WO2004005342A1 - Glp-1 and methods for treating diabetes - Google Patents
Glp-1 and methods for treating diabetes Download PDFInfo
- Publication number
- WO2004005342A1 WO2004005342A1 PCT/DK2003/000463 DK0300463W WO2004005342A1 WO 2004005342 A1 WO2004005342 A1 WO 2004005342A1 DK 0300463 W DK0300463 W DK 0300463W WO 2004005342 A1 WO2004005342 A1 WO 2004005342A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glp
- diabetes
- use according
- insulin
- mammal
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/155—Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/427—Thiazoles not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/54—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame
- A61K31/549—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame having two or more nitrogen atoms in the same ring, e.g. hydrochlorothiazide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/64—Sulfonylureas, e.g. glibenclamide, tolbutamide, chlorpropamide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/702—Oligosaccharides, i.e. having three to five saccharide radicals attached to each other by glycosidic linkages
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/2278—Vasoactive intestinal peptide [VIP]; Related peptides (e.g. Exendin)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/28—Insulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/31—Somatostatins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- the present invention generally relates to a method for treating diabetes and related disorders in a mammal.
- the method involves administering glucagon like peptide (GLP-1) or a related molecule having GLP-1 like effect to provide a therapeutically effective amount of endogenous insulin.
- GLP-1 glucagon like peptide
- the amount of drug administered to the mammal is substantially reduced to produce a "drug holiday".
- Practice of the invention achieves effective therapy without continuous drug exposure and without continuous presence of therapeutic levels of the drug.
- GLP-1 Glucagon-like peptide 1
- GLP-1 has been described as a physiological incretin hormone. It reportedly serves to augment an insulin response after an oral intake of glucose or fat. It is generally understood that GLP-1 lowers glucagon concentrations, slows gastric emptying, stimulates (pro)insulin biosynthesis, enhances insulin sensitivity and stimulates the insulin independent glycogen synthesis. See Hoist, JJ (1999) Curr Med Chem. 6: 1005; Nauck, MA, et al. (1997) Exp Clin Endocrinol Diabetes 105:187; and Lopez-Delgado,MI, et al. (1998) Endocrinology 139:2811.
- GLP-1 amino acid and protein sequence has been reported for human and other mammals.
- GLP-1 is thought to have a 37 amino acid residue protein. See eg., Heinrich, G., et al., Endocrinol, 115: 2176 (1984); and Uttenthal, L. O., et al., J. Clin. Endocrinol. Metabol,
- GLP-1 (7- 37) is known.
- a variety of analogs have also been described eg., Gin 9 -GLP-1 (7-37), D- Gln 9 -GLP-1 (7-37), acetyl-Lys 9 -GLP-1 (7-37), Thr 16 -Lys 18 -GLP-l(7-37), and Lys 18 -GLP- 1 (7-37), Gly 8 -GLP-1 (7-37), Ser 8 -GLP-1 (7-37),.
- GLP-1 derivatives have also been reported particularly as acid addition salts, carboxylate salts, lower alkyl esters, and amides. See WO 91/11457 and Mojsov, S., Int. J. Peptide Protein Research, 40:333-343 (1992), and references cited therein.
- GLP-1 derivatives have been disclosed some of which are reported to have agonist activity. See eg., U.S. Patent Nos. 6,358,924; 6,344,180; 6,284,725; 6,277,819; 6,271,241; 6,268,343; and 6,191,102.
- exendin- 4 a protein called exendin- 4 has been isolated from the salivary gland of the Gila monster. Further work has shown that the peptide is related to GLP-1. There is recognition that the peptide is a potent agonist for the mammalian GLP-1 receptor. Recent studies have shown that administration of exendin-4 induces pancreatic endocrine differentiation, islet proliferation and an increase in jS-cell mass indicating that exendin-4 may exert tropic effects on the /3-cells. See Raufman, JP, et al. J (1992) J Biol Chem 267:21432; Young, AA, et al.
- GLP-1 is further capable of enhancing the ability of ⁇ -cells to sense and respond to glucose in subjects with impaired glucose tolerance. See Byrne et al., supra.
- db/db mice is a satisfactory model of human type II diabetes.
- This diabetic mouse has been characterized by leptin receptor mutation leading to severe obesity, early onset of type II diabetes, hyperinsulinaemia and marked peripheral insulin resistance. Ultimately these animals develop ⁇ -cell exhaust and full insulin dependence.
- the clinical progression from type II to type I diabetes in db/db mice is believed to be bear relationship to human type II diabetes. See Coleman, DL (1973) Diabetologia 9:294; and Leiter, EH, et al. (1983) J.Nutr. 113:184.
- Reported treatment methods generally involve administration of insulin alone or in conjunction with one or more agents including oral hypoglycemic drugs. See S. N. Davis and D. Granner, supra.
- the invention generally relates to a method for preventing or treating diabetes and related disorders in a mammal.
- the method involves administering a therapeutically effective amount of glucagon like peptide (GLP-1) or related molecule having a GLP-1 like effect and then reducing that amount, often substantially, to prevent or treat the disease.
- GLP-1 glucagon like peptide
- Preferred practice of the invention achieves a much desired "drug holiday" during which time the mammal provides itself with a useful amount of endogenous insulin usually without further exposure to the drug.
- the invention has a variety of uses including helping to prevent, treat, delay onset of, or reduce symptoms associated with diabetes without continuous presence of the administered GLP-1 or a related molecule.
- the invention may also be used to prevent development of a failure to respond to oral diabetic compounds in some diabetic patients. It has been discovered that it is possible to prevent or treat diabetes and related disorders by administering GLP-1 and related molecules (drugs) in a new way. More specifically, it has been found that it is not necessary to expose mammals to these drugs continuously to achieve a desired therapeutic effect. That is, it has been found that it is possible to reduce administration of the drug, sometimes substantially, over a time period referred to herein as a "drug holiday". During the drug holiday, the mammal is surprisingly able to provide itself with a useful amount of endogenous insulin.
- the amount of endogenous insulin is generally sufficient to help prevent, treat, delay onset of, reduce symptoms of, or delay progression of diabetes and related disorders.
- Administration of GLP-1 or related molecules is not needed over this time period although after the drug holiday, drug administration can be resumed.
- the drug holiday can provide mammals and especially human patients with much sought after relief from invasive, sometimes painful, and often repetitive and expensive therapies. Potentially serious side-effects and related complications often associated with such therapies can be reduced, delayed, or in some instances eliminated by my invention. In particular, risk of developing hypoglycemia, allergy and resistance, and edema and related insulin side effects can be sometimes be reduced or avoided by providing for at least one drug holiday in accord with this invention.
- the GLP-1 or related molecule can be administered to the patient regularly and for a time sufficient to at least maintain and, in some instances, increase endogenous insulin levels.
- further administration of the GLP-1 or related molecule can be decreased, sometimes substantially, to provide for the drug holiday.
- the patient is able to provide him/herself with an amount of endogenous insulin that is therapeutically relevant. That is, the amount of endogenous insulin provided is able to help the patient exert more control over undesired blood glucose fluctuations.
- my invention the need to continue or even increase exposure to GLP-1 or related molecules can be avoided during the drug holiday by using my invention.
- administration of the drug is eliminated entirely during the drug holiday period.
- the GLP-1 or related molecule is administered again to the mammal in an amount that is the substantially the same or different from the amount administered previously. That second drug administration can be followed by another drug holiday if desired.
- each drug holiday is preferably followed by administration of an amount of at least one of GLP-1, a GLP-1 related molecule, or another drug such as those recognized anti-diabetic agents disclosed herein such as insulin and analogues thereof.
