WO2004084835A2 - Treating immunological disorder using agonists of interleukin-21/ interleukin-21 receptor - Google Patents

Treating immunological disorder using agonists of interleukin-21/ interleukin-21 receptor Download PDF

Info

Publication number
WO2004084835A2
WO2004084835A2 PCT/US2004/008833 US2004008833W WO2004084835A2 WO 2004084835 A2 WO2004084835 A2 WO 2004084835A2 US 2004008833 W US2004008833 W US 2004008833W WO 2004084835 A2 WO2004084835 A2 WO 2004084835A2
Authority
WO
WIPO (PCT)
Prior art keywords
agonist
polypeptide
subject
antibody
human
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2004/008833
Other languages
English (en)
French (fr)
Other versions
WO2004084835A3 (en
Inventor
Mary Collins
Elaine Y. Chin
Mayra Senices
Deborah A. Young
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Wyeth LLC
Original Assignee
Wyeth LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA002518854A priority Critical patent/CA2518854A1/en
Priority to EP04758055A priority patent/EP1608315A4/en
Priority to JP2006507478A priority patent/JP2006523682A/ja
Priority to AU2004224277A priority patent/AU2004224277A1/en
Priority to BRPI0408523-0A priority patent/BRPI0408523A/pt
Priority to MXPA05010035A priority patent/MXPA05010035A/es
Application filed by Wyeth LLC filed Critical Wyeth LLC
Publication of WO2004084835A2 publication Critical patent/WO2004084835A2/en
Priority to NO20054343A priority patent/NO20054343L/no
Anticipated expiration legal-status Critical
Publication of WO2004084835A3 publication Critical patent/WO2004084835A3/en
Priority to IL198102A priority patent/IL198102A0/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/42Oxazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/4353Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/436Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • A61K31/4738Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/4745Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • A61K31/525Isoalloxazines, e.g. riboflavins, vitamin B2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/02Peptides of undefined number of amino acids; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1793Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/21Interferons [IFN]
    • A61K38/215IFN-beta
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00

