. A multivalent HPV vaccine comprising L1 proteins or immunogenic fragments thereof from HPV 16, HPV 18 and at least one other oncogenic HPV type, wherein an L1 protein or immunogenic fragment thereof from one or more HPV types 5 selected from the group consisting of HPV 31, HPV 45, and HPV 52 is omitted from the vaccine and wherein the vaccine provides protection against infection caused by the omitted HPV type.
2. The vaccine according to claim 1 wherein an L1 protein or immunogenic fragment thereof from HPV 31 is omitted from the vaccine. 10
3. The vaccine according to claim 1 wherein an L1 protein or immunogenic fragment thereof from HPV 45 is omitted from the vaccine.
4. The vaccine according to claim 1 wherein an L1 protein or immunogenic fragment thereof from HPV 52 is omitted from the vaccine.
5. The vaccine according to claim 1 wherein an L1 protein or 15 immunogenic fragment thereof from HPV 31 and from HPV 45 are omitted from the vaccine.
6. The vaccine according to claim 1 wherein an L1 protein or immunogenic fragment thereof from HPV 31 and from HPV 52 are omitted from the vaccine. 20
7. The vaccine according to claim 1 wherein an L1 protein or immunogenic fragment thereof from HPV 45 and from HPV 52 are omitted from the vaccine.
8. The vaccine according to claim 1 wherein an L1 protein or immunogenic fragment thereof from HPV 31 and from HPV 45 and from HPV 52 are 25 omitted from the vaccine.
9. The vaccine according to claim 1 wherein the vaccine protects against incident infection.
10. The vaccine according to claim 1 wherein the vaccine protects against persistent infection. 30
11. The vaccine according to claim 1 wherein the other oncogenic HPV type is HPV 33. WO 2006/114273 PCT/EP2006/003809 35
12. The vaccine according to claim 1 wherein the other oncogenic HPV type is HPV 58.
13. The vaccine according to claim 1 wherein the other oncogenic HPV type is HPV 59. 5
14. The vaccine according to claim 1 comprising HPV 16 L1 protein or immunogenic fragment thereof, HPV 18 L1 protein or immunogenic fragment thereof, HPV 33 L1 protein or immunogenic fragment thereof and HPV 58 L1 protein or immunogenic fragment thereof.
15. The vaccine according to claim 1 wherein at least one of the L1 proteins 10 or fragments thereof is in the form of a virus like particle.
16. The vaccine according to claim 1 wherein at least one of the L1 proteins is a truncated L1 protein.
17. The vaccine according to claim 16 wherein the at least one L1 protein is a C terminally truncated L1 protein. 15
18. The vaccine according to claim 1 further comprising an adjuvant.
19. The vaccine according to claim 18 wherein the adjuvant is an aluminium salt.
20. The vaccine according to claim 19 wherein the adjuvant is aluminium hydroxide. 20
21. The vaccine according to claim 18 wherein the adjuvant is 3D MPL.
22. The vaccine according to claim 18 wherein the adjuvant is 3D MPL and aluminium hydroxide.
23 A vaccine according to claim 18 wherein the adjuvant is an oil in water emulsion. 25
24 A vaccine according to claim 23 wherein the adjuvant additionally comprises an aluminium salt.
25. A method to protect a patient against infection caused by HPV 16, HPV 18 and at least one other HPV type selected from the group consisting of HPV 31, HPV 45 and HPV 52, the method comprising administering the vaccine of claim 1 wherein 30 the vaccine provides protection against infection caused by the omitted HPV type.
26. The method of claim 25 wherein the omitted HPV type is HPV 31.
27. The method of claim 25 wherein the omitted HPV type is HPV 45. WO 2006/114273 PCT/EP2006/003809 36
28. The method of claim 25 wherein the omitted HPV type is HPV 52.
29. A method to prevent or reduce the frequency of cytological abnormalities in a patient caused by HPV 16, HPV 18 and at least one other HPV type selected from the group consisting of HPV 31, HPV 45 and HPV 52, the method 5 comprising administering the vaccine of claim 1 wherein the vaccine prevents or reduces the frequency of cytological abnormalities caused by the omitted HPV type.