- the invention can be used to provide a mammal such as a human patient with a first drug holiday, after which time the GLP-1 or a related molecule having a GLP-1 like effect is administered to the patient in an amount that is preferably therapeutically effective.
- the method can be repeated once, twice, thrice or as often as needed to provide a therapeutic regimen that features one, two, three or more drug holidays.
- the invention methods can be repeated as needed eg., every day, every few days, every few weeks, every few months up to the lifetime of the mammal to prevent or treat a medical condition.
- Human patients who are known to have diabetes or who are suspected to be susceptible to same are expected to benefit particularly from the invention.
- the invention features a method for preventing or treating diabetes and/or a related disorder in a mammal, preferably a human patient.
- the method includes administering to the mammal a therapeutically effective amount of at least one of GLP-1 and a related molecule having GLP-1 like effect in which eg., the amount and timing of administration are such as to prevent or treat the diabetes or related disorder typically without the continuous presence of the molecule in the mammal.
- Additional invention methods include reducing administration of the GLP-1 or related molecule below about the therapeutically effective during the drug holiday. Additional features of the drug holiday are discussed below.
- the amount of GLP-1 or related molecule administered to the mammal is preferably, but not exclusively, one that is therapeutically effective. In one embodiment and without wishing to be bound to theory, the amount is sufficient to help the mammal maintain or even increase endogenous insulin levels (before or during the drug holiday). To begin the drug holiday, the amount of administered drag is reduced or eliminated entirely.
- the drug holiday period is not tied to any particular endogenous insulin level(s) or method of providing or producing that insulin in vivo so long as that during the drug holiday, the mammal is able to provide itself with some amount of useful insulin, preferably an amount that is therapeutically relevant and effective.
- the mammal can be subjected to additional therapy including further administration of at least one of GLP-1, a related molecule having GLP-1 like effect, and recognized anti-diabetic agents such as those mentioned herein.
- Figure 1 is graph showing plasma insulin levels following administration of vehicle (control) and lOOnmol/kg of Compound 1.
- Figure 2 is a graph showing blood glucose levels (nM) after overnight fasting (17 hours)
- Figure 3 is a graph showing results of an oral glucose tolerance test (OTT). Results are expressed as AUC 0- 0 m in (mM x min) per day.
- Figure 4 is showing amounts of glycosylated hemoglobin (HbA lc ) in groups exposed to vehicle or varying concentration of Compound 1.
- Figure 5 is a graph showing fasting blood glucose levels following treatment with vehicle or various Compound 1 administration strategies.
- Figure 6 is a graph illustrating results from an oral glucose tolerance test (OGTT) after vehicle treatment or various Compound 1 administration strategies. Results are expressed as dAUCo- 2 0 mm (mM x min).
- Figure 7 is a graph showing pancreatic insulin mRNA levels (pg/microgram total RNA) after treatment with vehicle or various Compound 1 administration strategies.
- Figure 8 is a graph showing amounts of HbA lc (% of total haemoglobin) in groups exposed to vehicle or various Compound 1 administration routes.
- the invention features a method for preventing or treating diabetes in a mammal.
- Particular mammals that would be expected to benefit from practice of the invention include those that have, have had, are suspected of having, or are genetically or otherwise disposed to develop diabetes or a related medical condition.
- Particular mammals of interest include primates such as chimpanzees; rodents such as mice and rats; domesticated animals eg., rabbits, dogs, pigs, cats, sheep, goats, horses, cows and the like. More specific mammals of interest include accepted animal models of diabetes and related disorders such as the mouse model described below.
- An especially preferred mammal for use with the invention is a human patient who has been diagnosed with diabetes or a related disease such as impaired glucose tolerance (IGT).
- IIGT impaired glucose tolerance
- the method includes administering to the mammal a therapeutically effective amount of at least one of GLP-1 and a related molecule having GLP-1 effect.
- the amount and timing of administration are such as to prevent or treat diabetes in the mammal without the continuous presence of the molecule.
- such a method further includes reducing administration of the GLP-1 or related molecule below about the therapeutically effective amount for a time conducive to producing a drug holiday.
- Preferred methods are generally sufficient to prevent or treat the diabetes or related disorder in the mammal.
- terapéuticaally relevant amount of endogenous insulin is meant an insulin amount provided by the mammal that is at least sufficient to at least slow progression of diabetes or a related disorder in that mammal by at least about 10%, preferably at least 25% or at least about 50%. Progression of such disorders can be determined by one or a combination of recognized clinical tests such as the ability to utilize glucose or the level of glycosylated hemoglobin in the bloodstream. Preferred tests are described in more detail below. Illustrative amounts of endogenous insulin that are known in the field to be therapeutically relevant are provided below. However, it is emphasized that the invention is not tied to any particular level, amount, or production of endogenous insulin. It is recognized that the ability of a subject mammal to provide itself with at least some endogenous insulin can be manifested in an improved ability to utilize glucose eg., as determined by the tests described herein.
- administering is reduced during the drug holiday by at least about 50% below the therapeutic amount, preferably at least about 90% below the therapeutic amount, and more preferably such administration is stopped during the drug holiday.
- GLP-1 related molecule a derivative, homologue, variant or analog of GLP-1 including pharmaceutically acceptable salts and free acids thereof.
- the GLP-1 related molecule is a GLP agonist. More specific GLP-1 and GLP-1 related molecules are provided below. GLP-1 analogs, derivatives, variants, precursors and homologues are all suitable for the practice of the invention as long as the active fragment that impacts endogenous insulin production is included.
- GLP-1 is meant GLP-l(7-37). By custom, the amino-terminus of GLP- 1 (7-37) has been assigned number 7 and the carboxy-terminus, number 37.
- GLP- 1(7-37) The amino acid sequence of GLP- 1(7-37) is well-known and has the following sequence: NH 2 -His 7 -Ala-Glu-Gly 10 -Thr-Phe-Thr-Ser-Asp 15 -Val-Ser-Ser-Tyr-Leu 20 -Glu- Gly-Gln-Ala-Ala 20 -Lys-Glu-Phe-Ile-Ala 30 -Trp-Leu-Val-Lys-Gly-Arg-Gly 37 -COOH (SEQ ID NO: )
- GLP-1 analog is defined as a molecule having a modification including one or more amino acid substitutions, deletions, inversions, or additions when compared with GLP- 1.
- GLP-1 analogs include, for example, GLP- 1(7-34) and GLP-l(7-35), GLP- 1(7-36), Val 8 - GLP-l(7-37), Gin 9 -GLP- 1(7-37), D-Gln 9 -GLP-l(7-37), Thr 16 -Lys 18 -GLP-l(7-37), and Lys 18 -GLP-l(7-37).
- GLP-1 analogs are GLP-l(7-34) and GLP- 1(7-35), which are disclosed in U.S. Pat. No. 5,118,666, and also GLP-l(7-36). These compounds are the biologically processed forms of GLP-1 having insulinotropic properties. Other GLP-1 analogs are disclosed in U.S. Pat. No. 5,545,618.
- GLP-1 derivative is meant a molecule having the amino acid sequence of GLP-1 or of a GLP-1 analog, but additionally having at least one chemical modification of one or more of its amino acid side groups, alpha-carbon atoms, terminal amino group, or terminal carboxylic acid group.
- a chemical modification includes adding chemical moieties, creating new bonds, and removing chemical moieties. Modifications at amino acid side groups include acylation of lysine epsilon-amino groups, N-alkylation of arginine, histidine, or lysine, alkylation of glutamic or aspartic carboxylic acid groups, and deamidation of glutamine or asparagine.