Definitions

  • the present invention relates to methods and compositions for treating or preventing immunological disorders of the nervous system, e.g., multiple sclerosis, using IL-21/IL-21 receptor agonists, e.g., an IL-21 polypeptide or an active fragment thereof.
  • IL-21/IL-21 receptor agonists e.g., an IL-21 polypeptide or an active fragment thereof.
  • Human IL-21 is a cytokine. In its mature form, it is about 131-amino acids in length and has sequence homo logy to IL-2, IL-4 and IL-15 (Parrish-Novak et al. (2000) Nature 408:57-63). Despite low sequence homology among interleukin cytokines, these cytokines share a common fold that includes a characteristic "four-helix-bundle" structure. Most cytokines bind to either class I or class II cytokine receptors.
  • Class II cytokine receptors include the receptors for EL- 10 and the interferons, whereas class I cytokine receptors include the receptors for IL-2, IL-7, EL-9, IL-11-13, and IL-15, as well as the hematopoietic growth factors, leptin and growth hormone (Cosman, D. (1993) Cytokine 5:95-106).
  • Human IL-21R is a class I cytokine receptor that is expressed by lymphoid cells, particularly by NK, B and T cells (Parrish-Novak et al. (2000) supra).
  • Exemplary nucleic acid sequences encoding human interleukin-21 (EL-21) and its receptor (IL-21R) are described in WO 00/53761, WO 01/85792, Parrish-Novak et al. (2000) supra, and Ozaki et al. (2000) Proc. Natl. Acad. Sci. USA 97: 11439-11444, as are the corresponding amino acid sequences.
  • EL-21 R shows high sequence homology to EL-2 receptor ⁇ chain and IL-4 receptor ⁇ chain (Ozaki et al.
  • IL-21R associates with the common gamma cytokine receptor chain ( ⁇ c) that is shared by receptors for IL-2, EL-3, IL-4, IL-7, IL-9, EL-13 and IL-15 (Ozaki et al. (200O) supra; Asao et al. (2001) J. Immunol. 167:1-5).
  • ⁇ c common gamma cytokine receptor chain
  • IL-21 may play a role in immune regulation. Indeed, in vitro studies have shown that IL-21 significantly modulates the function of B cells, CD4 + and CD8 + T cells, and NK cells (Parrish-Novak et al.
  • Parrish-Novak et al. (2000) suggested that IL-21 functions to activate or stimulate the proliferation and maturation of natural killer (NK) cells, the proliferation of mature B-cell populations co-stimulated with anti-CD40, and the proliferation of T cells co-stimulated with anti-CD3.
  • NK natural killer
  • IL-21 interleukin-21
  • EL-21 R EL-21 receptor
  • MU-1 EL-21 receptor
  • agonists of EL-21 or EL-21 R are disclosed (also referred to herein as an "IL-21/IL-21R agonist" or "agonist”).
  • Such methods and compositions can be used to modulate an immunological disorder of the nervous system or a disease or disorder associated with an IL-10 deficiency.
  • the methods and compositions can be used to treat or prevent multiple sclerosis (MS).
  • mice prophylactically with an EL-21/EL-21R agonist results in an amelioration of symptoms in mouse models for experimental autoimmune encephalomyelitis (EAE).
  • EAE experimental autoimmune encephalomyelitis
  • MOG myelin oligodendrocyte glycoprotein
  • PLP proteolipid protein
  • IL-21 induced proliferation of T cells in vitro.
  • Lymphocytes cultured in the presence of EL-21 produced increased amounts of EL- 10 and decreased levels of interferon- ⁇ (EFN- ⁇ ).
  • agonists of EL-21 /EL-21 R activity can be used prophylactically or therapeutically to treat immunological disorders of the nervous system (e.g., chronic immunological disorders of the nervous system, including multiple sclerosis).
  • the invention features a method of treating (e.g., curing, suppressing, ameliorating, reducing, or delaying) or preventing (e.g., preventing the onset of, or preventing recurrence or relapse of) an immunological disorder of the nervous system (e.g., a chronic immunological disorder of the nervous system, including multiple sclerosis), in a subject.
  • an immunological disorder of the nervous system e.g., a chronic immunological disorder of the nervous system, including multiple sclerosis
  • the method includes: administering to the subject an IL-21/IL-21R agonist, in an amount sufficient to modulate immune cell activity and/or number (e.g., to modulate cytokine levels, e.g., cytokine expression, production and/or release), thereby treating or preventing the immunological disorder of the nervous system, e.g., multiple sclerosis.
  • the IL-21/EL-21R agonist is administered before the onset of symptoms to, e.g., delay or prevent the onset of, or prevent recurrence or relapse of, symptoms.
  • the IL-21/EL-21R agonist can be administered when a subject, e.g., an MS patient, is in remission.
  • the IL-21 /IL-2 IR agonist is administered after the onset of symptoms or an attack.
  • Exemplary general symptoms of MS include tremor, poor coordination, difficulty walking, and other problems.
  • the IL-21/EL-21R agonist can be administered to the subject, alone or in combination, with other therapeutic modalities as described herein.
  • the subject is a mammal, e.g., a human suffering from an immunological disorder of the nervous system, e.g., multiple sclerosis.
  • the EL-21/IL-21R agonist interacts with, e.g., binds to, IL-21 or EL-21 R, preferably, mammalian, e.g., human EL-21 or EL-21 R, and increases or potentiates one or more EL-21 and/or IL-21R activities.
  • An agonist of EL-21 is referred to herein as an "EL-21 agonist," and an agonist of EL-21R is referred to as a "EL-21R agonist.”
  • An IL-21 polypeptide is itself an EL-21 R agonist.
  • Preferred agonists bind to EL-21 or IL-21R with high affinity, e.g., with an affinity constant of at least about 10 7 M "1 , preferably about 10 8 M “1 , and more preferably, about 10 9 M "1 to 10 10 M "1 or stronger.
  • the EL-21/EL-21R agonist can be, e.g., an EL-21 polypeptide or an active fragment thereof, an EL-21 fusion protein, a peptide agonist, an antibody agonist or antigen-binding fragment thereof, or a small molecule agonist.
  • the IL-21/IL-21R agonist is an IL-21 polypeptide, e.g., a human, bovine or murine IL-21 polypeptide, or an active fragment thereof (e.g., a human IL-21 polypeptide comprising the amino acid sequence shown as SEQ ED NO:2, or encoded by a nucleotide sequence shown as SEQ ID NO: 1 , or a sequence at least 85%, 90%, 95%, 98% or more identical thereto).
  • the IL-21 polypeptide e.g., a human, bovine or murine IL-21 polypeptide, or an active fragment thereof (e.g., a human IL-21 polypeptide comprising the amino acid sequence shown as SEQ ED NO:2, or encoded by a nucleotide sequence shown as SEQ ID NO: 1 , or a sequence at least 85%, 90%, 95%, 98% or more identical thereto).
  • the IL-21 polypeptide e.g., a human, bovine or murine
  • IL-21/IL-21R agonist is a murine IL-21 polypeptide or an active fragment thereof (e.g., a murine IL-21 polypeptide comprising the amino acid sequence shown as SEQ ID NO:4, or encoded by a nucleotide sequence shown as SEQ ID NO:3, or a sequence at least 85%, 90%, 95%, 98% or more identical thereto).
  • the IL-21 /IL-2 IR agonist is a fusion protein comprising an IL-21 polypeptide, e.g., human or murine EL-21 polypeptide, or a fragment thereof and, e.g., fused to, a second moiety, e.g., a polypeptide (e.g., a GST, Lex-A, MBP polypeptide sequence or an immunoglobulin chain, including, e.g., an Fc fragment, a heavy chain constant regions of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE); an agonist antibody or antigen-binding fragment thereof, that binds to the IL-21 receptor; or a small molecule or peptide agonist.
  • a polypeptide e.g., a GST, Lex-A, MBP polypeptide sequence or an immunoglobulin chain, including, e.g.
  • the IL-21 /IL-2 IR agonist is an agent that increases the activity or levels of IL-21 by, e.g., increasing expression, processing and/or secretion of functional EL-21.
  • Nucleic acids encoding the aforesaid EL-21 /IL-2 IR agonists can also be administered to the subject.
  • the fusion proteins may additionally include a linker sequence joining the first moiety, e.g., an EL-21 fragment, to the second moiety, e.g., an immunoglobulin fragment.
  • additional amino acid sequences can be added to the N- or C-terminus of the fusion protein to facilitate expression, steric flexibility, detection and/or isolation or purification.
  • the EL-21/EL-21R agonists described herein can be derivatized or linked to another functional molecule, e.g., another peptide or protein (e.g., an Fab' fragment).
  • another functional molecule e.g., another peptide or protein (e.g., an Fab' fragment).
  • the fusion protein or an antibody, or antigen-binding portion can be functionally linked (e.g., by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as an antibody (e.g., a bispecific or a multi-specific antibody), toxins, radioisotopes, cytotoxic or cytostatic agents, among others.
  • the IL-21/EL-21R agonist is an antibody, e.g., an agonistic antibody, or antigen-binding fragment thereof, to IL-21R, preferably, human IL-21R.
  • the antibody or antigen-binding fragment thereof can be a humanized, chimeric, human (e.g., in vitro generated) antibody, or antigen-binding fragment thereof.
  • the antibody is a bispecific antibody, e.g., an antibody that interacts with IL-21R and another receptor chain.
  • the method includes evaluating the subject for an IL-10 parameter.
  • An "IL-10 parameter" is qualitative or quantitative information about IL-10 levels or activity, e.g., IL-10 mRNA or protein levels or activity.
  • the information can include, for example, concentration of IL-10 in one more tissues or one or more samples from a subject.
  • the subject can be evaluated, for example, before the administering, e.g., at least before administering a first dose.
  • the subject can be evaluated, e.g., after the administering, e.g., at after administering one or more doses, e.g., at regular intervals, or in the case of continuous administration, after one or more intervals.
  • the subject can be evaluated both before and after an administration.
  • Information from evaluating an EL- 10 parameter can be used to modulate administration of the IL-21/EL-21R agonist.
  • an increase in an IL-10 parameter to a value in the range of normal can indicate that a desired therapeutic effect.
  • a decrease in an EL- 10 parameter can indicate insufficient administration or non-responsiveness.
  • a decrease in an EFN ⁇ parameter to a value in the range of normal can indicate that a desired therapeutic effect.
  • a increase in an EFN ⁇ parameter can indicate insufficient administration or non-responsiveness.
  • the method includes evaluating the subject for a risk of an immunological disorder of the nervous system (e.g., of multiple sclerosis), or one or more symptoms of such a disorder.
  • One method of evaluating risk includes evaluating an EL- 10 parameter.
  • the EL-21 /EL-21 R agonist is administered in response to an alteration in status of a subject, e.g., in response to a flare-up or attack associated with MS.
  • the IL-21/EL-21R agonist(s) can be administered in the form of a single dose, or a series of doses separated by intervals of days, weeks or months.
  • the IL-21/EL-21R agonist(s) can be administered by injection, e.g., by injection into the central nervous system, of a subject.
  • the IL-21/IL-21R agonist(s) can be injected into the lumbar cerebrospinal fluid (intrathetically).
  • the IL-21 /IL-2 IR agonist(s) is administered intravenously.
  • the IL-21/IL-21R agonists described herein, e.g., the pharmaceutical compositions thereof are administered in combination therapy, i.e., combined with other agents, e.g., therapeutic agents, which are useful for treating or preventing an immunological disorder of the nervous system, e.g., multiple sclerosis.
  • the combination therapy can include one or more IL-21 /IL-2 IR agonists, e.g., an IL-21 polypeptide or active fragment thereof, an EL-21 fusion protein, a peptide agonist, an antibody agonist, or a small molecule agonist) co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents, as described in more herein.
  • additional therapeutic agents e.g., one or more cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents, as described in more herein.
  • Examples of therapeutic agents that can be co-administered and/or co- formulated with one or more EL-21/EL-21R agonists to treat multiple sclerosis include, but are not limited to, one or more of: interferon- ⁇ , for example, IFN ⁇ -l ⁇ and IFN ⁇ - 1 ⁇ ; a protein that simulates myelin basic protein (e.g., a synthetic protein, e.g., glatiramer acetate, COPAXONE ® ); corticosteroids; EL-1 inhibitors; TNF inhibitors; antibodies to CD40 ligand and CD80; antagonists of EL- 12 and IL-23, e.g., antagonists of a p40 subunit of EL- 12 and EL-23 (e.g., inhibitory antibodies against the p40 subunit); EL-22 antagonists; small molecule inhibitors, e.g., methotrexate, leflunomide, sirolimus (rapamycin) and analogs thereof, e.
  • TNF inhibitors include, e.g., chimeric, humanized, effectively human, human or in vitro generated antibodies, or antigen-binding fragments thereof, that bind to TNF; soluble fragments of a TNF receptor, e.g., p55 or p75 human TNF receptor or derivatives thereof, e.g., 75 kdTNFR-IgG (75 kD TNF receptor-IgG fusion protein, ENBRELTM), p55 kD TNF receptor-IgG fusion protein; and TNF enzyme antagonists, e.g., TNF ⁇ converting enzyme (TACE) inhibitors.
  • TNF receptor e.g., chimeric, humanized, effectively human, human or in vitro generated antibodies, or antigen-binding fragments thereof, that bind to TNF
  • soluble fragments of a TNF receptor e.g., p55 or p75 human TNF receptor or derivatives thereof, e.g., 75 kdTNFR-Ig
  • Additional therapeutic agents that can be co-administered and/or co-formulated with one or more IL-21 /IL-2 IR agonists include one or more of: interferon- ⁇ , for example, IFN ⁇ -l ⁇ and IFN ⁇ -l ⁇ ; COPAXONE ® ; corticosteroids; IL-1 inhibitors; TNF antagonists (e.g., a soluble fragment of a TNF receptor, e.g., p55 or p75 human TNF receptor or derivatives thereof, e.g., 75 kdTNFR-IgG (75 kD TNF receptor-IgG fusion protein, ENBRELTM)); antibodies to CD40 ligand and CD80; and antagonists of IL-12 and/or IL-23, e.g., antagonists of a p40 subunit of IL-12 and IL-23 (e.g., inhibitory antibodies that bind to the ⁇ 40 subunit of IL-12 and IL-23); methotrex
  • the invention features a method for modulating, e.g., increasing or decreasing, immune cell activity and/or number (e.g., the activity and/or number of an immune cell, e.g., a lymphocyte (e.g., a T cell) or a population of immune cells, e.g., a mixed or a substantially purified immune cell population.
  • the method includes contacting an immune cell, e.g., an immune cell as described herein, with an EL-21/IL-21R agonist, e.g., an agonist as described herein, in an amount sufficient to modulate, e.g., increase or decrease, immune cell activity and/or number.
  • the activity includes modulation, e.g., increase or decrease, of cytokine activity or levels.
  • the IL-21/EL-21R agonist may increase lymphocytic production or levels of IL-10 and/or decrease production or levels of interferon- ⁇ .
  • the subject method can be used on cells in culture, e.g. in vitro or ex vivo.
  • immune cells e.g., T cells as described herein
  • the contacting step can be effected by adding one or more
  • IL-21/IL-21R agonist(s) e.g., an agonist as described herein, to the culture medium.
  • the method can be performed on cells (e.g., immune cells as described herein) present in a subject, e.g., as part of an in vivo (e.g., therapeutic or prophylactic) protocol.
  • a change in immune cell activity includes any variation(s), e.g., increase/decrease, in one or more of: proliferation, cytokine secretion and/or production, survival, differentiation, cell responsiveness (e.g., desensitization), cytolytic activity, effector cell activity, gene expression, among others, of the immune cell contacted with an IL-21/EL-21R agonist compared to a reference, e.g., an untreated immune cell.
  • contacting an immune cell with an EL-21 /IL-2 IR agonist e.g., an IL-21 polypeptide
  • an EL-21 /IL-2 IR agonist e.g., an IL-21 polypeptide
  • the IL-21 /IL-2 IR agonist may increase lymphocytic production or levels of EL- 10 and/or decrease production or levels of interferon- ⁇ .
  • the invention features a method of modulating an EL- 10 deficiency, or a disorder associated with an IL-10 deficiency in a mammalian subject.
  • the method includes administering to the subject an interleukin-21 (EL-21) polypeptide in an amount sufficient to increase IL-10 expression or activity in the subject, e.g., at least 1.2, 1.5, 2, 2.5, 3, 3.5, 5, or 10 fold increase, e.g., between a 1.2-2.5 fold increase or between a 2.5-5 fold increase, a 5-10 fold increase, or a greater than 10 or 20 fold increase.
  • EL- 10 deficiency is a statistically significant decrease in EL- 10 relative to a corresponding normal subject.
  • the decrease can have a P value of less than 0.05.
  • IL-21 or other IL-21 /IL-2 IR agonists can be used to increase IL- 10 levels or activity, IL-21 and such agonists can be used to modulate an IL-10 deficiency.
  • EL- 10 levels can be monitored, for example, in blood, serum, or cerebrospinal fluid.
  • Exemplary disorders that can be associated with an EL- 10 deficiency include multiple sclerosis, significant inflammatory events (including ischemia-reperfusion injury), psoriasis and pemphingus.
  • EL-21 can increase EL-10 levels, EL-21 can be used to treat at least one symptom of these disorders and others associated with an EL-10 deficiency.
  • the invention features a method of ameliorating multiple sclerosis in a mammalian subject, e.g., a human.
  • the method includes: administering to the subject an interleukin-21 (EL-21) polypeptide in an amount sufficient to ameliorate multiple sclerosis, or at least one symptom of multiple sclerosis in the subject.
  • the EL-21 polypeptide can be a human IL-21 polypeptide, e.g., a polypeptide that includes SEQ ID NO:2, or an effectively human EL-21 polypeptide.
  • the polypeptide is recombinantly produced, e.g., in a bacterial cell.
  • the method includes administering to the subject an interleukin-21 (IL-21) polypeptide in an amount sufficient to increase IL-10 expression or activity in the subject, e.g., at least 1.2, 1.5, 2, 2.5, 3, 3.5, 5, or 10 fold increase, e.g., between a 1.2-2.5 fold increase or between a 2.5- 5 fold increase, a 5-10 fold increase, or a greater than 10 or 20 fold increase.
  • IL-21 interleukin-21
  • the method can include other features described herein.
  • the invention features amethod of treating or preventing an immunological disorder in a mammalian subject.
  • the method includes evaluating an IL-10 parameter in a mammalian subject; and administering, to the subject, an interleukin-21 (IL-21) polypeptide in an amount that is dependent on results of the evaluated IL-10 parameter.
  • the IL-10 parameter includes qualitative or quantitative information about levels of EL-10 protein or IL-10 mRNA.
  • the EL-10 parameter includes quantitative information about levels of IL-10 protein activity.
  • the immunological disorder is a neurological disorder.
  • the subject is human and the immunological disorder is multiple sclerosis or a immunological disorder causes damage or alteration to myelin sheaths.
  • the method can include other features described herein.
  • the invention features a method of evaluating treatment of multiple sclerosis in a mammalian subject.
  • the method includes: administering, to the subject, an agonist of an interleukin-21 (EL-21)/EL-21 receptor (IL-21R) (e.g., an EL-21 polypeptide, an agonistic anti-IL-21R antibody and an antigen-binding fragment of an agonistic anti-IL-21R antibody); and evaluating an EL-10 parameter in the subject.
  • the method further includes administering to the subject a second dose of the agonist, wherein the second dose is administered as a function of the evaluated EL-10 parameter.
  • the subject is human
  • the EL-21 polypeptide is a human IL-21 polypeptide, e.g., a polypeptide that includes SEQ ID NO:2.
  • the second dose or any subsequent dose is tailored to deliver an interleukin-21 (EL-21) polypeptide in an amount sufficient to increase EL-10 expression or activity in the subject, e.g., at least 1.2, 1.5, 2, 2.5, 3, 3.5, 5, or 10 fold increase, e.g., between a 1.2-2.5 fold increase or between a 2.5-5 fold increase, a 5-10 fold increase, or a greater than 10 or 20 fold increase, e.g., relative to a baseline, e.g., prior to a first treatment.
  • the first dose is so tailored.