30. The method of claim 29 wherein the omitted HPV type is HPV 52.
31. The method of claim 29 wherein the omitted HPV type is HPV 45.
32. The method of claim 29 wherein the omitted HPV type is HPV 31. 10
33. A method to prevent the formation of histologically-confirmed CIN lesions caused by HPV 16, HPV 18 and at least one other HPV type selected from the group consisting of HPV 31, HPV 45 and HPV 52, the method comprising administering the vaccine of claim 1 wherein the vaccine prevents the formation of histologically-confirmed CIN lesions caused by the omitted HPV type. 15
34. The method of claim 33 wherein the omitted HPV type is HPV 52.
35. The method of claim 33 wherein the omitted HPV type is HPV 45.
36. The method of claim 33 wherein the omitted HPV type is HPV 31.
37. A method to prevent or reduce the frequency of cytological abnormalities in a patient caused by oncogenic HPV types, the method comprising 20 administering the vaccine of claim 1.
38. A method to prevent the formation of histologically-confirmed CIN lesions in a patient caused by oncogenic HPV types, the method comprising administering the vaccine of claim 1.
39. A method to manufacture the vaccine of claim 1, the method comprising 25 combining L1 proteins or immunogenic fragments thereof from HPV 16, HPV 18 and at least one other oncogenic HPV type, wherein the vaccine does not comprise an L1 protein or immunogenic fragment thereof from one or more HPV types selected from the group consisting of HPV 31, HPV 45, and HPV 52.
40 Use of a composition comprising HPV 16 L1 and HPV 18 L1 proteins, 30 or immunogenic fragment thereof, in the preparation of a medicament for prevention of infection and/or disease caused by one or more of: HPV 31, HPV 45 or HPV 52. WO 2006/114273 PCT/EP2006/003809 37
41 Use of a vaccine comprising an HPV 16 L1 protein, or immunogenic fragment thereof, in the preparation of a medicament for the prevention of infection and/or disease caused by HPV 31, or HPV 52, or a combination thereof.
42 Use of a vaccine composition comprising an HPV 18 L1 protein, or an 5 immunogenic fragment thereof, in the preparation of a medicament for the prevention of infection and/or disease caused by HPV 45.
43 Use of a vaccine according to claim 40 in the manufacture of a medicament for the prevention of cytological abnormalities or reduction of the frequency of cytological abnormalities in an individual caused by a type other than 10 HPV 16 and HPV 18.
44 Use of a vaccine or combination according to claim 40 in the manufacture of a medicament for the prevention of histologically-confirmed CIN lesions (CIN 1, CIN 2, CIN 3) caused by a type other than HPV 16 and HPV 18.
45 Use according to any of claims 40 - 44 wherein the composition 15 comprising L1 proteins or immunogenic fragments thereof from HPV 16, HPV 18 and at least one other oncogenic HPV type, wherein an L1 protein or immunogenic fragment thereof from one or more HPV types selected from the group consisting of HPV 31, HPV 45, and HPV 52 is omitted from the vaccine and wherein the vaccine provides protection against infection and/or disease caused by the omitted HPV type. 20
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/114,301 US20050287161A1 (en) | 2002-12-20 | 2005-04-26 | Vaccine |
US11/114,301 | 2005-04-26 | ||
PCT/EP2005/006461 WO2005123125A1 (en) | 2004-06-16 | 2005-06-14 | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 |
AUPCT/EP2005/006461 | 2005-06-14 | ||
US11/367,601 US7858098B2 (en) | 2002-12-20 | 2005-12-16 | Vaccine |
US11/367,601 | 2005-12-16 | ||
PCT/EP2006/003809 WO2006114273A2 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2006239471A1 true AU2006239471A1 (en) | 2006-11-02 |
Family
ID=37199195
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2006239471A Abandoned AU2006239471A1 (en) | 2005-04-26 | 2006-04-24 | Vaccine |
Country Status (12)
Country | Link |
---|---|