- Modifications of the terminal amino include the des- amino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications.
- Modifications of the terminal carboxy group include the amide, lower alkyl amide, dialkyl amide, and lower alkyl ester modifications.
- a lower alkyl is a Ci -C 4 alkyl.
- one or more side groups, or terminal groups may be protected by protective groups known to the ordinarily-skilled protein chemist.
- the ⁇ -carbon of an amino acid may be mono- or di-methylated.
- GLP- 1 analogs and derivatives include active GLP-1 peptides, 7-34, 7-35, 7-36 and 7-37 have amino acid substitutions as positions 7-10 and or are truncated at the C- terminus and/or contain various other amino acid substitutions in the basic peptide.
- Analogs having D-amino acid substitutions in the 7 and 8 positions and/or N-alkylated or N-acylated amino acids in the 7 position are particularly resistant to degradation in vivo.
- a preferred drag holiday is defined as the time interval between a first endpoint (start) and a second endpoint (finish).
- the first endpoint follows the reduction in administration of the GLP-1 or related molecule.
- the second endpoint can be readily identified by one or a combination of standard methods.
- such endpoints can be characterized by an inability of the subject to control fasting blood glucose (FBG) as demonstrated, for instance, by an increase in FBG of at least about 5% or 10% when compared to the time prior to the second endpoint.
- FBG fasting blood glucose
- the second endpoint can be further identified by an unwanted increase in glycosylated hemoglobin of at least about 5% or 10%, also when compared to the interval before the second endpoint.
- FBG and glycosylated hemoglobin are known and include what is referred to herein as a standard FBG or glycosylated hemoglobin test, respectively. During a preferred drug holiday period, FBG and glycosylated hemoglobin do not increase significantly.
- the length of time associated with a particular drag holiday will vary depending on recognized factors including the health of the subject, sex, disease to be treated, weight, medical history, etc.
- the drug holiday spans about one day up to about twenty five weeks eg., between from about three to four weeks.
- the standard FBG assay will show an increase in FBG of at least about 5% or 10%.
- the GLP-1 or related molecule administered in accord with this invention can be given by nearly any acceptable route including a depot formulation such as those described in
- drugs can be administered to the mammal bolus at least about once daily, at least once a week.
- Other administration routes are also envisioned including about twice daily (i.v. or subq) for between from about one to about twenty weeks.
- the invention further includes administering to the mammal a second therapeutically effective amount of GLP-1 or a related molecule following the (first) drag holiday.
- the method can also include reducing administration of the second therapeutically effective amount of GLP-1 or related molecule for a time conducive to producing a second drug holiday. Such administration and reducing steps are repeated at least once eg., at least about 2 to about 25 times or as needed to prevent or treat the diabetes or related disorder. For instance, the invention can be practiced over the lifetime of the mammal.
- the invention also features methods which include administering to the mammal a therapeutically effective amount of at least one of glucagon-like peptide 1 (GLP-1), or a GLP-1 related molecule to provide a therapeutically effective amount of endogenous insulin in the mammal.
- GLP-1 glucagon-like peptide 1
- An invention goal is to at least delay resumption of such therapy during the drug holiday period.
- the endogenous insulin production is at least about maintained in the mammal for between from about one day to about twenty five weeks.
- administration of the GLP-1, GLP-1 related molecule is sufficient to increase the insulin production in the mammal by at least about 10% compared to a control.
- the increase in endogenous insulin production is at least about 20%, more preferably at least about a 50% increase compared to the control.
- a preferred control is a diabetic, non-treated mammal.
- Reference herein to a control mammal typically means untreated with the GLP-1 or GLP-1 related molecule.
- Suitable controls are mammals that may be diabetic or non-diabetic as needed to suit a particular invention use. It will be appreciated that for some invention applications, use of a control will not be needed eg., as when endogenous insulin production levels are already known.
- the method further includes monitoring at least one of endogenous insulin production and blood glucose levels.
- monitoring can, for instance, include detecting insulin mRNA in the mammal.
- the mammal will be a non-human mammal to allow for collection and analysis of insulin producing tissue, usually a pancreatic biopsy. In human patients, less invasive monitoring of blood insulin production according to establish protocols will be helpful for some invention applications.
- Methods for at least detecting insulin mRNA from biological samples are known and include nucleic acid hybridization, PCR and related amplification techniques.
- the method further includes quantitating the insulin mRNA and comparing the amount produced by the mammal to a control. Acceptable plasma insulin tests are described below.
- Therapeutically relevant levels of insulin are known for a wide variety of mammals. For human patients, it has been reported that endogenous insulin circulates in the blood as a monomer at a concentration of between from about 2 to about 4 ng/ml in the portal blood and in the peripheral circulation at about 0.5ng/ml or about 0. lnm. After ingestion of a meal, there is believed to be a rise in the concentration of endogenous insulin in the portal blood, followed by a smaller rise in the periphery. See S. N. Davis and D. Granner, supra.
- the invention is not tied to attaining the aforementioned levels of insulin which have been reported to be therapuetically important. Rather, there is general recognition in the field that any amount of insulin provided endogenously is relevant in most therapuetic settings. That is, it is generally preferred that a subject mammal have capacity to provide some amount of endogenous insulin regardless of whether it achieves normal or near normal levels. Even presence of some endogenous insulin as provided by this invention will help at least slow disease progression and in some instances make it more clinically manageable.
- a "therapeutically effective" amount of GLP-1 or related molecule administered in accord with this invention means restoring at least about 0.01% of the normal monomeric concentration of insulin (eg. human insulin) in the portal blood and peripheral circulation, preferably at least about 0.5% of same, more preferably at least about 5%, and even more preferably at least about 10% of those levels. Additionally preferred dosages of the GLP-1 and related molecules will further approach endogenous levels of insulin production in subject mammals eg., by at least about 50% up to 100% to 200% of same. More particular examples of such amounts can be found in one or more of the following patents: 6,358,924;
- the GLP-1 or related molecule can be administered to the mammal at a dose of at least about 0.01 nmol/kg (body weight).
- an example of a drag holiday in one invention embodiment, will achieve at least about 50% of the levels of insulin in the portal blood and peripheral circulation as in normal (non-diabetic) subjects, preferably at least about 80%, more preferably about 100% of same.
- the baseline level of insulin production in most subject mammals can be ascertained by workers in the field. Typically normal insulin levels for most healthy human subjects are known and are understood to vary by age, sex, diet and health of particular individuals. For subjects who have or are suspected of having diabetes, that baseline can change but is ascertainable using standard methods. • In one embodiment of the method, the amount of insulin produced by the mammal is at least about 10% higher than a control as determined by a standard plasma insulin test, preferably at least about 20% higher, more preferably at least about 50% higher. A preferred control is a non-treated diabetic mammal. Conventional methods for detecting plasma insulin are disclosed below. See also S. N. Davis and D. Granner, supra.
- the administration of the GLP-1 or GLP-1 related molecule is at least about once daily for at least about a 24 hours. Preferably, the administration is about twice daily for between from about one to about twenty weeks.
- Particular amounts of the GLP-1, or GLP-1 related peptide to administer to the mammal will vary with intended use but will generally be at least about 0.01 nmol/kg (body weight), preferably at least about 0.1 nmol/kg (body weight), more preferably 1, 2, 5 or 10 nmol/kg (body weight). More particular amounts of GLP-1 or GLP-1 related molecule to use will be guided by recognized parameters including the general health of the subject, type of diabetes, sex, medical history, ect.