  • the method can include other features described herein.
  • compositions e.g., pharmaceutical compositions, which include a pharmaceutically acceptable carrier and at least one of IL-21/IL-21R agonist as described herein (e.g., an EL-21 polypeptide or fusion protein described herein).
  • the compositions e.g., pharmaceutical compositions, comprise a combination of two or more one of the aforesaid IL-21/IL-21R agonists.
  • Combinations of the IL-21/EL-21R agonists and a drug e.g., a therapeutic agent (e.g., one or more cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents, as described in more herein) are also within the scope of the invention.
  • a therapeutic agent e.g., one or more cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents, as described in more herein
  • the pharmaceutical composition includes an IL-21 /IL-2 IR agonist and at least one additional therapeutic agent, in a pharmaceutically-acceptable carrier.
  • additional therapeutic agents that can be co-formulated in a composition, e.g., a pharmaceutical composition, with one or more IL-21/IL-21R agonists, include, but are not limited to, one or more of: interferon- ⁇ , for example, EFN ⁇ -l ⁇ and EFN ⁇ -l ⁇ ; a protein that simulates myelin basic protein (e.g., COPAXONE®); corticosteroids; IL-1 inhibitors; TNF antagonists (e.g., a soluble fragment of a TNF receptor, e.g., p55 or p75 human TNF receptor or derivatives thereof, e.g., 75 kdTNFR-IgG (75 kD TNF receptor-IgG fusion protein, ENBRELTM)); antibodies that bind to CD40 ligand and CD80; and antagonists of IL
  • the invention features an article of manufacture that includes (i) a container with one or more unit doses of a pharmaceutical composition comprising an IL-21 polypeptide; and (ii) instructions for administering the unit doses to a subject that has, or is suspected of having, multiple sclerosis.
  • the instructions are provided on a label.
  • the label can be affixed to an external surface of the container.
  • the article further includes a second container, e.g., containing an additional unit dose of a pharmaceutical composition comprising an IL-21 polypeptide.
  • the article further includes a second container that includes a second pharmaceutical composition comprising an agent for treating multiple sclerosis, i.e., an agent other than IL-21.
  • the agent is glatiramer acetate or another agent described herein.
  • the pharmaceutical composition that includes an IL-21 polypeptide, in the first container further includes a second agent agent for treating multiple sclerosis, e.g., glatiramer acetate.
  • MU-1 and "EL-21 R” are used interchangeably herein.
  • peptides and “proteins” are used interchangeably herein.
  • a protein can include one or more chains.
  • Statistical significance can be determined by any art known method. Exemplary statistical tests include: the Students T-test, Mann Whitney U non-parametric test, and Wilcoxon non-parametric statistical test. Some statistically significant relationships have a P value of less than 0.05 or 0.02. Particular effects mediated by an IL-21/EL-21R agonist may show a difference that is statistically significant (e.g., P value ⁇ 0.05 or 0.02).
  • Figure I A is a linear graph depicting the increased proliferation of lymph node cells cultured in the presence of 20 ng/ml of murine IL-21 at various dilutions. For example, at a 1:50 dilution, IL-21 caused increased proliferation of lymph node cells as compared to cells stimulated with peptide alone.
  • Figure IB is a linear graph depicting the increased proliferation of T cells from proteolipid protein (PLP) transgenic mice cultured at the indicated concentration of murine IL-21 (ng/ml) and 1 ⁇ g/ml of PLP compared to cells treated with only 1 ⁇ g/ml of PLP.
  • the graph shows that IL-21 induces proliferation of T cells from PLP transgenic mice.
  • Figure 2 is a bar graph depicting the increased secretion of IL-10 in the presence of the indicated concentrations of mouse IL-21 as compared to untreated cells. The response was saturable and at the highest tested concentration of IL-21 (25 ng/ml), cells produced approximately 2.5-fold more IL-10 than the control group. Production of increased levels of IL-10 suggests that IL-21 treatment can skew antigen-specific cells towards a Th2 profile.
  • Figure 3 is a bar graph showing a decrease in secretion of EFN ⁇ by spleen cells and lymph node cells treated with the indicated concentrations of murine EL-21 compared to control cells. Addition of EL-21 to MOG 33-55-stimulated spleen cells from immunized mice results in a two-fold decrease of IFN ⁇ , whereas addition of EL-21R causes a two-fold increase.
  • Figure 4 depicts a reduction in clinical symptoms of disease in an EAE model.
  • the figure shows that IL-21 suppresses IFN ⁇ and enhances IL-10.
  • Figure 4 is a linear graph showing the decrease in EAE symptoms detected in IL-21 -treated PLP spleen cells compared to untreated cultures with respect to the days post in vivo transfer.
  • Figure 5 depicts a reduction in clinical symptoms of disease in an EAE model. It is a bar graph depicting a decrease in the severity of EAE in mice treated with either a low (100 ng/day) or high (1 ⁇ g /day) dose of murine IL-21 compared to control mice.
  • EL-21 interleukin-21
  • MU-1 EL-21 receptor
  • Applicants have shown that treatment of mice with an IL-21/IL-21R agonist, e.g., murine IL-21 polypeptide, results in an amelioration of symptoms in mouse models for experimental autoimmune encephalomyelitis (EAE).
  • EAE autoimmune encephalomyelitis
  • the modulation of EAE symptoms was detected in mouse models generated using myelin oligodendrocyte glycoprotein (MOG) peptide (e.g., MOG 35-55) and proteolipid protein (PLP).
  • MOG myelin oligodendrocyte glycoprotein
  • PGP proteolipid protein
  • Lymphocytes cultured in the presence of IL-21 produced increased amounts of IL-10 and decreased levels of interferon- ⁇ . Accordingly, agonists of IL-21 /IL-21 R activity can be used to treat or prevent immunological disorders of the nervous system (e.g., chronic immunological disorders of the nervous system, including multiple sclerosis).
  • immunological disorders of the nervous system e.g., chronic immunological disorders of the nervous system, including multiple sclerosis.
  • interleukin-21 refers to a protein (e.g., a mammalian, e.g., murine or human protein) which is capable of interacting with, e.g., binding to, EL-21R (e.g., a mammalian, e.g., murine or human protein) and having one of the following features: (i) an amino acid sequence of a naturally occurring mammalian EL-21 or a fragment thereof, e.g., an amino acid sequence shown as SEQ ED NO:2 (human) or SEQ ED NO:4 (murine) or a fragment thereof; (ii) an amino acid sequence substantially homologous to, e.g., at least 85%, 90%, 95%, 98%, 99% homologous to, an amino acid sequence shown as SEQ ID NO:2 (human) or SEQ ID NO:4 (murine) or a fragment thereof; (iii) an amino acid sequence which is encoded
  • IL-21 binding to EL-21R can lead to stat5 or stat3 signaling (Ozaki et al. (2000) supra).
  • IL-21 polypeptide can be processed from a nascent protein that includes a signal sequence to a mature protein, from which the signal sequence has been removed.
  • An "effectively human" EL-21 polypeptide is an EL-21 polypeptide that includes a sufficient number of human amino acid positions such that the polypeptide does not elicit an immunogenic response in a normal human and so that the U-21 polypeptide interacts with a human IL-21R.
  • MU-1 refers to a receptor (e.g., of mammalian, e.g., murine or human origin) which is capable of interacting with, e.g., binding to, EL-21 (e.g., of mammalian, e.g., murine or human EL-21) and having one of the following features: (i) an amino acid sequence of a naturally occurring mammalian MU-1 polypeptide EL-21R/MU-1 or a fragment thereof, e.g., an amino acid sequence shown as SEQ ED NO:6 (human) or SEQ ID NO:8 (murine) or a fragment thereof (e.g., the mature region); (ii) an amino acid sequence substantially homologous to, e.g., at least 85%, 90%, 95%, 98%, 99% homologous to, an amino acid sequence shown as SEQ ED NO:6 (human) or SEQ ED NO:8
  • An exemplary IL-21R/MU-1 cDNA was deposited with the American Type Culture Collection on Mar. 10, 1998, as accession number ATCC 98687.
  • IL-21R is a class I cytokine family receptor, also known as NILR (WO 01/85792; Parrish-Novak et al. (2000) Nature 408:57-63; Ozaki et al. (2000) Proc. Natl. Acad. Sci. USA 97:11439-11444).
  • IL-21R is homologous to the shared ⁇ chain of the EL-2 and IL-15 receptors, and EL-4 receptor ⁇ chain (Ozaki et al. (2000) supra).
  • IL-21 R/MU-1 Upon ligand binding, IL-21 R/MU-1 is capable of interacting with a common ⁇ cytokine receptor chain ( ⁇ c) (Asao et al. (2001) J Immunol.
  • IL-21R shows widespread lymphoid tissue distribution.
  • IL-21 proteins of less than full length can be used in the methods and compositions, described herein, provided that it retains the ability to bind to an EL-21R polypeptide.
  • EL-21 proteins of less than full length can be produced by expressing a corresponding fragment of the polynucleotide encoding the full-length IL-21 protein in a host cell, or by expressing a polynucleotide encoding a modified protein (e.g., if one or more internal amino acids are removed).
  • One form of EL-21 polypeptide that is less than full length is mature IL-21, e.g., an IL-21 of SEQ ED NO:2.
  • Another form is a polypeptide that is shorter than a full-length, mature EL-21, e.g., less than 131, 130, 129, 128, or 125 amino acids, e.g., between 115 and 130 amino acids in length.
  • an EL-21 polypeptide derived from SEQ ED NO:2 can be missing the final eight amino acids, or a subset thereof, e.g., the EL-21 polypeptide comprises amino acids 1-122.
  • the corresponding polynucleotide fragments can also be used in the methods and compositions of the present invention. Modified polynucleotides as described above may be made by standard molecular biology techniques, including construction of appropriate desired deletion mutants, site-directed mutagenesis methods or by the polymerase chain reaction using appropriate oligonucleotide primers.
  • a biological activity of a MU-1 or IL-21R polypeptide refers to one or more of the biological activities of the corresponding mature MU-1 protein, including, but not limited to, (1 ) interacting with, e.g., binding to, an IL-21 polypeptide (e.g., a human IL-21 polypeptide); (2) associating with signal transduction molecules, e.g., ⁇ c, jakl ; (3) stimulating phosphorylation and or activation of stat proteins, e.g., STAT5 and/or STAT3; and/or (4) modulating, e.g., stimulating or decreasing, proliferation, differentiation, effector cell function, cytolytic activity, cytokine secretion, and/or survival of immune cells, e.g., T cells (CD8+, CD4+ T cells), NK cells, B cells, macrophages and megakaryocytes).
  • T cells CD8+, CD4+ T cells
  • NK cells e.g., B cells, macrophage
  • a "EL-21/EL-21R agonist” refers to an agent which potentiates, induces or otherwise enhances one or biological activities of an IL-21 R/MU-1 polypeptide, e.g., a biological activity as described herein.
  • the agonist interacts with, e.g., binds to, an IL-21 R/MU-1 polypeptide.
  • an agonist interacts with EL-21R and another receptor chain, e.g., the ⁇ cytokine receptor chain.
  • the agonist crosslinks IL-21R and ⁇ cytokine receptor chain.
  • a "therapeutically effective amount" of an EL-21/IL-21R agonist refers to an amount of an agent which is effective, upon single or multiple dose administration to a subject, e.g., a human patient, at curing, reducing the severity of, ameliorating one or more symptoms of a disorder, e.g., a disorder as described herein, or in prolonging the survival of the subject beyond that expected in the absence of such treatment.
  • a prophylactically effective amount of an EL-21/EL-21R agonist refers to an amount of an EL-21 /TL-2 IR agonist which is effective, upon single- or multiple-dose administration to a subject, e.g., a human patient, in preventing or delaying the occurrence of the onset or recurrence of a disorder, e.g., a disorder as described herein.
  • the term “in combination” in this context means that the agents are given substantially contemporaneously, either simultaneously or sequentially. If given sequentially, at the onset of administration of the second compound, the first of the two compounds is preferably still detectable at effective concentrations at the site of treatment.
  • fusion protein refers to a protein containing two or more operably associated, e.g., linked, moieties, e.g., protein moieties.
  • the moieties are covalently associated.
  • the moieties can be directly associated, or connected via a spacer or linker.
  • Sequences similar or homologous e.g., at least about 85% sequence identity
  • sequence identity can be about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher.
  • nucleic acid segments will hybridize under selective hybridization conditions (e.g., highly stringent hybridization conditions), to the complement of the strand.
  • the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
  • sequence identity is calculated as follows.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non- homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid "homology”).
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the comparison uses the GAP program from the GCG software package (www.gcg.com) and parameters that include a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • hybridizes under stringent conditions describes conditions for hybridization and washing.
  • Stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Aqueous and nonaqueous methods are described in that reference and either can be used.
  • a preferred, example of stringent hybridization conditions are hybridization in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 50°C.
  • SSC sodium chloride/sodium citrate
  • stringent hybridization conditions are hybridization in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 55°C.
  • a further example of stringent hybridization conditions are hybridization in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60°C.
  • stringent hybridization conditions are hybridization in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65°C.
  • Particularly preferred highly stringent conditions are 0.5M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2X SSC, 1% SDS at 65°C.
  • IL-21 /IL-2 IR agonists may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • the IL-21 /IL-2 IR agonists used in the methods and compositions can be an IL-21 polypeptide, e.g., a human or murine IL-21 polypeptide, or an active fragment thereof (e.g., a human IL-21 polypeptide comprising the amino acid sequence shown as SEQ ED NO:2, or an amino acid sequence including a region encoded by a nucleotide sequence shown as SEQ ED NO:l, or a sequence at least 85%, 90%, 95%, 98% or more identical thereto)(e.g., the region of SEQ ED NO: l that encodes a mature IL-21 polypeptide.
  • an IL-21 polypeptide e.g., a human or murine IL-21 polypeptide, or an active fragment thereof (e.g., a human IL-21 polypeptide comprising the amino acid sequence shown as SEQ ED NO:2, or an amino acid sequence including a region encoded by a nucleotide sequence shown as SEQ
  • the IL-21 /IL-2 IR agonist is a murine IL-21 polypeptide or an active fragment thereof (e.g., a murine IL-21 polypeptide comprising the amino acid sequence shown as SEQ ED NO:4, or encoded by a nucleotide sequence shown as SEQ ID NO:3, or a sequence at least 85%, 90%, 95%, 98% or more identical thereto), or an EL-21 polypeptide from another mammal, e.g., a non-human primate, a bovine, and so forth.
  • a murine IL-21 polypeptide comprising the amino acid sequence shown as SEQ ED NO:4, or encoded by a nucleotide sequence shown as SEQ ID NO:3, or a sequence at least 85%, 90%, 95%, 98% or more identical thereto
  • an EL-21 polypeptide from another mammal e.g., a non-human primate, a bovine, and so forth.
  • Amino acid sequences of IL-21 polypeptides are publicly known.
  • the nucleotide sequence and amino acid sequence of a human EL-21 is available at GENBANK ® Ace. No. X_011082.
  • An exemplary disclosed human IL-21 nucleotide sequence is presented below:
  • nucleotide sequence information is available, e.g., from AF254069 [gi:l 1093535] which provides a 642 bp mRNA sequence encoding an exemplary IL-21 polypeptide. In some embodiments, it is sufficient to use the region of nucleotide sequence that encodes mature IL-21, e.g., without a region encoding a signal sequence.
  • the amino acid sequence of an exemplary mature human IL-21 polypeptide is presented below:
  • the mature sequence is based on Parrish-Novak et al. (2000) Nature 408:57-63.
  • the full length sequence is:
  • MRSSPGNMERIVIC MVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVP EFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQ KHRLTCPSCDSYEKKPPKEFLERFKS LQKMIHQHLSSRTHGSEDS (SEQ ID NO: 10)
  • Additional entries providing amino acid sequences for human EL-21 polypeptides are as follows: gi
  • the human IL-21 polypeptide can be
  • IL-21 polypeptides can be encoded by nucleic acids that hybridize to the nucleotide sequence set forth in SEQ ED NO:l, SEQ ED NO:3, SEQ ID NO:5, or SEQ ID NO:7, or the complement thereof, under a condition described herein, e.g., highly stringent conditions (for example, 0.1X SSC at 65°C).
  • Isolated polynucleotides which encode IL-21/IL-21R proteins or fusion proteins, but which differ from the nucleotide sequence set forth in SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, or SEQ ID NO:7, by virtue of the degeneracy of the genetic code can be used.
  • Variations in the nucleotide sequence as set forth in SEQ ED NO:l, SEQ ID NO:3, SEQ ID NO:5, or SEQ ID NO:7 which are caused by point mutations or by induced modifications can also be used.
  • the IL-21 /IL-2 IR agonist is a fusion protein comprising an IL-21 polypeptide, e.g., human or murine IL-21 polypeptide, or a fragment thereof and, e.g., fused to, a second moiety, e.g., a polypeptide (e.g., a GST, Lex-A, MBP polypeptide sequence or an immunoglobulin chain, including, e.g., an Fc fragment, a heavy chain constant regions of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE).
  • a polypeptide e.g., a GST, Lex-A, MBP polypeptide sequence or an immunoglobulin chain, including, e.g., an Fc fragment, a heavy chain constant regions of the various isotypes, including: IgGl, IgG2, IgG3, Ig
  • the fusion proteins may additionally include a linker sequence joining the EL-21 or IL-21R fragment to the second moiety.
  • the fusion protein can include a peptide linker, e.g., a peptide linker of about 4 to 20, more preferably, 5 to 10, amino acids in length; the peptide linker is 8 amino acids in length.
  • a peptide linker e.g., a peptide linker of about 4 to 20, more preferably, 5 to 10, amino acids in length; the peptide linker is 8 amino acids in length.
  • Each of the amino acids in the peptide linker is selected from the group consisting of Gly, Ser, Asn, Thr and Ala; the peptide linker includes a Gly-Ser element.
  • the fusion protein includes a peptide linker and the peptide linker includes a sequence having the formula (Ser-Gly-Gly-Gly-Gly, SEQ ID NO:l l) y wherein y is, e.g., 1, 2, 3, 4, 5, 6, 7, or 8.
  • additional amino acid sequences can be added to the N- or C-terminus of the fusion protein to facilitate expression, detection and/or isolation or purification.
  • IL-21 fusion protein may be linked to one or more additional moieties, e.g., GST, His6 tag, FLAG tag.
  • the fusion protein may additionally be linked to a GST fusion protein in which the fusion protein sequences are fused to the C-terminus of the GST (i.e., glutathione S-transferase) sequences.
  • Such fusion proteins can facilitate the purification of the fusion protein.
  • the fusion protein is includes a heterologous signal sequence (i.e., a polypeptide sequence that is not present in a polypeptide encoded by a EL-21 nucleic acid) at its N-terminus.
  • a heterologous signal sequence i.e., a polypeptide sequence that is not present in a polypeptide encoded by a EL-21 nucleic acid
  • the native signal sequence can be removed and replaced with a signal sequence from another protein.
  • expression and/or secretion of EL-21 /EL-21 R agonist can be increased through use of a heterologous signal sequence.