EP (1) | EP1879614A2 (en) |
JP (1) | JP2008539182A (en) |
KR (1) | KR20080005583A (en) |
AR (1) | AR053715A1 (en) |
AU (1) | AU2006239471A1 (en) |
CA (1) | CA2606206A1 (en) |
EA (1) | EA013325B1 (en) |
MX (1) | MX2007013475A (en) |
NO (1) | NO20075185L (en) |
SG (1) | SG159529A1 (en) |
UY (1) | UY29499A1 (en) |
WO (1) | WO2006114273A2 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2010147268A1 (en) * | 2009-06-19 | 2010-12-23 | 아이진 주식회사 | Vaccine for cervical cancer |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9921146D0 (en) * | 1999-09-07 | 1999-11-10 | Smithkline Beecham Biolog | Novel composition |
US6908613B2 (en) * | 2000-06-21 | 2005-06-21 | Medimmune, Inc. | Chimeric human papillomavirus (HPV) L1 molecules and uses therefor |
GB0206360D0 (en) * | 2002-03-18 | 2002-05-01 | Glaxosmithkline Biolog Sa | Viral antigens |
ATE503492T1 (en) * | 2002-12-20 | 2011-04-15 | Glaxosmithkline Biolog Sa | USE OF HPV16 AND HPV18 VLPS AS VACCINES AGAINST ONE OR MORE ONCOGENIC HPV TYPE 31,33, 35, 39, 45, 51, 52, 56, 58, 59, 66, 68 |
PL1758609T3 (en) * | 2004-06-16 | 2013-02-28 | Glaxosmithkline Biologicals Sa | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 |
-
2006
- 2006-04-24 MX MX2007013475A patent/MX2007013475A/en unknown
- 2006-04-24 AR ARP060101618A patent/AR053715A1/en not_active Application Discontinuation
- 2006-04-24 KR KR1020077027492A patent/KR20080005583A/en not_active Application Discontinuation
- 2006-04-24 WO PCT/EP2006/003809 patent/WO2006114273A2/en active Application Filing
- 2006-04-24 JP JP2008508138A patent/JP2008539182A/en active Pending
- 2006-04-24 EA EA200702077A patent/EA013325B1/en unknown
- 2006-04-24 EP EP06753410A patent/EP1879614A2/en not_active Ceased
- 2006-04-24 AU AU2006239471A patent/AU2006239471A1/en not_active Abandoned
- 2006-04-24 SG SG201000826-6A patent/SG159529A1/en unknown
- 2006-04-24 CA CA002606206A patent/CA2606206A1/en not_active Abandoned
- 2006-04-26 UY UY29499A patent/UY29499A1/en not_active Application Discontinuation
-
2007
- 2007-10-11 NO NO20075185A patent/NO20075185L/en not_active Application Discontinuation
Also Published As
Publication number | Publication date |
---|---|
NO20075185L (en) | 2008-01-25 |
EA200702077A1 (en) | 2008-04-28 |
WO2006114273A2 (en) | 2006-11-02 |
MX2007013475A (en) | 2008-04-02 |
CA2606206A1 (en) | 2006-11-02 |
WO2006114273A3 (en) | 2007-03-15 |
KR20080005583A (en) | 2008-01-14 |
EA013325B1 (en) | 2010-04-30 |
EP1879614A2 (en) | 2008-01-23 |
SG159529A1 (en) | 2010-03-30 |
JP2008539182A (en) | 2008-11-13 |
UY29499A1 (en) | 2006-11-30 |
AR053715A1 (en) | 2007-05-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20050287161A1 (en) | Vaccine | |
EP1758609B1 (en) | Vaccine against hpv16 and hpv18 and at least another hpv type selected from hpv 31, 45 or 52 | |
US20090181052A1 (en) | Vaccine | |
KR101359943B1 (en) | Vaccine against hpv 16 and hpv 18 and at least another hpv type selected from hpv 31, 45 or 52 | |
US7858098B2 (en) | Vaccine | |
US7758866B2 (en) | Vaccine against HPV16 and HPV18 and at least another HPV type selected from HPV 31, 45 or 52 | |
AU2006239471A1 (en) | Vaccine | |
CN101217975A (en) | Vaccine | |
BRPI0610032A2 (en) | use of a human papillomavirus l1 protein or immunogenic fragment thereof from a first type of hpv, vaccination program for protection against hiv infection and / or disease, method for preventing hpv infection and / or disease, vaccine composition and kit | |
BRPI0610396A2 (en) | multivalent hpv vaccine, methods to protect a patient against infection, to prevent or reduce the frequency of cytological abnormalities in a patient, to prevent the formation of histologically confirmed lesions and to manufacture the vaccine, and, uses of a composition, to a vaccine and a vaccine composition |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK4 | Application lapsed section 142(2)(d) - no continuation fee paid for the application |