- a particular GLP-1 analog includes a peptide X selected from the group consisting of:
- variant of said exendin wherein said variant comprises a modification selected from the group consisting of between one and five deletions at positions 34-39 and contains a Lys at position 40 having a lipophilic substituent;
- R 1 and R 2 are selected from the group consisting of hydrogen, C ⁇ , 6 -alkyl, phenyl, and phenyl-methyl, wherein C 1-6 -alkyl is optionally substituted with from one to three substituents selected f om halogen, hydroxy, amino, cyano, nitro, sulfono, and carboxy, and phenyl and phenyl- methyl is optionally substituted with from one to three substituents selected from C ⁇ .
- GLP-1 and GLP-1 related molecules including analogs thereof such as those disclosed in the the PCT/DKOO/00393 application.
- Such molecules include the following specific compounds: des Ser 39 -exendin-4(l-39)-Lys 6 -NH 2 (SEQ ID NO des Pro 36 -exendin-4(l-39)-Lys 6 -NH 2 (SEQ ID NO J, des Ala 35 -exendin-4(l-39)-Lys 6 -NH 2 (SEQ ID NO des Gly 34 -exendin-4(l-39)-Lys 6 -NH 2 (SEQ ID NO des Ser 39 -(Lys 40 (palmitoyl))exendin-4(l-39)-Lys 7 -NH 2 (SEQ ID NO: ), des Gly 34 -(Lys 40 (palmitoyl))exendin-4(l-39)-Lys 7 -NH 2 (SEQ ID NO: ), des Ala 35 -
- Lys 40 (palmitoyl)exendin-4(l-39)-Lys 7 -NH 2 (SEQ ID NO: ), des Pro , Pro -exendin-4(l-39)-Lys 6 -NH 2 , Lys 6 -des Pro , Pro , Pro -exendin-4(l-39)-NH 2 ⁇ Asn(Glu) 5 -des Pro 36 , Pro 37 , Pro 38 -exendin-4(l-39)-NH 2 , Lys 6 -des Pro 36 , Pro 37 , Pro 38 -exendin-4(l-39)-Lys 6 -NH 2 , Asn(Glu) 5 -des Pro 36 , Pro 37 , Pro 38 -exendin-4(l-39)-Lys 6 -NH 2 , des Pro , Pro , Pro -exendin-4(l-39)-Lys 6 -NH 2 ,
- Gly -GLP-1 (7-37)-Lys 6 -NH 2 and the free acid or pharmaceutically acceptable salt thereof.
- Another preferred group of active compounds for use in the present invention is disclosed in WO 91/11457 and includes GLP-l(7-34), GLP- 1(7-35), GLP-l(7-36), or GLP- 1(7-37), or the amide form thereof, and pharmaceutically-acceptable salts thereof, having at least one modification including those shown below:
- the present invention provides important methods for preventing or treating diabetes.
- Preferred practice involves at least maintaining endogenous insulin production in the mammal sufficient to support a drug holiday or maintaining the level of glycosylated hemoglobin sufficient to support a drug holiday.
- administration of an anti-diabetic formulation can be significantly reduced and sometimes avoided completely.
- the method will further include administering at least one anti-diabetic drug to the mammal.
- the administration will be about below the recognized therapeutically effective amount for at least one of the drugs in the mammal. That is, the amount of at least one and preferably all of the anti- diabetic drugs given to the mammal will be below about what is accepted as the useful dose.
- the administration of the anti-diabetic drug can be before, during or after about the time the endogenous insulin level is at least maintained in the mammal.
- the method further includes discontinuing (either completely or partially) administration of at least one of the anti-diabetic drugs to the mammal. Cessation of the administration can be before, during or after about the time endogenous insulin production is at least maintained in the mammal.
- the method is sufficient to prevent, treat, delay onset of, or at least alleviate symptoms associated with the diabetes in the mammal for a time after administration of the GLP-1, GLP-1 related molecule or anti- diabetic drug is discontinued.
- practice of the invention can suitably prevent, treat, delay onset of or at least alleviate diabetic symptoms in subject mammals.
- such benefits can be achieved in the mammal from about one day to about twenty five weeks.
- the length of the drug holiday period will depend on recognized parameters including the mammal of interest, the amount of GLP-1 and/or related molecule administered, and the type of diabetes, if any, to be addressed.
- administration of the GLP-1 or related molecule can be repeated as needed, eg., one or more times usually after (but sometimes before or during) the drug holiday period.
- the administration of the GLP-1 or related molecule is repeated one or more times after the time the endogenous insulin production at least maintained in the mammal.
- At least one of the anti-diabetic drugs is insulin, an insulin analog; or a pharmaceutically acceptable mixture thereof.
- Preferred human insulin is commercially available as HUMULiNTM and NOVULINTM, for example. Additional insulins include bovine insulin,porcine insulin; or a mixture of insulins. Sometimes use of an insulin analog will be indicated. In such embodiments, the insulin analog of choice is Lys (B28), Pro (B29) human insulin.
- the invention is further compatible with use of a wide spectrum of standard anti- diabetic drags such as those disclosed by S. N. Davis and D. Granner, supra.
- the anti-diabetic drug is a sulfonylurea, biguanide, thiazolidinedione, diazoxide, somatostatin, or an alpha-glucosidase inhibitor such as acarbose.
- Prefered sulfonylureas according to the invention can be selected from the group consisting of tolbutamide, chlorpropamide, tolazamide, acetohexamide, glyburide, glipizide, and gliclazide.
- a particular biguanide of interest is metformin and phenformin.
- Suitable thiazolidinediones include ciglitazone and pioglitazone.
- the present invention can be used to prevent or treat diabetes in a wide range of subject mammals. Use in a human patient that has, has had, is suspected of having, or who is predisposed to get diabetes will often be preferred. Typical diabetes will be diabetes mellitus or a related disorder.
- a preferred type of diabetes mellitus is selected from the group consisting of insulin-dependent diabetes millitus (IDDM or type I diabetes) and non-insulin-dependent diabetes mellitus (NIDDM, or type II diabetes). Examples of disorders related to diabetes mellitus have been described in S. N. Davis and D.
- Granner supra and include, but are not limited to, impaired glucose tolerance (IGT); maturity-onset diabetes of youth (MODY); leprechaunism (insulin receptor mutation), tropical diabetes, diabetes secondary to a pancreatic disease or surgery; diabetes associated with a genetic syndome (eg., Prader-Willi syndrome); pancreatitis; and diabetes secondary to endocrinopathies; adipositas; and metabolic syndrome (syndroma X).
- ITT impaired glucose tolerance
- MODY maturity-onset diabetes of youth
- leprechaunism insulin receptor mutation
- tropical diabetes diabetes secondary to a pancreatic disease or surgery
- diabetes associated with a genetic syndome eg., Prader-Willi syndrome
- pancreatitis eg., and pancreatitis
- diabetes secondary to endocrinopathies adipositas
- metabolic syndrome syndroma X
- the present invention is related to specific observations discussed below and in the Examples. More specifically, two long-term studies were conducted in which db/db mice were dosed daily with a particular GLP-1 receptor agonist, COMPOUND 1. The first study was initiated to explore the dose-dependent anti-diabetic effect of COMPOUND 1 after intraperitoneal (i.p.) administration twice daily for 42 days. The second study was a conventional single-dose crossover study in which the animals were divided into two groups either dosed with COMPOUND 1 or vehicle. After 50 days, half of the vehicle-treated animals were switched to COMPOUND 1 treatment and half of the COMPOUND 1 -treated animals were switched to vehicle treatment.
- the progression of the type II diabetes was assessed by measuring the water- and food consumption, body weight, fasting blood glucose and glucose tolerance.