  • EL-21 R proteins and fragments thereof can also be produced using similar methods, e.g., to provide an immunogen to obtain agonizing antibodies that interact with IL-21R.
  • a chimeric or fusion protein can be produced by standard recombinant DNA techniques.
  • DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g. , by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, for example, Ausubel et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992).
  • anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence
  • a fusion moiety e.g., an Fc region of an immunoglobulin heavy chain.
  • An IL-21 /TL-2 IR agonist encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the immunoglobulin protein.
  • the fusion polypeptides can exist as oligomers, such as dimers (e.g., homo- or hetero-dimers) or trimers.
  • the first polypeptide, and/or nucleic acids encoding the first polypeptide can be constructed using methods known in the art.
  • the first polypeptide includes full-length EL-21 /EL-21 R agonist polypeptide (e.g., EL-21 itself).
  • the first polypeptide comprises less than full-length, EL-21 /TL-2 IR polypeptide.
  • a signal peptide that can be included in the fusion protein is MPLLLLLLLLPSPLHP (SEQ ID NO:9). If desired, one or more amino acids can additionally be inserted between the first polypeptide moiety comprising the EL-21/IL-21R agonist moiety and the second polypeptide moiety.
  • the second polypeptide is preferably soluble.
  • the second polypeptide enhances the half-life, (e.g., the serum half-life) of the linked polypeptide.
  • the second polypeptide includes a sequence that facilitates association of the fusion polypeptide with a second IL-21/EL-21R agonist polypeptide.
  • the second polypeptide includes at least a region of an immunoglobulin polypeptide. Immunoglobulin fusion polypeptide are known in the art 2004/084835
  • the second polypeptide comprises a full-length immunoglobulin polypeptide.
  • the second polypeptide comprises less than full-length immunoglobulin polypeptide, e.g., a heavy chain, light chain, Fab, Fab 2 , Fv, or Fc.
  • the second polypeptide can include the heavy chain of an immunoglobulin polypeptide.
  • the second polypeptide can include the Fc region of an immunoglobulin polypeptide.
  • the second polypeptide has less effector function that the effector function of an Fc region of a wild-type immunoglobulin heavy chain.
  • Fc effector function includes for example, Fc receptor binding, complement fixation and T cell depleting activity (see for example, US Patent No. 6,136,310). Methods for assaying T cell depleting activity, Fc effector function, and antibody stability are known in the art.
  • the second polypeptide has low or no affinity for the Fc receptor. In an alternative embodiment, the second polypeptide has low or no affinity for complement protein Clq.
  • the isolated IL-21 /IL-2 IR agonist polynucleotides described herein may be operably linked to an expression control sequence such as the pMT2 or pED expression vectors disclosed in Kaufman et al., Nucleic Acids Res. 19, 4485-4490 (1991), in order to produce the protein recombinantly.
  • an expression control sequence such as the pMT2 or pED expression vectors disclosed in Kaufman et al., Nucleic Acids Res. 19, 4485-4490 (1991)
  • Many suitable expression control sequences are known in the art. General methods of expressing recombinant proteins are also known and are exemplified in R. Kaufman, Methods in Enzymology 185, 537-566 (1990).
  • operably linked means enzymatically or chemically ligated to form a covalent bond between a particular polynucleotide encoding a protein of interest and the expression control sequence, in such a way that the protein of interest (e.g., EL-21 or another EL-21 /EL-21 R agonist) is expressed by a host cell which has been transformed (transfected) with the ligated polynucleotide/expression control sequence.
  • the protein of interest e.g., EL-21 or another EL-21 /EL-21 R agonist
  • vector is intended to refer to a nucleic acid molecule capable of transporting, or sustaining maintenance or replication of, another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • Certain vectors are capable of autonomous replicati on in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non- episomal mammalian vectors
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as "recombinant expression vectors” (or simply, “expression vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
  • the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
  • viral vectors e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
  • regulatory sequence is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
  • promoters e.g., promoters and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
  • regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from FF- la promoter and BGH poly A, cytomegalovirus (CMN) (such as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major late promoter (AdMLP)) and polyoma.
  • CNN cytomegalovirus
  • SV40 Simian Virus 40
  • AdMLP adenovirus major late promoter
  • the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Patents Nos. 4,399,216, 4,634,665 and 5,179,017, all by Axel et al.).
  • the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
  • Preferred selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr" host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
  • DHFR dihydrofolate reductase
  • a number of types of cells may act as suitable host cells for expression of the IL-21 /IL-2 IR agonist protein or fusion protein thereof. Any cell type capable of expressing functional IL-21 /TL-2 IR protein may be used.
  • Suitable mammalian host cells include, for example, monkey COS cells, Chinese Hamster Ovary (CHO) cells, human kidney 293 cells, human epidermal A431 cells, human Colo205 cells, 3T3 cells, CV-1 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HeLa cells, mouse L cells, BHK, HL-60, U937, HaK, Rat2, BaF3, 32D, FDCP-1, PC12, Mix or C2C12 cells.
  • the EL-21 /IL-2 IR agonist protein or fusion protein thereof may also be produced by operably linking a polynucleotide encoding such a protein to suitable control sequences in one or more insect expression vectors, and employing an insect expression system.
  • Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, e.g., Invitrogen, San Diego, Calif. U.S.A. (the MAXBAC® kit), and such methods are well known in the art, as described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987), incorporated herein by reference. Soluble forms of the MU-1 protein may also be produced in insect cells using appropriate isolated polynucleotides as described above.
  • the EL-21 /EL-21 R agonist protein or fusion protein thereof may be produced in lower eukaryotes such as yeast or in prokaryotes such as bacteria.
  • yeast strains include Saccharomyces cerevisiae, Schizosaccharomyces pombe,
  • Kluyveromyces strains Candida, or any yeast strain capable of expressing heterologous proteins.
  • Suitable bacterial strains include Escherichia coli, Bacillus subtilis, Salmonella typhimurium, or any bacterial strain capable of expressing heterologous proteins.
  • EL-21 is produced in a bacterial without a signal sequence (e.g., without either a prokaryotic or eukaryotic signal sequence).
  • Expression in bacteria may result in formation of inclusion bodies incorporating the recombinant protein.
  • refolding of the recombinant protein may be required in order to produce active or more active material.
  • Several methods for obtaining correctly folded heterologous proteins from bacterial inclusion bodies are known in the art. These methods generally involve solubilizing the protein from the inclusion bodies, then denaturing the protein completely using a chaotropic agent.
  • the protein When cysteine residues are present in the primary amino acid sequence of the protein, the protein can be refolded in an environment which facilitates correct formation of disulfide bonds (e.g., a redox system).
  • a redox system General methods of refolding are disclosed in Kohno, Meth. Enzym., 185:187-195 (1990).
  • Asano et al. (2002) FEBS Lett. 528(l-3):70-6 describes an exemplary method for refolding EL-21 produced in bacterial cells.
  • rEL-21 recombinant EL-21
  • E insoluble inclusion bodies in E.
  • the EL-21 /IL-2 IR agonist protein or fusion protein thereof may also be expressed as a product of transgenic animals, e.g., as a component of the milk of transgenic cows, goats, pigs, or sheep which are characterized by somatic or germ cells containing a polynucleotide sequence encoding the IL-21 /IL-2 IR agonist protein or fusion protein thereof.
  • the EL-21/EL-21R agonist protein or fusion protein thereof may be prepared by growing a culture transformed host cells under culture conditions necessary to express the desired protein.
  • the resulting expressed protein may then be purified from the culture medium or cell extracts.
  • Soluble forms of the EL-21 /IL-2 IR agonist protein or fusion protein thereof can be purified from conditioned media.
  • Membrane-bound forms of MU-1 protein can be purified by preparing a total membrane fraction from the expressing cell and extracting the membranes with a non-ionic detergent such as Triton X-100.
  • the IL-21 /IL-2 IR agonist protein or fusion protein can be purified using methods known to those skilled in the art.
  • the IL-21 /IL-2 IR agonist protein can be concentrated using a commercially available protein concentration filter, for example, an AMICON ® or MILLIP ORE ® PELLICONTM ultrafiltration unit.
  • the concentrate can be applied to a purification matrix such as a gel filtration medium.
  • a purification matrix such as a gel filtration medium.
  • an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) or polyetheyleneimine (PEE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
  • a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. Sulfopropyl groups are preferred (e.g., S-Sepharose ® columns).
  • the purification of the MU-1 protein or fusion protein from culture supernatant may also include one or more column steps over such affinity resins as concanavalin A-agarose, heparin- TOYOPEARL® or Cibacrom blue 3GA SEPHAROSE®; or by hydrophobic interaction chromatography using such resins as phenyl ether, butyl ether, or propyl ether; or by immunoaffinity chromatography.
  • affinity resins as concanavalin A-agarose, heparin- TOYOPEARL® or Cibacrom blue 3GA SEPHAROSE®
  • hydrophobic interaction chromatography using such resins as phenyl ether, butyl ether, or propyl ether
  • immunoaffinity chromatography e.g., immunoaffinity chromatography
  • Affinity columns including antibodies to the EL-21/EL-21R agonist protein can also be used in purification in accordance with known methods. Some or all of the foregoing purification steps, in various combinations or with other known methods, can also be employed to provide a substantially purified isolated recombinant protein.
  • the isolated EL-21/EL-21R agonist protein is purified so that it is substantially free of other mammalian proteins or, if produced in bacteria, substantially free of other bacterial proteins, e.g., endotoxins.
  • the EL-21 /EL-21 R agonists are antibodies, or antigen- binding fragments thereof, that bind to, e.g., EL-21R, preferably, mammalian (e.g., human or murine) EL-21 or IL-21R, and activate an IL-21R activity.
  • EL-21R preferably, mammalian (e.g., human or murine) EL-21 or IL-21R, and activate an IL-21R activity.
  • the term "antibody” refers to a protein comprising at least one, and preferably two, heavy (H) chain variable regions (abbreviated herein as VH), and at least one and preferably two light (L) chain variable regions (abbreviated herein as VL).
  • VH and VL regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” (“CDR"), interspersed with regions that are more conserved, termed “framework regions” (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • the extent of the framework region and CDR's has been precisely defined (see, Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
  • Each VH and VL is composed of three CDR's and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the antibody can further include a heavy and light chain constant region, to thereby form a heavy and light immunoglobulin chain, respectively.
  • the antibody is a tetramer of two heavy immunoglobulin chains and two light immunoglobulin chains, wherein the heavy and light immunoglobulin chains are inter-connected by, e.g., disulfide bonds.
  • the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
  • the light chain constant region is comprised of one domain, CL.
  • the variable region of the heavy and light chains contains a binding domain that interacts with an antigen.
  • the constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • immunoglobulin refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes.
  • the recognized human immunoglobulin genes include the kappa, lambda, alpha (IgAl and IgA2), gamma (IgGl, IgG2, IgG3, IgG4), delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
  • Full-length immunoglobulin "light chains” (about 25 Kd or 214 amino acids) are encoded by a variable region gene at the NH2-terminus (about 110 amino acids) and a kappa or lambda constant region gene at the COOH—terminus.
  • variable region gene about 116 amino acids
  • constant region genes e.g., gamma (encoding about 330 amino acids).
  • isotype refers to the antibody class (e.g., IgM or IgGl) that is encoded by heavy chain constant region genes.
  • antibody portion refers to one or more fragments of a full-length antibody that retain the ability to specifically bind to an antigen (e.g., IL-21R).
  • an antigen e.g., IL-21R
  • binding fragments encompassed within the term "antigen-binding fragment" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al.
  • VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • scFv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding fragment" of an antibody. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
  • An "effectively human” immunoglobulin variable region is an immunoglobulin variable region that includes a sufficient number of human framework amino acid positions such that the immunoglobulin variable region does not elicit an immunogenic response in a normal human.
  • An "effectively human” antibody is an antibody that includes a sufficient number of human amino acid positions such that the antibody does not elicit an immunogenic response in a normal human. Human and effectively human immunoglobulin variable regions and antibodies can be used.
  • IL-21 or EL-21R proteins may be used to immunize animals (e.g., non-human animals and non-human animals include human immunoglobulin genes) to obtain polyclonal and monoclonal antibodies which specifically react with the EL-21 /EL-21 R agonist protein and which may activate an IL-21R.
  • animals e.g., non-human animals and non-human animals include human immunoglobulin genes
  • polyclonal and monoclonal antibodies which specifically react with the EL-21 /EL-21 R agonist protein and which may activate an IL-21R.
  • Such antibodies may be obtained using the entire EL-21 /EL-21 R agonist protein as an immunogen, or by using fragments of IL-21 /IL-21 R.
  • the peptide immunogens additionally may contain a cysteine residue at the carboxyl terminus, and are conjugated to a hapten such as keyhole limpet hemocyanin (KLH).
  • KLH keyhole limpet hemocyanin
  • Additional peptide immunogens may be generated by replacing tyrosine residues with sulfated tyrosine residues. Methods for synthesizing such peptides are known in the art, for example, as in R. P. Merrifield, J.Amer.Chem.Soc. 85, 2149-2154 (1963); J. L. Krstenansky, et al., FEBS Lett. 211, 10 (1987).
  • Human monoclonal antibodies (mAbs) directed against IL-21 or EL-21 R can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., WO 91/00906, WO 91/10741; WO 92/03918; WO 92/03917; Lonberg, N. et al. 1994 Nature 368:856-859; Green, L.L. et al. 1994 Nature Genet. 7: 13-21 ; Morrison, S.L. et al.
  • Monoclonal antibodies can also be generated by other methods known to those skilled in the art of recombinant DNA technology.
  • An alternative method referred to as the "combinatorial antibody display” method, has been developed to identify and isolate antibody fragments having a particular antigen specificity, and can be utilized to produce monoclonal antibodies (for descriptions of combinatorial antibody display see e.g., Sastry et al. 1989 PNAS 86:5728; Huse et al. 1989 Science 246:1275; and Orlandi et al. 1989 PNAS 86:3833). After immunizing an animal with an immunogen as described above, the antibody repertoire of the resulting B-cell pool is cloned.
  • Methods are generally known for obtaining the DNA sequence of the variable regions of a diverse population of immunoglobulin molecules by using a mixture of oligomer primers and PCR.
  • mixed oligonucleotide primers corresponding to the 5' leader (signal peptide) sequences and/or framework 1 (FR1) sequences, as well as primer to a conserved 3' constant region primer can be used for PCR amplification of the heavy and light chain variable regions from a number of murine antibodies (Larrick et al.,1991, Biotechniques 11 :152-156).
  • a similar strategy can also been used to amplify human heavy and light chain variable regions from human antibodies (Larrick et al., 1991, Methods: Companion to Methods in Enzymology 2:106-1 10).
  • Chimeric antibodies including chimeric immunoglobulin chains, can be produced by recombinant DNA techniques known in the art. For example, a gene encoding the Fc constant region of a murine (or other species) monoclonal antibody molecule is digested with restriction enzymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fc constant region is substituted (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al.
  • An antibody or an immunoglobulin chain can be humanized by methods known in the art.
  • Humanized antibodies, including humanized immunoglobulin chains can be generated by replacing sequences of the Fv variable region which are not directly involved in antigen binding with equivalent sequences from human Fv variable regions.
  • General methods for generating humanized antibodies are provided by Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference.
  • Those methods include isolating, manipulating, and expressing the nucleic acid sequences that encode all or part of immunoglobulin Fv variable regions from at least one of a heavy or light chain.
  • Sources of such nucleic acid are well known to those skilled in the art and, for example, may be obtained from a hybridoma producing an antibody against a predetermined target.
  • the recombinant DNA encoding the humanized antibody, or fragment thereof, can then be cloned into an appropriate expression vector.
  • Humanized or CDR-grafted antibody molecules or immunoglobulins can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDR's of an immunoglobulin chain can be replaced.
  • CDR-grafting or CDR substitution wherein one, two, or all CDR's of an immunoglobulin chain can be replaced.
  • monoclonal, chimeric and humanized antibodies can be modified by, e.g., deleting, adding, or substituting other portions of the antibody, e.g., the constant region.
  • an antibody can be modified as follows: (i) by deleting the constant region; (ii) by replacing the constant region with another constant region, e.g., a constant region meant to increase half-life, stability or affinity of the antibody, or a constant region from another species or antibody class; or (iii) by modifying one or more amino acids in the constant region to alter, for example, the number of glycosylation sites, effector cell function, Fc receptor (FcR) binding, complement fixation, among others.
  • Methods for altering an antibody constant region are known in the art.
  • Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the Cl component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 Al, US 5,624,821 and US 5,648,260). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
  • an Fc region of an antibody e.g., an IgG, such as a human IgG
  • FcR e.g., Fc gamma RI
  • Clq binding by replacing the specified residue(s) with a residue(s) having an appropriate functionality on its side chain, or by introducing a charged functional group, such as glutamate or aspartate, or perhaps an aromatic non-polar residue such as phenylalanine, tyrosine, tryptophan or alanine (see e.g., US 5,624,821).
  • an agonist of IL-21 R is an agent that interacts with IL-21R and another receptor subunit, e.g., ⁇ c.