- the amount of HbA t c was measured at the end of the study.
- the insulin mRNA expression was measured by RT-PCR as a marker for ⁇ -cells function.
- treatment of the animals with a new GLP-1 agonist improves insulin mRNA compared to a control (no active treatment). This improvement is seen for a long time period during the compound life time.
- treatment with the agonist is stopped, the relatively high insulin mRNA level remains higher for a long period of time.
- This sustained boost in insulin message provided by the invention provides for the drug holiday.
- GLP-1 agonists will improve insulin mRNA. This improvement has several benefits and will last for a long time ie., days, weeks or even months in some settings. This will allow human subjects to increase dosing intervals beyond the half-life of the compound.
- the duration of dose intervals compared to plasma half life can be evaluated eg., by measuring plasma insulin and plasma glucose response after a standard glucose intake before and after stopping dosing with the GLP-1 agonist. If desired, glycosylated haemoglobin can also be monitored.
- the GLP-1 and GLP-1 related molecules including derivatives and agonists thereof can be administered to a mammal in need of such treatment by one or several acceptable routes. For instance, in type II diabetic patients Compound 1 can be administered subcutaneously. A wide range of formulation strategies are acceptable including use of recognized depot formulations or as water soluble formulations adapted for unitary dosing.
- subject mammals such as human patients can be divided into four groups.
- the study design is preferably a double blind randomized parallel study with a duration of about eight months.
- the three groups are dosed for one, three or six months after which dosing will be discontinued.
- the fourth group is treated with a placebo instead of the molecule to be tested.
- Fasting blood glucose, blood glucose response after a controlled oral glucose intake will be followed in parallel in all groups (particularly since it is a double blind design), in the days and weeks after stopping administration of the GLP-1 or related molecule.
- glycosylated haemoglobin can be followed as well.
- Parameters can be compared to the same parameters measured the last day before dosing with the molecule was stopped, with the other active treated groups, and with the parameters obtained in the placebo treated group.
- Preferred compounds such as Compound 1 have an effect on fasting blood glucose and blood glucose response after oral intake will last at least for days, preferably weeks after disappearance of the compound from the blood.
- Plasma levels of the molecule to be tested can be measured using a conventional immunological approach such as RIA, Western blotting and/or ELISA.
- Blood glucose and HbAl c can be measured by conventional standard bioanalytical methods.
- GLP-1 and related molecules such as GLP-1 agonists (eg., Compound 1) shall be dosed only once every ten times or more of the biological half life, depending on recognized parameters such as the formulation type administered. Progression of type II diabetes and related disorders can be monitored by one or a combination of suitable methods.
- type II patients are treated with at least one GLP-1 or a related molecule such a GLP-1 agonist and particularly Compound 1.
- Such treatment typically involves an individualized maximum tolerable dose of the compound either alone or in combination with at least one recognized anti-diabetic formulation.
- examples of such formulations are disclosed herein and include oral antidiabetics such as glitazones, methformine, glucophages. It is typically useful to compare with a treatment matched patient group treated with placebo instead of the compound test.
- Diagnostic tests for detecting and evaluating diabetes are known. Such tests include evaluation of peripheral neuropathy, typically by sense of vibration, retinopathy evaluated by ophtalmoscopic examination, myocardial ischaemia evaluated eg., by ECG, renal failure evaluated by proteinuria and measurements of glomerular filtration rate can be followed in an observation period of at least a few days, preferably a few weeks up to 1 to 3 years or more. The study is stopped when the compound of interest (eg., Compound 1) demonstrates a significantly slower development of secondary diabetic complications compared to non- treated patients.
- the compound of interest eg., Compound 1
- any suitable statistical analysis treatment can be used.
- such an analysis can be made by analyzing absence of progression of the various symptoms ("survival analysis").
- at least one of peripheral neuropathy, retinopathy, myocardial ischaemia, renal loss of protein and renal insufficiency progress is significantly slower in patients receiving at least one of the GLP-1 or GLP-1 related molecule such as a GLP-1 agonist (eg., Compound 1).
- GLP-1 agonist eg., Compound 1
- treatment with the Compound 1 either alone or in combination with GLP-1 or a related molecule as described previously, will substantially reduce time of progression of type II diabetic complications.
- the invention thus provides a highly useful method for providing blood glucose controlling therapy to a patient.
- the method includes at least one and preferably all of the following steps: (a) administering to a patient in need of treatment at least one dose of at least one GLP-1 agonist in an amount sufficient to produce a therapuetically relevant plasma concentration of endogenously made insulin, (b) reducing or eliminating administration of the GLP-1 agonist from between about one day to about twenty five weeks, and (c) optionally repeating steps a) and b) sufficient to provide the insulin to the patient (drug holiday).
- Such a method can be combined, if desired, with nearly any of the standard anti-diabetic strategies as disclosed herein.
- COMPOUND 1 effectively decreased fasting blood glucose (FBG). Blood glucose after an oral glucose load was significantly lower in COMPOUND 1 treated animals compared to controls. Glycosylated hemoglobin (HbA lc ) decreased dose-dependently (8.4+0.38% to 6.2+0.27%). In the V+V group, FBG, blood glucose after an oral glucose load, and HbA lc levels were significantly higher than in mice treated with COMPOUND 1 throughout. Interestingly, these effects were preserved throughout the study in db/db mice treated with COMPOUND 1 only during the first 50 days of the study. The beneficial effects of early therapy with ZP10 were associated with an increased pancreatic insulin mRNA expression relative control animals.
- an oral glucose load (1 g/kg).
- the area under the blood glucose concentration curve obtained over a 240-minute period (AUCo -24 o; unit: mM-min) was used to stratify animals into five groups exhibiting similar glucose tolerances. Based on the dose-response relationship an ED 50 dose was estimated.
- Animals included in this study were between 6 and 10 weeks old at the beginning of the study. Four days prior to the first dosing, the animals were weighed and subjected to an overnight fast (17 hrs). The fasted animals were then subjected to an oral glucose tolerance test (OGTT). The area under the blood glucose concentration curve obtained over a 240- minute period (AUC 0-2 0 ; unit: mM-min) was used to stratify animals into four groups exhibiting similar glucose tolerances. The animals were subjected to two daily i.p. doses of COMPOUND 1 at 8 am and 4 pm, respectively, for 42 days. Doses were 0 (vehicle), 1, 10 or 100 nmol/kg. The injection volume was 5 ml/kg in all groups.
- Parameters recorded in the 42 days study were During the 42 days dosing period, body weight, food and water consumption were recorded daily. The animals over-night fasting blood glucose levels were measured on days -3, 1, 14, 41 and 43 and OGTT was performed on days -3, 1, 14 and 41 of the treatment period. On day 43 the animals were sacrificed and blood samples collected for measuring HbA ⁇ c .
- OGTT Oral Glucose Tolerance Test
- Figure 3 is discussed in more detail as follows.
- the figure shows oral Glucose Tolerance Test (OGTT) before treatment (day -3) and on day 1, 14 and 41 of long-term treatment with COMPOUND 1.
- ⁇ p ⁇ 0.05 vs. AUC 0-240 m i n in all three ZPlO-treated groups.
- HbA lc As an indicator of long-term blood glucose control, HbA lc was measured at the end of the study (figure 4). The level of HbA lc is expressed as a percentage of the total hemoglobin concentration. These data clearly show that long-term treatment with COMPOUND 1 significantly decreases the concentration of HbA lc in a dose-dependent fashion.
- Figure 4 shows HbA lc expressed as percent of total Hgb (hemoglobin) (42 days study). Data are mean ⁇ SEM. *: pO.Ol vs. vehicle.
- the animals were weighed and subjected to an overnight fast. The fasted animals were subjected to an OGTT (see below). The area under the blood glucose concentration curve obtained over a 240-minute period (AUC 0-240 ; unit: mM-min) was used to stratify animals into two groups exhibiting similar glucose tolerances. The animals were given one daily i.p. dose of COMPOUND 1, 100 nmol/kg or vehicle for a period of 50 days. The dosing was performed between 3 and 4 p.m. in order to ensure pharmacological efficacy during the period with maximal food intake, i.e. during night.
- Parameters recorded in the 90 days study During the 90 days dosing period body weight and water consumption were recorded daily. The animals fasting blood glucose levels were measured on days 44, 58, 65, 72, 86 and 91 and an OGTT was performed on days 0, 50, 67, 78 and 90 of the treatment period. On day 91 the animals were sacrificed, blood samples collected for measuring glycosylated hemoglobin, and pancreas removed for Insulin mRNA measurements.
- Group 1 continued receiving vehicle, group 2 initially received vehicle, but was changed to treatment with ZP10, group 3 initially received COMPOUND 1 and was changed to treatment with vehicle and finally group 4 continued receiving COMPOUND 1.
- the body weight of the animals was monitored during the study. Interestingly, during the 50 days no significant difference between the two initial groups could be detected (data not shown). However, after 90 days the body weight of group 3 and 4 was significantly higher than group 1 and 2 (table 2). This indicates that the general condition of the mice treated initially with COMPOUND 1 was better than the vehicle-treated group.
- the water consumption was also measured throughout the study and like in the 42 days study the water consumption was highest in the vehicle-treated groups. Interestingly, even after 40 days cessation of therapy with COMPOUND 1, the group treated with COMPOUND 1 during the first 50 days, still had lower water consumption than animals never treated with COMPOUND 1.
- the fasting blood glucose was also measured during the study (figure 5). In the initial period from day 0-50, the fasting blood glucose level was significantly higher in the vehicle- treated animals than in the COMPOUND 1 -treated animals. During the second treatment period, group 1 still displayed high fasting blood glucose. In contrast, group 2, 3 and 4, all had significantly lower fasting blood glucose levels throughout the 90 days study period. Group 2 exhibited an intermediate level of fasting blood glucose, but still significantly lower than group 1. These results indicate that these animals still have the ability to control their blood glucose levels after withdrawal of COMPOUND 1 for 40 days. Group 4 did not show any signs of hyperglycemia.
- Figure 5 is explained in more detail as follows. It shows fasting blood glucose (FG) levels after eight hours of fasting. During Day 0-50, FG was significantly lower in animals treated with COMPOUND 1 compared with vehicle. Moreover, during the second treatment period (Days 51-90), FG was significantly higher in mice treated with vehicle throughout relative to the other three groups. However, mice that were changed from COMPOUND 1 to vehicle had a significant higher FG level than mice treated with COMPOUND 1 throughout.
- Oral glucose tolerance was measured five times during the study (figure 6). After the first 50 days the vehicle-treated group showed an impaired response to glucose whereas the glucose response of the COMPOUND 1 -treated group did not deviate from the starting level. In fact, the glucose tolerances were similar in groups 2, 3 and 4 during the last 40 days. In group 3, glucose tolerance was significantly improved during the last period of the study in which the animals received treatment with COMPOUND 1 and at the end of the study, it was not different from glucose tolerances in groups 2 and 4.
- FIG. 6 shows oral Glucose Tolerance Test (OGTT) performed on Day 0, 50, 67, 78 and 90.
- OGTT oral Glucose Tolerance Test
- Vehicle-treated db/db mice displayed progressively impaired glucose tolerance during the study.
- glucose tolerances were similar in the three groups of animals that were treated with COMPOUND 1 either during Day 1-50 (Group 2), Day 51-90 (Group 3), or throughout the entire study period (Group 4).
- group 3 may reflect an improved ⁇ -cell function.
- group 4 had increased expression of insulin mRNA compared to group 1, Intriguingly, the expression of insulin mRNA was similar in groups 3 and 4, indicating that early treatment with COMPOUND 1 prevents the deterioration of pancreatic insulin mRNA production.
- pancreatic insulin mRNA was also measured in a group of young untreated animals (6-10 weeks old; group 0 in figure 7).
- HbA lc levels were measured at the end of the study (figure 8).
- the three groups that received COMPOUND 1 treatment had lower levels of HbA lc than animals receiving vehicle treatment throughout, but the differences did not reach statistical significance.
- Example 4 Effect of COMPOUND 1 On Insulin Release In db/db Mice.
- COMPOUND 1 insulin levels were determined after an oral glucose load (1 g/kg). Thirty nine overnight fasted animals entered the experiment one week after being stratified into two group after an OGTT as described above. Fifteen minutes before the animals were given an oral glucose load, each animal received vehicle or 100 nmol/kg COMPOUND 1 i.p. Thirty minutes after the glucose administration, the animals were bled by left ventricular puncture during carbon dioxide anaesthesia. The blood was collected using a syringe mounted with a needle pre-flushed with heparine (5000 i.u./ml).
- the blood samples were quickly transferred into a pre-chilled test tube that contained 5 ⁇ l 0.5 M EDTA and 5 ⁇ l Trasylol ® (aprotinin, 20 x 10 "6 IU/ml) and centrifuged at 3000 rpm for 10 minutes at 2-4 °C. Plasma was kept cold during harvest, frozen on dry ice and stored at -80°C for later analysis of hormones. The whole blood glucose (mM) concentration was analysed as described above. Plasma concentrations of insulin were measured in samples of 10 ⁇ l plasma using a commercial enzyme immunoassay from Peninsula Laboratories Europe, LTD (ELIS7537).
- mice Male db/db mice C57BLKS/J-Leprdb/Leprdb weighing 37.3 ⁇ 1.1 g (M&B, LI. Skensved, Denmark) at time of inclusion were used. The mice were housed (3 mice/cage) under controlled conditions (20°C, 55-85% humidity) following a 12:12-h light/dark cycle with light on at 6 am. The animals were fed ad libitum with a standard Altromin No. 1324 diet (Chr. Petersen, Ringsted, Denmark) and had free access to domestic quality tap water. At the time of inclusion, all mice had overnight fasting (17 hrs) blood glucose (BG) levels below 10 mmol/1. No animals included in the study displayed blood glucose levels above 33 mM when subjected to a standard oral glucose load (see below).
- BG blood glucose
- mice pancreas Isolation of total RNA from mice pancreas.
- the frozen pancreatic glands were weighed and minced in a mortar under liquid nitrogen.
- the extraction of total RNA was conducted as described by the manufacturer of the kit(Qiagen Rneasy kit, VWR International).
- Insulin standard for quantitative PCR One ⁇ l first strand synthesis was used for PCR with the following insulin primers: 5'-AACCCACCCAGGCTTTTGTCA; 5'- CTTCCTCCCACGTCCAGTTGTTC-3
- the amplicon were inserted into the PCR 4-TOPO vector (invitrogen) and transformed into E.coli.
- the plasmids were purified and 2 ⁇ g of each were linearized with either Spe I or Not I.
- the linearized plasmids were in-vitro transcribed using T7 or T3 RNA polymerase. After in-vitro transcription, the template was removed by DNAse treatment. Subsequently, the mixture was phenol/chloroform-extracted and precipitated. After precipitation the RNA was dissolved to 1 mg/ml in water.