  • the agent can be a protein that interacts with IL-21R and another receptor subunit, e.g., ⁇ c.
  • the protein can be, e.g., a bispecific antibody that includes one antigen binding site that interacts with EL-21 R and another antigen binding site that interacts with ⁇ c. Binding of such a protein can be used to crosslink and agonize the receptor, e.g., activate or increase STAT3 or STAT5 signalling.
  • an IL-21/EL-21R agonist is an agent (e.g., an immunoglobulin) that stabilizes an IL-21/IL-21R interaction, e.g., by binding one or both of IL-21 and EL-21 R.
  • agent e.g., an immunoglobulin
  • Agonists of IL-21 /IL-21 R proteins can be screened for, e.g., binding and/or activation of an IL-21R polypeptide using procedures known in the art. Binding assays using a desired binding protein, immobilized or not, are known in the art and may be used for this purpose using the IL-21R protein as described herein. Purified cell based or protein based (cell free) screening assays may be used to identify such agonists. For example, IL-21R protein may be immobilized in purified form on a carrier and binding or potential ligands to purified IL-21 R protein may be measured. Cell-based assays for evaluating IL-21R activity and STAT3 or STAT5 signalling are known. Examples are described herein.
  • IL-21 /IL-2 lR-agonists may be used as a pharmaceutical composition when combined with a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier may contain, in addition to the EL-21 /EL-2 lR-agonists and carrier, various diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials well known in the art.
  • pharmaceutically acceptable means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredient(s). The characteristics of the carrier will depend on the route of administration.
  • the pharmaceutical composition may further contain other anti-inflammatory agents as described in more detail below.
  • additional factors and/or agents may be included in the pharmaceutical composition to produce a synergistic effect with an IL-21 /IL-2 lR-agonists, or to minimize side effects caused by the IL-21 /EL-21 R- agonists.
  • IL-21 /IL-2 IR- agonists may be included in formulations of the particular anti-inflammatory agent to minimize side effects of the anti-inflammatory agent.
  • the pharmaceutical composition may be in the form of a liposome in which IL-21 /EL-2 lR-agonists is combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers which in aqueous solution.
  • Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Pat. No. 4,235,871; U.S. Pat. No. 4,501,728; U.S. Pat. No. 4,837,028; and U.S. Pat. No. 4,737,323, all of which are incorporated herein by reference.
  • the term "therapeutically effective amount” means the total amount of each active component of the pharmaceutical composition or method that is sufficient to show a meaningful patient benefit, e.g., amelioration of symptoms of, healing of, or increase in rate of healing of such conditions.
  • a meaningful patient benefit e.g., amelioration of symptoms of, healing of, or increase in rate of healing of such conditions.
  • the term refers to that ingredient alone.
  • the term refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously.
  • an EL-21 /EL-2 IR- agonist is administered to a subject, e.g., mammal (e.g., a human).
  • a subject e.g., mammal (e.g., a human).
  • An EL-21 /EL-2 lR-agonists may be administered either alone or in combination with other therapies such as treatments employing anti-inflammatory agents.
  • an EL-21 - and or EL-21R- agonist may be administered either simultaneously with the second agent, or sequentially. If administered sequentially, the attending physician can decide on the appropriate sequence of administering an EL-21 /EL-2 lR-agonist in combination with other agents.
  • Administration of an EL-21 /EL-2 lR-agonist used in the pharmaceutical composition or to practice the method of the present invention can be carried out in a variety of conventional ways, such as oral ingestion, intracranial, inhalation, or cutaneous, subcutaneous, or intravenous injection or administration.
  • th ⁇ e composition can be delivered as an epidural or otherwise, e.g., to cerebrospinal fluid.
  • the binding agent When a therapeutically effective amount of an IL-21 /IL-2 lR-agonist is administered orally, the binding agent will be in the form of a tablet, capsule, powder, solution or elixir.
  • the pharmaceutical composition may additionally contain a solid carrier such as a gelatin or an adjuvant.
  • the tablet, capsule, and powder contain from about 5 to 95% binding agent, and preferably from about 25 to 90% binding agent.
  • a liquid carrier such as water, petroleum, oils of animal or plant origin such as peanut oil, mineral oil, soybean oil, or sesame oil, or synthetic oils may be added.
  • the liquid form of the pharmaceutical composition may further contain physiological saline solution, dextrose or other saccharide solution, or glycols such as ethylene glycol, propylene glycol or polyethylene glycol.
  • the pharmaceutical composition When administered in liquid form, contains from about 0.5 to 90% by weight of the binding agent, and preferably from about 1 to 50% the binding agent.
  • binding agent When a therapeutically effective amount of an IL-21 /IL-2 lR-agonist is administered by intravenous, cutaneous or subcutaneous injection, binding agent will be in the form of a pyrogen-free, parenterally acceptable aqueous solution.
  • a preferred pharmaceutical composition for intravenous, cutaneous, or subcutaneous injection should contain, in addition to binding agent an isotonic vehicle such as sodium chloride injection, Ringer's injection, dextrose injection, dextrose and sodium chloride injection, lactated Ringer's injection, or other vehicle as known in the art.
  • the pharmaceutical composition of the present invention may also contain stabilizers, preservatives, buffers, antioxidants, or other additive known to those of skill in the art.
  • the amount of an EL-21 /EL-2 lR-agonist in the pharmaceutical composition of the present invention can depend upon the nature and severity of the condition being treated, and on the nature of prior treatments that the patient has undergone.
  • the attending physician can decide the amount of agonist with which to treat each individual patient. Initially, for example, the attending physician can administer low doses of binding agent and observe the patient's response. Larger doses of binding agent may be administered until the optimal therapeutic effect is obtained for the patient, and at that point the dosage is not generally increased further, or by monitoring cytokine levels or one or more symptoms.
  • the various pharmaceutical compositions used to practice the method of the present invention should contain about 0.1 ⁇ g to about 100 mg IL-21 /EL-2 lR-agonist per kg body weight.
  • useful dosages can include between about 10 ⁇ g-lmg, 0.1 -5mg, and 3- 50 mg of IL-21 /IL-21 R agonist per kg body weight.
  • Useful dosages of IL-21 can further include between about 5 ⁇ g-lmg, 0.1-5mg, and 3-20 mg of IL-21 /IL-21 R agonist per kg body weight.
  • the duration of intravenous therapy using the pharmaceutical composition can vary, depending on the severity of the disease being treated and the condition and potential idiosyncratic response of each individual patient.
  • the duration of each application of the IL-21 /IL-2 lR-agonist can be, e.g., in the range of 12 to 24 hours of continuous intravenous administration.
  • the attending physician can decide on the appropriate duration of intravenous therapy using the pharmaceutical composition of the present invention.
  • the disease or disorder can be treated or prevented by administration or use of polynucleotides encoding such proteins (such as, for example, in gene therapies or vectors suitable for introduction of DNA).
  • the present invention provides methods for treating (e.g., curing, suppressing, ameliorating, delaying or preventing the onset of, or preventing recurrence or relapse of) or preventing an immunological disorder of the nervous system (e.g., a chronic immunological disorder of the nervous system, including multiple sclerosis), in a subject.
  • the method includes: administering to the subject an EL-21 /EL-2 IR agonist, in an amount sufficient to modulate immune cell activity and/or cell number (e.g., to modulate cytokine levels, e.g., cytokine expression, production and/or release), thereby treating or preventing the immunological disorder of the nervous system, e.g., multiple sclerosis.
  • MS Multiple sclerosis
  • EAE experimental autoimmune encephaliti s
  • mice with EL-21 injections prior to EAE induction reduces the symptoms of the disease.
  • the IL-21/EL-21R agonists described herein may similarly be used to treat or prevent multiple sclerosis in humans.
  • Patients suitable for such treatment may be identified by criteria establishing a diagnosis of clinically definite MS as defined by the workshop on the diagnosis of MS (Poser et al., Ann. Neurol. 13:227, 1983). Briefly, an individual with clinically definite MS has had two attacks and clinical evidence of either two lesions or clinical evidence of one lesion and paraclinical evidence of another, separate lesion. Definite MS may also be diagnosed by evidence of two attacks and oligoclonal bands of IgG in cerebrospinal fluid or by combination of an attack, clinical evidence of two lesions and oligoclonal band of IgG in cerebrospinal fluid. Slightly lower criteria are used for a diagnosis of clinically probable MS.
  • Effective treatment of multiple sclerosis may be examined in several different ways. Satisfying any of the following criteria evidences effective treatment. Three main criteria are used: EDSS (extended disability status scale), appearance of exacerbations or MRI (magnetic resonance imaging). The EDSS is a means to grade clinical impairment due to MS (Kurtzke, Neurology 33:1444, 1983). Eight functional systems are evaluated for the type and severity of neurologic impairment. Briefly, prior to treatment, patients are evaluated for impairment in the following systems: pyramidal, cerebella, brainstem, sensory, bowel and bladder, visual, cerebral, and other. Following- ups are conducted at defined intervals. The scale ranges from 0 (normal) to 10 (death due to MS).
  • Exacerbations are defined as the appearance of a new symptom that is attributable to MS and accompanied by an appropriate new neurologic abnormality (EFNB MS Study Group, supra). In addition, the exacerbation must last at least 24 hours and be preceded by stability or improvement for at least 30 days. Briefly, patients are given a standard neurological examination by clinicians. Exacerbations are either mild, moderate, or severe according to changes in a Neurological Rating Scale (Sipe et al., Neurology 34:1368, 1984). An annual exacerbation rate and proportion of exacerbation-free patients are determined.
  • Treatment is deemed to be effective if there is a statistically significant difference in the rate or proportion of exacerbation-free patients between the treated group and the placebo group for either of these measurements.
  • time to first exacerbation and exacerbation duration and severity may also be measured.
  • a measure of effectiveness as therapy in this regard is a statistically significant difference in the time to first exacerbation or duration and severity in the treated group compared to control group.
  • MRI can be used to measure active lesions using gadolinium-DTPA-enhanced imaging (McDonald et al. Ann. Neurol. 36:14, 1994) or the location and extent of lesions using T 2 -weighted techniques. Briefly, baseline MRIs are obtained. The same imaging plane and patient position are used for each subsequent study. Positioning and imaging sequences can be chosen to maximize lesion detection and facilitate lesion tracing. The same positioning and imaging sequences can be used on subsequent studies. The presence, location and extent of MS lesions can be determined by radiologists. Areas of lesions can be outlined and summed slice by slice for total lesion area.
  • Exemplary symptoms associated with multiple sclerosis include: optic neuritis, diplopia, nystagmus, ocular dysmetria, internuclear ophthalmoplegia, movement and sound phosphenes, afferent pupillary defect, paresis, monoparesis, paraparesis, hemiparesis, quadraparesis, plegia, paraplegia, hemiplegia, tetraplegia, quadraplegia, spasticity, dysarthria, muscle atrophy, spasms, cramps, hypotonia, clonus, myoclonus, myokymia, restless leg syndrome, footdrop, dysfunctional reflexes, paraesthesia, anaesthesia, neuralgia, neuropathic and neurogenic pain, l'hermitte's, proprioceptive dysfunction, trigeminal neuralgia, ataxia, intention tremor, dysmetria, vestibular ataxia, vertigo,
  • Candidate patients for prevention may be identified by the presence of genetic factors. For example, a majority of MS patients have HLA-type DR2a and DR2b. The MS patients having genetic dispositions to MS who are suitable for treatment fall within two groups. First are patients with early disease of the relapsing remitting type. Entry criteria can include disease duration of more than one year, EDSS score of 1.0 to 3.5, exacerbation rate of more than 0.5 per year, and free of clinical exacerbations for 2 months prior to study. The second group would include people with disease progression greater than 1.0 EDSS unit/year over the past two years.
  • Candidate patients for prevention may be identified by evaluating cytokine parameters, e.g., an EL-10 or IL-21 parameter.
  • Efficacy of the IL-21 /EL-2 IR agonist in the context of prevention is judged based on the following criteria: frequency of MBP reactive T cells determined by limiting dilution, proliferation response of MBP reactive T cell lines and clones, cytokine profiles of T cell lines and clones to MBP established from patients. Efficacy is established by decrease in frequency of reactive cells, a reduction in thymidine incorporation with altered peptide compared to native, and a reduction in TNF and IFN- ⁇ . Clinical measurements include the relapse rate in one and two-year intervals, and a change in EDSS, including time to progression from baseline of 1.0 unit on the EDSS which persists for six months.
  • the EL-21 /EL-2 IR agonists are administered in combination therapy, i.e., combined with other agents, e.g., therapeutic agents, which are useful for treating pathological conditions or disorders, such as immune and inflammatory disorders of the brain, e.g., multiple sclerosis.
  • combination in this context means that the agents are given substantially contemporaneously, either simultaneously or sequentially. If given sequentially, at the onset of administration of the second compound, the first of the two compounds is preferably still detectable at effective concentrations at the site of treatment.
  • the combination therapy can include one or more IL-21/IL-21R agonists (e.g., an IL-21 polypeptide or fusion protein, a peptide agonist or a small molecule agonist) co-formulated with, and or co-administered with, one or more additional therapeutic agents, e.g., one or more cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents, as described in more detail below.
  • one or more EL-21 /EL-2 IR agonists described herein may be used in combination with two or more of the therapeutic agents described herein.
  • Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
  • the therapeutic agents disclosed herein act on pathways that differ from the IL-21 /EL-2 IR receptor pathway, and thus are expected to enhance and or synergize with the effects of the EL-21/EL-21R agonists.
  • Preferred therapeutic agents used in combination with an EL-21/EL-21R agonist are those agents that interfere at different stages in the autoimmune and subsequent inflammatory response.
  • Non-limiting examples of agents for treating or preventing multiple sclerosis with which an EL-21-/TL21R agonist can be combined include the following: interferons, e.g., interferon-beta-l ⁇ (e.g., AVONEXTM; Biogen) and interferon-l ⁇ (BETASERONTM; human interferon ⁇ substituted at position 17; Berlex/Chiron); glatiramer acetate (also termed Copolymer 1, Cop-1 ; COPAXONETM; Teva Pharmaceutical Industries, Inc.); hyperbaric oxygen; intravenous immunoglobulin; clabribine; TNF antagonists as described herein; corticosteroids; prednisolone; methylprednisolone; azathioprine; cyclophosphamide; cyclosporine; methotrexate; 4- aminopyridine; and tizanidine.
  • interferons e.g., interferon-beta-l ⁇ (e.g
  • Additional antagonists that can be used in combination with EL-21 agonists include antibodies to, or antagonists of, other human cytokines or growth factors, for example, TNF, LT, EL- 1, IL-2, IL-6, IL-7, IL-8, IL-12 IL- 15, IL- 16, IL- 18, EMAP-11, GM- CSF, FGF, and PDGF.
  • EL-21 agonists as described herein can be combined with antibodies to cell surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80, CD86, CD90 or their ligands.
  • the IL-21 agonists may also be combined with agents, such as methotrexate, cyclosporine, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAEDs, for example, ibuprofen, corticosteroids such as prednisolone, phosphodiesterase inhibitors, adenosine agonists, antithrombotic agents, complement inhibitors, adrenergic agents, agents which interfere with signaling by proinflammatory cytokines as described herein, IL- I ⁇ converting enzyme inhibitors (e.g., Vx740), anti-P7s, PSGL, TACE inhibitors, T- cell signaling inhibitors such as kinase inhibitors, metal loproteinase inhibitors, sulfasalazine, azathloprine, 6- mercaptopurines, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof, as described herein, and anti-inflammatory cyto
  • IL-21 /EL-2 IR agonists examples include interferon- ⁇ , for example, IFN ⁇ -l ⁇ and IFN ⁇ -l ⁇ ; glatiramer acetate (e.g, COPAXONE ® ), corticosteroids, IL-1 inhibitors, TNF inhibitors, antibodies to CD40 ligand and CD80, and EL-12 antagonists.
  • interferon- ⁇ for example, IFN ⁇ -l ⁇ and IFN ⁇ -l ⁇
  • glatiramer acetate e.g, COPAXONE ®
  • corticosteroids IL-1 inhibitors
  • TNF inhibitors antibodies to CD40 ligand and CD80
  • EL-12 antagonists examples include interferon- ⁇ , for example, IFN ⁇ -l ⁇ and IFN ⁇ -l ⁇ ; glatiramer acetate (e.g, COPAXONE ® ), corticosteroids, IL-1 inhibitors, TNF inhibitors, antibodies to CD40 ligand and CD80, and
  • agents that may be used to treat one or more symptoms or side effects of MS e.g., amantadine, baclofen, mineral oil, papaverine, meclizine, hydroxyzine, sulfamethoxazole, ciprofloxacin, docusate, ciprofloxacin, pemoline, dantrolene, desmopressin, desmopressin, dexamethasone, prednisone, tolterodine, phenytoin, oxybutynin, oxybutynin (extended release formula), bisacodyl, venlafaxine, amitriptyline, docusate stool softener laxative, sodium phosphate, methenamine, baclofen (intrathecal), clonazepam, isoniazid, vardenafil, nitrofurantoin, psyllium hydrophilic mucilloid, alprostadil, gabapentin,
  • agents include EL-12 antagonists, such as chimeric, humanized, human or in vitro generated antibodies (or antigen-binding fragments thereof) that bind to EL-12 (preferably human EL-12), e.g., the antibody disclosed in WO 00/56772, Genetics Institute/BASF); EL-12 receptor inhibitors, e.g., antibodies to human IL-12 receptor; and soluble fragments of the EL-12 receptor, e.g., human EL-12 receptor.
  • EL-12 antagonists such as chimeric, humanized, human or in vitro generated antibodies (or antigen-binding fragments thereof) that bind to EL-12 (preferably human EL-12), e.g., the antibody disclosed in WO 00/56772, Genetics Institute/BASF)
  • EL-12 receptor inhibitors e.g., antibodies to human IL-12 receptor
  • soluble fragments of the EL-12 receptor e.g., human EL-12 receptor.
  • IL-15 antagonists include antibodies (or antigen-binding fragments thereof) against IL-15 or its receptor, e.g., chimeric, humanized, human or in vitro generated antibodies to human IL-15 or its receptor, soluble fragments of the IL- 15 receptor, and IL-15-binding proteins.
  • IL-18 antagonists include antibodies, e.g., chimeric, humanized, human or in vitro generated antibodies (or antigen-binding fragments thereof), to human IL-18, soluble fragments of the IL-18 receptor, and IL-18 binding proteins (IL-18BP, Mallet et al. (2001) Circ. Res. 28).
  • IL-1 antagonists include Interleukin- 1 -converting enzyme (ICE) inhibitors, such as Vx740, IL-1 antagonists, e.g., IL-1RA (ANEKINRA, AMGEN), sILlRII (Immunex), and anti-IL-1 receptor antibodies (or antigen-binding fragments thereof).
  • IL-1 antagonists include chimeric, humanized, human or in vitro generated antibodies (or antigen-binding fragments thereof) to TNF (e.g., human TNF a), such as D2E7, (human TNFa antibody, U.S.
  • CDP-571/CDP- 870/BAY-10-3356 humanized anti-TNFa antibody; Celltech/Pharmacia
  • cA2 chimeric anti-TNFa antibody; RemicadeTM, Centocor
  • anti-TNF antibody fragments e.g., CPD870
  • soluble fragments of the TNF receptors e.g., p55 or p75 human TNF receptors or derivatives thereof, e.g., 75 kdTNFR-IgG (75 kD TNF receptor-IgG fusion protein, ENBRELTM; Immunex; see e.g., Arthritis & Rheumatism (1994) Vol. 37,
  • TNFa converting enzyme (TACE) inhibitors e.g., an alpha-sulfonyl hydroxamic acid derivative, WO 01/55112, and N-hydroxyformamide TACE inhibitor GW 3333, -005, or -022
  • TNF-bp/s-TNFR soluble TNF binding protein
  • TNF antagonists are soluble fragments of the TNF receptors, e.g., p55 or p75 human TNF receptors or derivatives thereof, e.g., 75 kdTNFR-IgG, and TNFa converting enzyme (TACE) inhibitors.
  • TNFa converting enzyme TACE
  • the IL-21-/IL21R agonists described herein can be administered in combination with one or more of the following: IL-13 antagonists, e.g., soluble IL-13 receptors (sEL-13) and/or antibodies against EL-13; EL-2 antagonists, e.g., DAB 486-EL-2 and/or DAB 389-EL-2 (IL-2 fusion proteins; Seragen; see e.g., Arthritis & Rheumatism (1993) Vol. 36, 1223), and/or antibodies to IL-2R, e.g., anti-Tac (humanized anti-IL-2R; Protein Design Labs, Cancer Res. 1990 Mar 1 ;50(5): 1495-502).
  • IL-13 antagonists e.g., soluble IL-13 receptors (sEL-13) and/or antibodies against EL-13
  • EL-2 antagonists e.g., DAB 486-EL-2 and/or DAB 389-EL-2 (IL-2 fusion proteins; Seragen; see
  • Yet another combination includes IL-21 antagonists in combination with non-depleting anti-CD4 inhibitors (IDEC-CE9.1/SB 210396 (non-depleting primatized anti-CD4 antibody; IDEC/SmithKline).
  • IL-21 antagonists in combination with non-depleting anti-CD4 inhibitors (IDEC-CE9.1/SB 210396 (non-depleting primatized anti-CD4 antibody; IDEC/SmithKline).
  • Yet other preferred combinations include antagonists of the co-stimulatory pathway CD80 (B7.1) or CD86 (B7.2) including antibodies, soluble receptors or antagonistic ligands; as well as p-selectin glycoprotein ligand (PSGL), anti- inflammatory cytokines, e.g., IL-4 (DNAX/Schering); IL-10 (SCH 52000; recombinant IL-10 DNAX/Schering); IL- 13 and TGF, and agonists thereof (e.g., agonist antibodies).
  • CD80
  • one or more IL-21-/IL21R agonists can be co-formulated with, and/or co-administered with, one or more anti-inflammatory drugs, immunosuppressants, or metabolic or enzymatic inhibitors.
  • drugs or inhibitors that can be used in combination with the IL-21 agonists described herein, include, but are not limited to, one or more of: non-steroidal anti- inflammatory drug(s) (NSAEDs), e.g., ibuprofen, Tenidap (see e.g., Arthritis & Rheumatism (1996) Vol. 39, No. 9 (supplement), S280)), Naproxen (see e.g., Neuro Report (1996) Vol.
  • NSAEDs non-steroidal anti- inflammatory drug(s)
  • ibuprofen e.g., ibuprofen, Tenidap (see e.g., Arthritis & Rheumatism (1996) Vol. 39, No. 9 (suppl
  • CSAED 9 (supplement), S281); corticosteroids such as prednisolone; cytokine suppressive anti- inflammatory drug(s) (CSAEDs); inhibitors of nucleotide biosynthesis, e.g., inhibitors of purine biosynthesis, folate antagonists (e.g., methotrexate (N-[4-[[(2,4-diamino-6- pteridinyl)methyl]methylamino]benzoyl]-L-glutamic acid); and inhibitors of pyrimidine biosynthesis, e.g., dihydroorotate dehydrogenase (DHODH) inhibitors (e.g., leflunomide (see e.g., Arthritis & Rheumatism (1996) Vol.
  • DHODH dihydroorotate dehydrogenase
  • Preferred therapeutic agents for use in combination with IL-21/IL-21R antagonists include NSAIDs, CSADDs, (DHODH) inhibitors (e.g., leflunomide), and folate antagonists (e.g., methotrexate).
  • additional inhibitors include one or more of: corticosteroids (oral, inhaled and local injection); immunosuppresants, e.g., cyclosporin, tacrolimus (FK- 506); and mTOR inhibitors, e.g., sirolimus (rapamycin) or rapamycin derivatives, e.g., soluble rapamycin derivatives (e.g., ester rapamycin derivatives, e.g., CCI-779 (Elit. L. (2002) Current Opinion Investig. Drugs 3(8): 1249-53; Huang, S. et al.. (2002) Current Opinion Investig.
  • corticosteroids oral, inhaled and local injection
  • immunosuppresants e.g., cyclosporin, tacrolimus (FK- 506)
  • mTOR inhibitors e.g., sirolimus (rapamycin) or rapamycin derivatives, e.g., soluble rapamycin
  • Drugs 3(2):295-304 agents which interfere with signaling by proinflammatory cytokines such as TNFa or IL-1 (e.g. IRAK, NIK, EKK, p38 or MAP kinase inhibitors); COX2 inhibitors, e.g., celecoxib and variants thereof, MK-966, see e.g., Arthritis & Rheumatism (1996) Vol. 39, No. 9 (supplement), S81); phosphodiesterase inhibitors, e.g., R973401 (phosphodiesterase Type IV inhibitor; see e.g., Arthritis & Rheumatism (1996) Vol. 39, No.
  • cytokines such as TNFa or IL-1
  • COX2 inhibitors e.g., celecoxib and variants thereof, MK-966, see e.g., Arthritis & Rheumatism (1996) Vol. 39, No. 9 (supplement), S81
  • phospholipase inhibitors e.g., inhibitors of cytosolic phospholipase 2 (cPLA2) (e.g., trifluoromethyl ketone analogs (U.S. 6,350,892)); inhibitors of vascular endothelial cell growth factor or growth factor receptor, e.g., VEGF inhibitor and/or VEGF-R inhibitor; and inhibitors of angiogenesis.
  • cPLA2 cytosolic phospholipase 2
  • VEGF inhibitor and/or VEGF-R inhibitor inhibitors of angiogenesis.
  • immunosuppresants e.g., cyclosporin, tacrolimus (FK-506); and mTOR inhibitors, e.g., sirolimus (rapamycin) or rapamycin derivatives, e.g., soluble rapamycin derivatives (e.g., ester rapamycin derivatives, e.g., CCI-779; COX2 inhibitors, e.g., celecoxib and variants thereof; and phospholipase inhibitors, e.g., inhibitors of cytosolic phospholipase 2 (cPLA2) (e.g., trifluoromethyl ketone analogs)
  • cPLA2 cytosolic phospholipase 2
  • Additional examples of therapeutic agents that can be combined with an IL-21/EL-21R agonist include one or more of: 6-mercaptopurines (6-MP); azathioprine sulphasalazine; mesalazine; olsalazine chloroquinine/hydroxychloroquine; pencillamine; aurothiomalate (intramuscular and oral); azathioprine; cochicine; beta-2 adrenoreceptor agonists (salbutamol, terbutaline, salmeteral); xanthines (theophylline, arninophylline); cromoglycate; nedocromil; ketotifen; ipratropium and oxitropium; mycophenolate mofetil; adenosine agonists; antithrombotic agents; complement inhibitors; and adrenergic agents.
  • 6-MP 6-mercaptopurines
  • azathioprine sulphasalazine me
  • kits for carrying out the combined administration of the IL-21/IL21R antagonists with other therapeutic compounds comprises one or more binding agents formulated in a pharmaceutical carrier, and at least one agent, e.g., therapeutic agent, formulated as appropriate, in one or more separate pharmaceutical preparations.
  • agent e.g., therapeutic agent
  • any standard assay can be used to evaluate cytokine levels in a sample or a subject.
  • the sample can be obtained from a subject or can include culture cells.
  • Exemplary samples can be obtained or derived from one or more cells, tissue, or bodily fluids such as blood, urine, lymphatic fluid, cerebrospinal fluid, or amniotic fluid, cultured cells (e.g., tissue culture cells), buccal swabs, mouthwash, stool, tissues slices, and biopsy materials (e.g., biopsy aspiration).
  • Methods for evaluating cytokine levels include evaluating nucleic acids to detect mRNA or cDNA encoding a cytokine of interest (e.g., IL-10 or IL-21) or evaluating proteins to detect the cytokine itself.
  • Nucleic acids can be evaluated, e.g., using RT-PCR (e.g., quantitative PCR) or nucleic acid microarrays. Proteins can be evaluated, e.g., using mass spectroscopy or an immunoassay.
  • ELISAs provide one convenient form of immunoassay.
  • Biosource for example, Biosource
  • R&D Systems provides reagents to detect EFN- ⁇ with a sensitivity ⁇ 8 pg/ml or TGF-betal with a sensitivity of ⁇ 7 pg/ml.
  • a cytokine e.g., IL-10 or EFN ⁇
  • an acceptable changes e.g., to a level in a range of normal of a cytokine, e.g., IL-10 or
  • EFN ⁇ EFN ⁇ .
  • Information from the evaluating can be used to modulate the dosage of the agonist. For example, if EL-10 levels are not increased to levels within the range of a normal subject, administration of the agonist can be increased, e.g., by increasing dosage or frequency. Conversely, if EL-10 levels are increased beyond the desired range, the administration of the agonist can be decreased, e.g., by decreasing dosage or frequency.
  • IL-21 /EL21R agonists as activators of an immune system can, among other means, be measured by the following methods:
  • Suitable assays for thymocyte or splenocyte cytotoxicity include, without limitation, those described in: Current Protocols in Immunology, Ed by J. E. Coligan, A. M. Kruisbeek, D. H. Margulies, E. M. Shevach, W Strober, Pub. Greene Publishing Associates and Wiley-Interscience (Chapter 3, In Vitro assays for Mouse Lymphocyte Function 3.1-3.19; Chapter 7, Immunologic studies in Humans); Herrmann et al., Proc. Natl. Acad. Sci. U.S.A. 78:2488-2492, 1981 ; Herrmann et al., J. Immunol. 128:1968- 1974, 1982; Handa et al., J.
  • T-cell-dependent immunoglobulin responses and isotype switching (which will identify, among others, proteins that modulate T-cell dependent antibody responses and that affect Thl/Th2 profiles) include, without limitation, those described in: Maliszewski, J. Immunol. 144:3028-3033, 1990; and Assays for B cell function: In vitro antibody production, Mond, J. J. and Brunswick, M. In Current Protocols in Immunology. J. E.e.a. Coligan eds. Vol 1 pp. 3.8.1-3.8.16, John Wiley and Sons, Toronto. 1994.
  • MLR Mixed lymphocyte reaction
  • Dendritic cell-dependent assays (which will identify, among others, proteins expressed by dendritic cells that activate naive T-cells) include, without limitation, those described in: Guery et al., J. Immunol.
  • lymphocyte survival/apoptosis (which will identify, among others, proteins that prevent apoptosis after superantigen induction and proteins that regulate lymphocyte homeostasis) include, without limitation, those described in: Darzynkiewicz et al., Cytometry 13:795-808, 1992; Gorczyca et al., Leukemia 7:659- 670, 1993; Gorczyca et al., Cancer Research 53: 1945-1951, 1993; Itoh et al., Cell 66:233-243, 1991; Zacharchuk, Journal of Immunology 145:4037-4045, 1990; Zamai et al., Cytometry 14:891-897, 1993; Gorczyca et al., International Journal of Oncology 1 :639-648, 1992.
  • Assays for proteins that influence early steps of T-cell commitment and development include, without limitation, those described in: Antica et al., Blood 84:111-117, 1994; Fine et al., Cellular Immunology 155:111-122, 1994; Galy et al., Blood 85:2770-2778, 1995; Toki et al., Proc. Nat. Acad Sci. U.S.A. 88:7548-7551, 1991.
  • evaluated cells e.g., cells treated with an agonist or a candidate agonist
  • tyrosine phosphorylated proteins can be immunoprecipitated with an anti-phosphotyrosine antibody.
  • precipitated materials can then be evaluated using antibodies specific for a signalling pathway component, e.g., an antibody to the STAT protein, e.g., STAT5.
  • EL-21/IL21R Agonists as Modulators of Cytokine Production and Cell Proliferation/Differentiation
  • the activity of EL-21 /EL21R agonists as modulator of cytokine production and cell proliferation/differentiation can be tested using any one of a number of routine factor dependent cell proliferation assays for cell lines including, without limitation, 32D, DA2, DA1G, T10, B9, B9/11, BaF3, MC9/G, M+(preB M+), 2E8, RB5, DAI, 123, Tl 165, HT2, CTLL2, TF-1, Mo7e and CMK.
  • Assays for T-cell or thymocyte proliferation include without limitation those described in: Current Protocols in Immunology, Ed by J. E. Coligan, A. M. Kruisbeek, D. H. Margulies, E. M. Shevach, W Strober, Pub. Greene Publishing Associates and Wiley-Interscience (Chapter 3, In Vitro assays for Mouse Lymphocyte Function 3.1- 3.19; Chapter 7, Immunologic studies in Humans); Takai et al., J. Immunol. 137:3494- 3500, 1986; Bertagnolli et al., J. Immunol.
  • Assays for cytokine production and/or proliferation of spleen cells, lymph node cells or thymocytes include, without limitation, those described in: Polyclonal T cell stimulation, Kruisbeek, A. M. and Shevach, E. M. In Current Protocols in Immunology. J. E.e.a. Coligan eds. Vol 1 pp. 3.12.1-3.12.14, John Wiley and Sons, Toronto. 1994; and Measurement of mouse and human Interferon gamma, Schreiber, R. D. In Current Protocols in Immunology. J. Coligan eds. Vol 1 pp. 6.8.1-6.8.8, John Wiley and Sons, Toronto. 1994.
  • Assays for proliferation and differentiation of hematopoietic and lymphopoietic cells include, without limitation, those described in: Measurement of Human and Murine Interleukin 2 and Interleukin 4, Bottomly, K., Davis, L. S. and Lipsky, P. E. In Current Protocols in Immunology. J. Coligan eds. Vol 1 pp. 6.3.1-6.3.12, John Wiley and Sons, Toronto. 1991; deVries et al., J. Exp. Med. 173:1205-1211, 1991; Moreau et al., Nature 336:690-692, 1988; Greenberger et al., Proc. Natl. Acad. Sci. U.S.A.
  • Assays for T-cell clone responses to antigens include, without limitation, those described in: Current Protocols in Immunology, Ed by J. E. Coligan, A. M. Kruisbeek, D. H. Margulies, E. M. Shevach, W Strober, Pub. Greene Publishing Associates and Wiley-Interscience (Chapter 3, In Vitro assays for Mouse Lymphocyte Function; Chapter 6, Cytokines and their cellular receptors; Chapter 7, Immunologic studies in Humans); Weinberger et al., Proc. Natl. Acad. Sci. U.S.A.
  • mice Female C57BL/6 and female SJL/J mice were obtained from The Jackson Laboratory. The animals were housed within an AAALAC-approved barrier facility and monitored for parasites as well as bacterial and viral pathogens. All mice were used at 8-10 weeks of age.
  • Lymph node cells of C57BL/6 female mice challenged with the mouse oligodendrocyte glycoprotein (MOG) 3 -55 peptide were harvested from the mice 20 days after immunization.
  • Cells were cultured in Dulbecco's Modified Eagle's Media (DME) containing 10% fetal calf serum (FCS).
  • DME Dulbecco's Modified Eagle's Media
  • FCS fetal calf serum
  • the cells were restimulated with the MOG 5-55 peptide (25 ⁇ g/ml) and grown in flat-bottom 96-well microtiter plates in the presence or absence of murine EL-21. After 72 hours, the plates were pulsed with 0.5 ⁇ Ci tritiated thymidine/well and incubated for a 4- to 6-hour period.
  • the mean incorporation of thymidine in the DNA in the triplicate wells was measured by a scintillation counter.
  • Lymph node cells derived from immunized mice were activated in vitro with 25 ⁇ g/ml of the MOG 35 . 5 5 peptide.
  • Cells were cultured in (DME) containing 10% FCS and IL-2 (10 U/ml) and various concentrations of murine EL-21 ranging from 5 ng/ml to 25 ng/ml. Culture supernatants were collected after 72 hours and were analyzed for cytokine and chemokine production using the SEARCHLIGHTTM Proteome Array System (Pierce, Boston Technology Center).
  • mice Female SJL/J mice were immunized subcutaneously with 100 ⁇ g of the proteolipid protein (PLP) ⁇ 39 - ⁇ 5 ⁇ peptide emulsified in complete Freund's adjuvant supplemented with 800 ⁇ g of Mycobacterium tuberculosis H37 Ra (Difco Laboratories). Mice also received intraperitoneal injections with 400 ng of pertussis toxin (List Biological Laboratories) at the time of immunization and 48 hours later.
  • PRP proteolipid protein
  • H37 Ra Mycobacterium tuberculosis H37 Ra
  • mice were scored daily for clinical signs of EAE according to the following scale: 0, no disease, 1, limp tail; 2, hind limb weakness or partial paralysis; 3, complete hind limb paralysis; 4, front and hind limb paralysis, and 5, moribund.
  • the mean clinical score was calculated by averaging the individual scores of the mice in each group.
  • EL-21 administration in vivo Mice sensitized for EAE were given intraperitoneal injections of murine IL-21 at 100 ng/day or 1 ⁇ g /day in 0.2 ml of PBS.
  • the control mice were dosed with 0.2 ml of saline. Treatment began on the day prior to immunization with the PLP ⁇ 39- ⁇ 5 ⁇ peptide and continued on alternate days for a total often doses.
  • lymphocytes cultured with 20 ng/ml of IL-21 showed a significant 3.5-fold increase in proliferation as compared to cells stimulated with peptide alone.
  • the cells Upon titration of the cytokine, the cells exhibited a similar proliferative capacity as the control cells.
  • Figure IB shows increased proliferation of T cells from proteolipid protein (PLP) transgenic mice cultured at the indicated concentration of murine IL-21 (ng/ml) compared to cells treated with only 1 ⁇ g/ml of PLP.
  • PLP proteolipid protein
  • lymphocytes were cultured with IL-21.
  • IL-21 induced increased secretion of the Th2 cytokine, EL-10, as compared to untreated cells. This response was saturable ( Figure 2 and Table 2) and at the highest tested concentration of IL-21 (25 ng/ml), cells produced approximately 2.5-fold more IL-10 than the control group.
  • Figure 3 shows a decrease in secretion of EFN ⁇ by spleen cells treated with the indicated concentrations of murine IL-21 compared to control cells.
  • Addition of EL-21 to MOG 33 -55 -stimulated spleen cells from immunized mice results in a two-fold decrease of EFN ⁇ , whereas addition of IL-21R yields a two-fold increase.
  • lymph node cells were treated with IL-21, EFN ⁇ levels were decreased from 20,000 pg/ml (control) or 15840 pg/ml (mock treated) to 3260 pg/ml (EL-21 treated).
  • mice were immunized with the encephalito genie PLP ⁇ - ⁇ . ⁇ peptide in CFA plus pertussis toxin and treated them with a prophylactic regimen of EL-21.
  • the clinical course of EAE was compared in mice treated with saline or EL-21.
  • Table 4 documents average changes in cytokine secretion in two exemplary PLP cultures treated in the presence or absence of murine IL-21.
  • the cytokine level in the untreated control cells is normalized to 100.
  • mice were highly susceptible to disease. In contrast, mice treated with either a low (100 ng/day) or high (1 ⁇ g/day) dose of IL-21 had less severe clinical scores.
  • Figure 5 and Table 5 shows a decrease in the severity of EAE in mice treated with either a low (100 ng/day) or high (1 ⁇ g /day) dose of murine IL-21 compared to control mice.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Cell Biology (AREA)
  • Psychiatry (AREA)
  • Pain & Pain Management (AREA)
  • Hospice & Palliative Care (AREA)
  • Rheumatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2004/008833 2003-03-21 2004-03-22 Treating immunological disorder using agonists of interleukin-21/ interleukin-21 receptor Ceased WO2004084835A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP04758055A EP1608315A4 (en) 2003-03-21 2004-03-22 TREATMENT OF IMMUNOLOGICAL DISORDERS USING INTERLEUKIN-21 / INTERLEUKIN-21 RECEPTOR
JP2006507478A JP2006523682A (ja) 2003-03-21 2004-03-22 インターロイキン−21/インターロイキン−21受容体のアゴニストを用いた免疫学的障害の治療
AU2004224277A AU2004224277A1 (en) 2003-03-21 2004-03-22 Treating immunological disorder using agonists of interleukin-21/ interleukin-21 receptor
BRPI0408523-0A BRPI0408523A (pt) 2003-03-21 2004-03-22 métodos para melhorar um sintoma de esclerose múltipla em um indivìduo, para melhorar esclerose múltipla em um indivìduo mamìfero, para modular uma deficiência de il-10, ou um distúrbio associado com uma deficiência de il-10 em um indivìduo mamìfero, para tratar ou prevenir um distúrbio imunológico em um indivìduo mamìfero e para avaliar o tratamento de esclerose múltipla em um indivìduo mamìfero, composição farmacêutica, e, artigo de manufatura
MXPA05010035A MXPA05010035A (es) 2003-03-21 2004-03-22 Tratamiento de desordenes inmunologicos usando agonistas de interleucina-21/receptor de interleucina-21.
CA002518854A CA2518854A1 (en) 2003-03-21 2004-03-22 Treating immunological disorder using agonists of interleukin-21/interleukin-21 receptor
NO20054343A NO20054343L (no) 2003-03-21 2005-09-20 Behandling av immunologiske lidelser ved anvendelse av agonister av interleukin-21/interleukin-21 reseptor
IL198102A IL198102A0 (en) 2003-03-21 2009-04-07 Use of an il-21 polypeptide in the manufacture of a medicament for modulating an il-10 deficiency, or a disorder associated therewith in a mammal