- Quantitative PCR One ⁇ g of both standard and sample were subjected to first strand synthesis as described above. A dilution series of the insulin mRNA standard, together with the samples were subjected to quantitative PCR using the following probe (Mouse insulin Taqman probe, 110-138) and the above described primers: 5 '-FAM-AGGCTCTCTACCTGGTGTGTGGGGAGCGT- Tamra-3 '
- COMPOUND 1 H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2, Batch: ZP 15.65-3 A was produced at Zealand Pharma A/S using the Merifield technique.
- COMPOUND 1 was a highly efficacious GLP-1 agonist with potent anti-diabetic efficacy. It binds to the human GLP-1 receptor with an affinity 4 times higher than GLP-1 itself, it potentiates the secretion of insulin in response to an oral glucose load, and normalizes glucose intolerance in diabetic db/db mice at doses in the low nmol/kg range. Furthermore, after prolonged treatment, COMPOUND 1 increases the insulin mRNA level, and normalizes HbA lc levels. The Examples show that prolonged treatment with COMPOUND 1 reduces progression of type II diabetes in db/db mice.
- pancreatic insulin mRNA suggests that the improved glucose tolerance in COMPOUND 1 treated db/db mice was related to an improved ability to release of insulin in response to oral glucose load. This observation is supported by the Examples above, particulary the finding that plasma insulin levels increased twice as much in response to an oral glucose load in COMPOUND 1 treated mice than in untreated control animals.
- mice treated with COMPOUND 1 during the first 50 days of the study period produced a sustained improvement in glucose tolerance, decreased fasting glucose levels, lower water intake, and an elevated expression of insulin mRNA compared to vehicle-treated animals.
- COMPOUND 1 once daily effectively prevents the progression of diabetes in db/db mice.
- the sustained effect on glucose metabolism and pancreatic expression of insulin mRNA is consistent with Compound 1 preserving ⁇ -cell function in diabetic db/db mice.
- COMPOUND 1 The Examples also show that the protective action of COMPOUND 1 is most effective when therapy is initiated early during the diabetic development.
- COMPOUND 1 When therapy with COMPOUND 1 was initiated in animals with late untreated diabetes, COMPOUND 1 improved glucose tolerance in absence of changes in the expression of insulin mRNA. The presence of detectable insulin mRNA in vehicle-treated mice suggests that even these severely ill animals were able to produce insulin.
- Compound 1 is an effective anti-diabetic compound that prevents the progression of diabetes in db/db mice.
- the sustained effect on glucose metabolism, and pancreatic expression of insulin after discontinuation of COMPOUND 1 treatment indicates that COMPOUND 1 preserves ⁇ -cell function in diabetic db/db mice.
- COMPOUND 1 is an effective anti-diabetic compound that prevents the progression of diabetes in db/db mice.
- the sustained effect on glucose metabolism, and pancreatic expression of insulin mRNA after discontinuation of COMPOUND 1 freatment indicates that COMPOUND 1 preserves ⁇ -cell function in diabetic db/db mice.
- Compound 1 is a new and rationally designed GLP-1 agonist.
- COMPOUND 1 is a peptide with a high affinity for the GLP-1 receptor that increases insulin release and improves glucose tolerance.
- FBG fasting blood glucose
- COMPOUND 1 preserves ⁇ -cell function in diabetic db/db mice.
- Glucagon-like peptide 1 improves the ability of the beta-cell to sense and respond to glucose in subjects with impaired glucose tolerance. Diabetes 47:1259-1265
- Truncated glucagon-like peptide-1 interacts with exendin receptors on dispersed acini from guinea pig pancreas. Identification of a mammalian analogue of the reptilian peptide exendin-4. J Biol Chem 267:21432-7
- Exendin-4 stimulates both beta-cell replication and neogenesis, resulting in increased beta-cell mass and improved glucose tolerance in diabetic rats. Diabetes 48:2270-2276
- Glucagon-like peptide 1 induces differentiation of islet duodenal homeobox-1 -positive pancreatic ductal cells into insulin-secreting cells. Diabetes 50:785-796
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Diabetes (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Vascular Medicine (AREA)
- Emergency Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines Containing Plant Substances (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HK05106202.6A HK1075456B (en) | 2002-07-04 | 2003-07-02 | Glp-1 and methods for treating diabetes |
| AU2003243929A AU2003243929B2 (en) | 2002-07-04 | 2003-07-02 | GLP-1 and methods for treating diabetes |
| DE60327771T DE60327771D1 (de) | 2002-07-04 | 2003-07-02 | Glp-1 und behandlungsmethode für diabetes |
| EP03762471A EP1525219B1 (en) | 2002-07-04 | 2003-07-02 | Glp-1 and methods for treating diabetes |
| AT03762471T ATE432289T1 (de) | 2002-07-04 | 2003-07-02 | Glp-1 und behandlungsmethode für diabetes |
| DK03762471T DK1525219T3 (da) | 2002-07-04 | 2003-07-02 | GLP-1 og fremgangsm der til behandling af diabetes |
| MXPA04012497A MXPA04012497A (es) | 2002-07-04 | 2003-07-02 | Glp-1 y metodos para tratar la diabetes. |
| CA002490564A CA2490564A1 (en) | 2002-07-04 | 2003-07-02 | Glp-1 and methods for treating diabetes |
| US10/517,563 US20060057137A1 (en) | 2002-07-04 | 2003-07-02 | Glp-1 and methods for treating diabetes |
| JP2004518465A JP5685355B2 (ja) | 2002-07-04 | 2003-07-02 | Glp−1および糖尿病の処置方法 |
| IL165531A IL165531A (en) | 2002-07-04 | 2004-12-02 | Glp-1, compositions comprising it and uses thereof |
| US12/277,148 US20090088369A1 (en) | 2002-07-04 | 2008-11-24 | Glp-1 and methods for treating diabetes |
| AU2009202390A AU2009202390B8 (en) | 2002-07-04 | 2009-06-15 | GLP-1 and methods for treating diabetes |
| IL208184A IL208184A (en) | 2002-07-04 | 2010-09-16 | Use of glp-1 agonist to produce a drug for the prevention or treatment of diabetes |
| AU2010257216A AU2010257216B2 (en) | 2002-07-04 | 2010-12-15 | GLP-1 and methods for treating diabetes |
| US14/177,132 US20140187483A1 (en) | 2002-07-04 | 2014-02-10 | Glp-1 and methods for treating diabetes |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US39391702P | 2002-07-04 | 2002-07-04 | |
| US60/393,917 | 2002-07-04 | ||
| US46561303P | 2003-04-24 | 2003-04-24 | |
| US60/465,613 | 2003-04-24 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/517,563 A-371-Of-International US20060057137A1 (en) | 2002-07-04 | 2003-07-02 | Glp-1 and methods for treating diabetes |
| US12/277,148 Continuation US20090088369A1 (en) | 2002-07-04 | 2008-11-24 | Glp-1 and methods for treating diabetes |
| US14/177,132 Continuation US20140187483A1 (en) | 2002-07-04 | 2014-02-10 | Glp-1 and methods for treating diabetes |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2004005342A1 true WO2004005342A1 (en) | 2004-01-15 |
Family
ID=30118392