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US45692003P 2003-03-21 2003-03-21
US60/456,920 2003-03-21

Publications (2)

Publication Number Publication Date
WO2004084835A2 true WO2004084835A2 (en) 2004-10-07
WO2004084835A3 WO2004084835A3 (en) 2006-05-26

Family

ID=33098171

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2004/008833 Ceased WO2004084835A2 (en) 2003-03-21 2004-03-22 Treating immunological disorder using agonists of interleukin-21/ interleukin-21 receptor

Country Status (17)

Country Link
US (1) US20060159655A1 (enExample)
EP (1) EP1608315A4 (enExample)
JP (1) JP2006523682A (enExample)
KR (1) KR20060015482A (enExample)
CN (1) CN1849131A (enExample)
AU (1) AU2004224277A1 (enExample)
BR (1) BRPI0408523A (enExample)
CA (1) CA2518854A1 (enExample)
CO (1) CO5611161A2 (enExample)
CR (1) CR7994A (enExample)
EC (1) ECSP056027A (enExample)
IL (1) IL198102A0 (enExample)
MX (1) MXPA05010035A (enExample)
NO (1) NO20054343L (enExample)
RU (1) RU2005132458A (enExample)
WO (1) WO2004084835A2 (enExample)
ZA (1) ZA200507235B (enExample)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2008538290A (ja) * 2005-04-18 2008-10-23 ノボ ノルディスク アクティーゼルスカブ Il−21変異体
WO2009143526A1 (en) * 2008-05-23 2009-11-26 Wyeth Methods of treatment utilizing binding proteins of the interleukin-21 receptor
WO2009100035A3 (en) * 2008-02-01 2009-12-23 Wyeth Interleukin-21 (il-21) and il-21 receptor (il-21r) modulation of regulatory t cells and forkhead box p3 (foxp3)
US7705123B2 (en) 1998-03-17 2010-04-27 Genetics Institute, Llc MU-1, member of the cytokine receptor family
US7731946B2 (en) 2002-07-15 2010-06-08 Wyeth Llc Methods and compositions for modulating T helper (TH) cell development and function
WO2010041149A3 (en) * 2008-10-08 2010-09-30 Cambridge Enterprise Methods and compositions for diagnosis and treatment of autoimmune disease secondary to multiple sclerosis
US7910105B2 (en) 2005-04-14 2011-03-22 Wyeth Llc Methods for treating and preventing fibrosis
US8143385B2 (en) 2003-03-14 2012-03-27 Wyeth Llc Nucleic acids coding for antibodies against human IL-21 receptor and uses therefor
US8163884B2 (en) 2008-05-23 2012-04-24 Wyeth Llc Interleukin-21 receptor binding proteins
US8450459B2 (en) 2003-10-10 2013-05-28 Novo Nordisk A/S IL-21 derivatives and variants
US8455449B2 (en) 2011-01-18 2013-06-04 Bioniz, Llc Compositions and methods for modulating γ-c-cytokine activity
US9959384B2 (en) 2013-12-10 2018-05-01 Bioniz, Llc Methods of developing selective peptide antagonists
US10030059B2 (en) 2015-10-09 2018-07-24 Bioniz, Llc Modulators of gamma-C-cytokine activity
WO2022117569A1 (en) 2020-12-02 2022-06-09 Oncurious Nv A ccr8 antagonist antibody in combination with a lymphotoxin beta receptor agonist antibody in therapy against cancer
US12030936B2 (en) 2019-05-03 2024-07-09 Bioniz Therapeutics, Inc. Modulating the effects of gamma-c-cytokine signaling for the treatment of alopecia and alopecia associated disorders
WO2024146959A1 (en) * 2023-01-06 2024-07-11 Twain Therapeutics Pte. Ltd. Antigen-binding molecules

Families Citing this family (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7276478B2 (en) * 2003-09-25 2007-10-02 Zymogenetics, Inc. Methods of treating autoimmune diseases using IL-21
BRPI0510996A (pt) * 2004-05-19 2007-12-04 Wyeth Corp métodos para melhorar um sintoma de um distúrbio atópico, e para tratar ou prevenir um distúrbio atópico em um paciente, métodos para modular a produção de igg e ige em uma célula, e nìveis relativos de ige e igg, composição farmacêutica, recipiente, métodos para avaliar um paciente tendo ou suspeito de ter um distúrbio atópico, e para avaliar um paciente quanto ao risco de um distúrbio atópico
US20060039902A1 (en) * 2004-08-05 2006-02-23 Young Deborah A Antagonizing interleukin-21 receptor activity
AU2006341398B9 (en) * 2005-11-28 2012-02-02 Zymogenetics, Inc. IL-21 receptor antagonists
JP5322653B2 (ja) * 2005-11-28 2013-10-23 ザイモジェネティクス, インコーポレイテッド Il−21アンタゴニスト
JP5745274B2 (ja) 2007-12-07 2015-07-08 ザイモジェネティクス, インコーポレイテッド 抗ヒトil−21モノクローナル抗体
US20100075329A1 (en) * 2008-09-23 2010-03-25 O'toole Margot Methods for predicting production of activating signals by cross-linked binding proteins
US20110293700A1 (en) * 2010-05-26 2011-12-01 Selecta Biosciences, Inc. Nanocarrier compositions with uncoupled adjuvant
WO2012112933A1 (en) * 2011-02-18 2012-08-23 The Scripps Research Institute Directed differentiation of oligodendrocyte precursor cells to a myelinating cell fate
MA45488A (fr) 2015-10-22 2018-08-29 Juno Therapeutics Gmbh Procédés, kits et appareil de culture de cellules
WO2020009437A1 (ko) * 2018-07-04 2020-01-09 서울대학교산학협력단 신경손상의 면역세포치료
CN120535649A (zh) 2018-08-30 2025-08-26 免疫生物公司 单链嵌合多肽和其用途
NZ772550A (en) 2018-08-30 2025-08-29 Immunitybio Inc Multi-chain chimeric polypeptides and uses thereof
CN112888445B (zh) 2018-08-30 2025-06-10 免疫生物公司 治疗老年化相关病症的方法
KR20220035394A (ko) 2019-06-21 2022-03-22 에이치씨더블유 바이올로직스, 인크. 다중-사슬 키메라 폴리펩티드 및 이의 용도
WO2021163298A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of activating regulatory t cells
KR20220140535A (ko) 2020-02-11 2022-10-18 에이치씨더블유 바이올로직스, 인크. 크로마토그래피 수지 및 이의 용도
AU2021220870A1 (en) 2020-02-11 2022-08-04 Immunitybio, Inc. Methods of treating age-related and inflammatory diseases
WO2021247003A1 (en) 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
KR20230031280A (ko) 2020-06-01 2023-03-07 에이치씨더블유 바이올로직스, 인크. 노화 관련 장애의 치료 방법
US12012441B2 (en) 2020-10-26 2024-06-18 Neptune Biosciences Llc Engineered human IL-21 cytokines and methods for using the same

Family Cites Families (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20010025022A1 (en) * 1997-11-26 2001-09-27 Kikly Kristine Kay Hnovilr
US7198789B2 (en) * 1998-03-17 2007-04-03 Genetics Institute, Llc Methods and compositions for modulating interleukin-21 receptor activity
US7189400B2 (en) * 1998-03-17 2007-03-13 Genetics Institute, Llc Methods of treatment with antagonists of MU-1
US6057128A (en) * 1998-03-17 2000-05-02 Genetics Institute, Inc. MU-1, member of the cytokine receptor family
US20030003545A1 (en) * 1998-05-29 2003-01-02 Reinhard Ebner Interleukins-21 and 22
WO2000008152A1 (en) * 1998-08-04 2000-02-17 Regeneron Pharmaceuticals, Inc. Novel orphan cytokine receptors
US6576744B1 (en) * 1998-09-23 2003-06-10 Zymogenetics, Inc. Cytokine receptor zalpha11
US6307024B1 (en) * 1999-03-09 2001-10-23 Zymogenetics, Inc. Cytokine zalpha11 Ligand
US20020090680A1 (en) * 1999-05-18 2002-07-11 Millennium Pharmaceuticals, Inc. Novel IL-9/IL-2 receptor-like molecules and uses thereof
AU2001253127A1 (en) * 2000-04-05 2001-10-23 Zymogenetics Inc. Soluble zalpha11 cytokine receptors
EP3254687A1 (en) * 2001-10-04 2017-12-13 Genetics Institute LLC Methods and compositions for modulating interleukin-21 receptor activity
DE60233888D1 (de) * 2001-11-05 2009-11-12 Zymogenetics Inc Il-21-antagonisten
AU2003226141A1 (en) * 2002-03-27 2003-10-13 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Method for treating cancer in humans
US20040016010A1 (en) * 2002-04-17 2004-01-22 Marion Kasaian IL-21 receptor knockout animal and methods of use thereof
PT1531850E (pt) * 2002-06-07 2012-05-07 Zymogenetics Inc Utilização de il-21 e anticorpo monoclonal para tratar cancros sólidos
KR20050037552A (ko) * 2002-07-15 2005-04-22 와이어쓰 T 헬퍼(th) 세포 발생 및 기능을 조절하는 방법 및조성물
JP4914209B2 (ja) * 2003-03-14 2012-04-11 ワイス ヒトil−21受容体に対する抗体および該抗体の使用
BRPI0510996A (pt) * 2004-05-19 2007-12-04 Wyeth Corp métodos para melhorar um sintoma de um distúrbio atópico, e para tratar ou prevenir um distúrbio atópico em um paciente, métodos para modular a produção de igg e ige em uma célula, e nìveis relativos de ige e igg, composição farmacêutica, recipiente, métodos para avaliar um paciente tendo ou suspeito de ter um distúrbio atópico, e para avaliar um paciente quanto ao risco de um distúrbio atópico
US20060039902A1 (en) * 2004-08-05 2006-02-23 Young Deborah A Antagonizing interleukin-21 receptor activity
US7533965B2 (en) * 2005-03-07 2009-05-19 Eastman Kodak Company Apparatus and method for electrostatically charging fluid drops
GT200600148A (es) * 2005-04-14 2006-11-22 Metodos para el tratamiento y la prevencion de fibrosis

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of EP1608315A4 *

Cited By (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7994292B2 (en) 1998-03-17 2011-08-09 Genetics Institute, Llc MU-1, member of the cytokine receptor family
US7705123B2 (en) 1998-03-17 2010-04-27 Genetics Institute, Llc MU-1, member of the cytokine receptor family
US7731946B2 (en) 2002-07-15 2010-06-08 Wyeth Llc Methods and compositions for modulating T helper (TH) cell development and function
US8143385B2 (en) 2003-03-14 2012-03-27 Wyeth Llc Nucleic acids coding for antibodies against human IL-21 receptor and uses therefor
US8450459B2 (en) 2003-10-10 2013-05-28 Novo Nordisk A/S IL-21 derivatives and variants
US7910105B2 (en) 2005-04-14 2011-03-22 Wyeth Llc Methods for treating and preventing fibrosis
JP2008538290A (ja) * 2005-04-18 2008-10-23 ノボ ノルディスク アクティーゼルスカブ Il−21変異体
US8383367B2 (en) 2005-04-18 2013-02-26 Novo Nordisk A/S IL-21 variant nucleic acids
JP2012070742A (ja) * 2005-04-18 2012-04-12 Novo Nordisk As Il−21変異体
WO2009100035A3 (en) * 2008-02-01 2009-12-23 Wyeth Interleukin-21 (il-21) and il-21 receptor (il-21r) modulation of regulatory t cells and forkhead box p3 (foxp3)
CN102149403A (zh) * 2008-05-23 2011-08-10 惠氏有限责任公司 利用白介素-21受体结合蛋白的治疗方法
WO2009143526A1 (en) * 2008-05-23 2009-11-26 Wyeth Methods of treatment utilizing binding proteins of the interleukin-21 receptor
US8163884B2 (en) 2008-05-23 2012-04-24 Wyeth Llc Interleukin-21 receptor binding proteins
US8178097B2 (en) 2008-05-23 2012-05-15 Wyeth Llc Methods of treatment utilizing binding proteins of the interleukin-21 receptor
KR101682730B1 (ko) * 2008-10-08 2016-12-05 캠브리지 엔터프라이즈 리미티드 다발경화증에 대한 2차 자가면역 질환의 진단 및 치료를 위한 방법 및 조성물
KR101825457B1 (ko) 2008-10-08 2018-02-05 캠브리지 엔터프라이즈 리미티드 다발경화증에 대한 2차 자가면역 질환의 진단 및 치료를 위한 방법 및 조성물
US11243211B2 (en) 2008-10-08 2022-02-08 Cambridge Enterprise Limited Methods and compositions for diagnosis and treatment of autoimmune disease secondary to multiple sclerosis by assessing genotypes associated with elevated IL-21
US10598670B2 (en) 2008-10-08 2020-03-24 Cambridge Enterprise Limited Methods and compositions for diagnosis and treatment of autoimmune disease secondary to multiple sclerosis
KR20110094276A (ko) * 2008-10-08 2011-08-23 캠브리지 엔터프라이즈 리미티드 다발경화증에 대한 2차 자가면역 질환의 진단 및 치료를 위한 방법 및 조성물
RU2563521C2 (ru) * 2008-10-08 2015-09-20 Кембридж Энтерпрайз Лимитед Способы и композиции для диагностики и лечения аутоиммунной болезни, возникающей вследствие рассеянного склероза
WO2010041149A3 (en) * 2008-10-08 2010-09-30 Cambridge Enterprise Methods and compositions for diagnosis and treatment of autoimmune disease secondary to multiple sclerosis
EP3241910A1 (en) * 2008-10-08 2017-11-08 Cambridge Enterprise Limited Methods and compositions for diagnosis and treatment of autoimmune disease secondary to multiple sclerosis
US9675672B2 (en) 2011-01-18 2017-06-13 Bioniz, Llc Compositions and methods for modulating gamma-C-cytokine activity
US9951105B2 (en) 2011-01-18 2018-04-24 Bioniz, Llc Methods of developing selective peptide antagonists
US11834519B2 (en) 2011-01-18 2023-12-05 Bioniz Therapeutics, Inc. Compositions and methods for modulating γ-c-cytokine activity
US9133244B2 (en) 2011-01-18 2015-09-15 Bioniz, Llc Compositions and methods for modulating gamma-c-cytokine activity
US10227382B2 (en) 2011-01-18 2019-03-12 Bioniz, Llc Method of designing a peptide and/or peptide derivative for modulating gamma-c-cytokine activity
US9133243B2 (en) 2011-01-18 2015-09-15 Bioniz, Llc Compositions and methods for modulating γ-c-cytokine activity
US10808009B2 (en) 2011-01-18 2020-10-20 Bioniz, Llc Peptide conjugates
US8455449B2 (en) 2011-01-18 2013-06-04 Bioniz, Llc Compositions and methods for modulating γ-c-cytokine activity
US11708392B2 (en) 2011-01-18 2023-07-25 Bioniz, Llc Peptide conjugates
US11462297B2 (en) 2013-12-10 2022-10-04 Bioniz, Llc Selective peptide antagonists
US9959384B2 (en) 2013-12-10 2018-05-01 Bioniz, Llc Methods of developing selective peptide antagonists
US10854312B2 (en) 2013-12-10 2020-12-01 Bioniz, Llc Selective peptide antagonists
US10030058B2 (en) 2015-10-09 2018-07-24 Bioniz, Llc Modulating gamma-C-cytokine activity
US11400134B2 (en) 2015-10-09 2022-08-02 Bioniz, Llc Modulating gamma-c-cytokine activity
US10030059B2 (en) 2015-10-09 2018-07-24 Bioniz, Llc Modulators of gamma-C-cytokine activity
US12030936B2 (en) 2019-05-03 2024-07-09 Bioniz Therapeutics, Inc. Modulating the effects of gamma-c-cytokine signaling for the treatment of alopecia and alopecia associated disorders
WO2022117569A1 (en) 2020-12-02 2022-06-09 Oncurious Nv A ccr8 antagonist antibody in combination with a lymphotoxin beta receptor agonist antibody in therapy against cancer
WO2024146959A1 (en) * 2023-01-06 2024-07-11 Twain Therapeutics Pte. Ltd. Antigen-binding molecules

Also Published As

Publication number Publication date
EP1608315A4 (en) 2008-07-16
RU2005132458A (ru) 2006-03-20
AU2004224277A1 (en) 2004-10-07
KR20060015482A (ko) 2006-02-17
BRPI0408523A (pt) 2006-03-21
CA2518854A1 (en) 2004-10-07
CO5611161A2 (es) 2006-02-28
US20060159655A1 (en) 2006-07-20
WO2004084835A3 (en) 2006-05-26
NO20054343L (no) 2005-11-24
JP2006523682A (ja) 2006-10-19
CN1849131A (zh) 2006-10-18
NO20054343D0 (no) 2005-09-20
ECSP056027A (es) 2006-09-18
EP1608315A2 (en) 2005-12-28
IL198102A0 (en) 2009-12-24
CR7994A (es) 2006-10-17
ZA200507235B (en) 2007-03-28
MXPA05010035A (es) 2005-11-17

Similar Documents

Publication Publication Date Title
US20060159655A1 (en) Treating immunological disorders using agonists of interleukin-21 / interleukin-21 receptor
EP1432431B1 (en) Methods and compositions for modulating interleukin-21 activity
EP1644415B1 (en) Antibodies against interleukin-22 and uses therefor
US7198789B2 (en) Methods and compositions for modulating interleukin-21 receptor activity
JP5905534B2 (ja) 多発性硬化症を治療する方法
US20080241098A1 (en) Antagonizing interleukin-21 receptor activity
RU2419450C2 (ru) Способы лечения и профилактики фиброза антагонистами il-21/il-21r
US20060024268A1 (en) Modulation of immunoglobulin production and atopic disorders
JP2025000638A (ja) 抗IFN-α/ω抗体の投与方法
Steinberger et al. Allergen-specific IgE production of committed B cells from allergic patients in vitro
CA2596276A1 (en) Use of baff to treat th2-mediated conditions
AU2008207646A1 (en) Methods and compositions for modulating interleukin-21 receptor activity
NZ567242A (en) Use of an IL-21/IL-21R agonist for modulating interleukin-21 receptor activity and treating cancer
HK1063011B (en) Methods and compositions for modulating interleukin-21 activity
HK1063011A (en) Methods and compositions for modulating interleukin-21 activity
AU2002330061A1 (en) Methods and compositions for modulating interleukin-21 receptor activity

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 2005/07235

Country of ref document: ZA

Ref document number: 200507235

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: 2518854

Country of ref document: CA

Ref document number: 4049/DELNP/2005

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 542405

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: CR2005-007994

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: 1-2005-501690

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 171003

Country of ref document: IL

Ref document number: PA/a/2005/010035

Country of ref document: MX

Ref document number: 2004224277

Country of ref document: AU

Ref document number: 1020057017652

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 20048076306

Country of ref document: CN

Ref document number: 2006507478

Country of ref document: JP

Ref document number: 05095726

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2004224277

Country of ref document: AU

Date of ref document: 20040322

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2004224277

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2004758055

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2005132458

Country of ref document: RU

Ref document number: 1200501544

Country of ref document: VN

WWP Wipo information: published in national office

Ref document number: 2004758055

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1020057017652

Country of ref document: KR

ENP Entry into the national phase

Ref document number: PI0408523

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 198102

Country of ref document: IL