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/DK2003/000463 Ceased WO2004005342A1 (en) | 2002-07-04 | 2003-07-02 | Glp-1 and methods for treating diabetes |
Country Status (12)
| Country | Link |
|---|---|
| US (3) | US20060057137A1 (https=) |
| EP (2) | EP1525219B1 (https=) |
| JP (2) | JP5685355B2 (https=) |
| AT (1) | ATE432289T1 (https=) |
| AU (3) | AU2003243929B2 (https=) |
| CA (1) | CA2490564A1 (https=) |
| DE (1) | DE60327771D1 (https=) |
| DK (1) | DK1525219T3 (https=) |
| ES (1) | ES2327328T3 (https=) |
| IL (2) | IL165531A (https=) |
| MX (1) | MXPA04012497A (https=) |
| WO (1) | WO2004005342A1 (https=) |
Cited By (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004050115A3 (en) * | 2002-12-03 | 2004-07-22 | Novo Nordisk As | Combination treatment using exendin-4 and thiazolidinediones |
| EP1688148A1 (en) * | 2002-12-03 | 2006-08-09 | Novo Nordisk A/S | Combination treatment using exendin-4 and thiazolidinediones |
| WO2006037810A3 (en) * | 2004-10-07 | 2006-09-08 | Novo Nordisk As | Protracted glp-1 compounds |
| WO2007051987A1 (en) * | 2005-11-01 | 2007-05-10 | Activotec Spp Limited | Insulinotropic compounds and uses thereof |
| DE102008003568A1 (de) | 2008-01-09 | 2009-07-16 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| DE102008003566A1 (de) | 2008-01-09 | 2009-07-16 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| DE102008025007A1 (de) | 2008-05-24 | 2009-11-26 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| DE102008025008A1 (de) | 2008-05-24 | 2009-11-26 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| DE102008051834A1 (de) | 2008-10-17 | 2010-04-22 | Sanofi-Aventis Deutschland Gmbh | Kombination von einem Insulin und einem GLP-1-Agonisten |
| DE102008053048A1 (de) | 2008-10-24 | 2010-04-29 | Sanofi-Aventis Deutschland Gmbh | Kombination von einem Insulin und einem GLP-1-Agonisten |
| DE102009038210A1 (de) | 2009-08-20 | 2011-03-03 | Sanofi-Aventis Deutschland Gmbh | Kombination von einem Insulin und einem GLP-1-Agonisten |
| WO2011058082A1 (de) | 2009-11-13 | 2011-05-19 | Sanofi-Aventis Deutschland Gmbh | Pharmazeutische zusammensetzung umfassend einen glp-1-agonisten und methionin |
| WO2011058083A1 (de) | 2009-11-13 | 2011-05-19 | Sanofi-Aventis Deutschland Gmbh | Pharmazeutische zusammensetzung umfassend einen glp-1-agonisten, ein insulin und methionin |
| DE102010011919A1 (de) | 2010-03-18 | 2011-09-22 | Sanofi-Aventis Deutschland Gmbh | Pharmazeutische Zusammensetzung umfassend einen GLP-1-Agonisten und Methionin |
| US8030273B2 (en) | 2004-10-07 | 2011-10-04 | Novo Nordisk A/S | Protracted exendin-4 compounds |
| US8048854B2 (en) | 2006-07-11 | 2011-11-01 | Sanofi-Aventis Deutschland Gmbh | Amidated insulin glargine |
| CN102256618A (zh) * | 2008-10-17 | 2011-11-23 | 赛诺菲-安万特德国有限公司 | 胰岛素和glp-1激动剂的组合 |
| US8410048B2 (en) | 2006-07-11 | 2013-04-02 | Sanofi-Aventis Deutschland Gmbh | Method for producing insulin analogs having a dibasic B chain terminus |
| WO2013050379A1 (en) | 2011-10-04 | 2013-04-11 | Sanofi-Aventis Deutschland Gmbh | Glp-1 agonist for use in the treatment of stenosis or/and obstruction in the pancreatic duct system |
| WO2013050378A1 (en) | 2011-10-04 | 2013-04-11 | Sanofi-Aventis Deutschland Gmbh | Glp-1 agonist for use in the treatment of stenosis or/and obstruction in the biliary tract |
| US8633156B2 (en) | 2008-01-09 | 2014-01-21 | Sanofi-Aventis Deutschland Gmbh | Insulin derivatives having an extremely delayed time-action profile |
| USRE45313E1 (en) | 1999-07-12 | 2014-12-30 | Zealand Pharma A/S | Exendin variant peptides |
| US9089538B2 (en) | 2010-04-27 | 2015-07-28 | Zealand Pharma A/S | Peptide conjugates of GLP-1 receptor agonists and gastrin and their use |
| US9200051B2 (en) | 2013-05-28 | 2015-12-01 | Takeda Pharmaceutical Company Limited | Peptide compound |
| US9364519B2 (en) | 2011-09-01 | 2016-06-14 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition for use in the treatment of a neurodegenerative disease |
| US9408893B2 (en) | 2011-08-29 | 2016-08-09 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for use in glycemic control in diabetes type 2 patients |
| US9644017B2 (en) | 2008-01-09 | 2017-05-09 | Sanofi-Aventis Deutschland Gmbh | Insulin derivatives having an extremely delayed time-action profile |
| US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
| US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
| US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
| US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
| US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
| US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
| WO2017178829A1 (en) * | 2016-04-15 | 2017-10-19 | Imperial Innovations Limited | Peptide analogues |
| US9821032B2 (en) | 2011-05-13 | 2017-11-21 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for improving glycemic control as add-on therapy to basal insulin |
| US9839692B2 (en) | 2014-01-09 | 2017-12-12 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US9839675B2 (en) | 2013-02-04 | 2017-12-12 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US9861706B2 (en) | 2011-11-03 | 2018-01-09 | Zealand Pharma A/S | GLP-1 receptor agonist peptide gastrin conjugates |
| US9895424B2 (en) | 2014-01-09 | 2018-02-20 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US9895423B2 (en) | 2014-01-09 | 2018-02-20 | Sanofi | Stabilized pharmaceutical formulations of insulin aspart |
| WO2018053036A1 (en) * | 2016-09-16 | 2018-03-22 | Viking Therapeutics, Inc. | Method of reducing thyroid-associated side effects |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US9944687B2 (en) | 2011-07-04 | 2018-04-17 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| US9950039B2 (en) | 2014-12-12 | 2018-04-24 | Sanofi-Aventis Deutschland Gmbh | Insulin glargine/lixisenatide fixed ratio formulation |
| US9975939B2 (en) | 2012-09-17 | 2018-05-22 | Zealand Pharma A/S | Glucagon analogues |
| US9981013B2 (en) | 2010-08-30 | 2018-05-29 | Sanofi-Aventis Deutschland Gmbh | Use of AVE0010 for the treatment of diabetes mellitus type 2 |
| US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
| EP3351262A1 (en) * | 2016-12-30 | 2018-07-25 | Istanbul Universitesi Rektorlugu | Curaglutide for in treatment of prediabetes, diabetes, obesity and metabolic diseases associated thereto |
| US10093713B2 (en) | 2013-11-06 | 2018-10-09 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
| US10131702B2 (en) | 2013-11-06 | 2018-11-20 | Zealand Pharma A/S | Glucagon-GLP-1-GIP triple agonist compounds |
| US10159713B2 (en) | 2015-03-18 | 2018-12-25 | Sanofi-Aventis Deutschland Gmbh | Treatment of type 2 diabetes mellitus patients |
| US10253078B2 (en) | 2014-10-29 | 2019-04-09 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US10336802B2 (en) | 2015-04-16 | 2019-07-02 | Zealand Pharma A/S | Acylated glucagon analogue |
| US10434147B2 (en) | 2015-03-13 | 2019-10-08 | Sanofi-Aventis Deutschland Gmbh | Treatment type 2 diabetes mellitus patients |
| WO2019197466A1 (en) | 2018-04-10 | 2019-10-17 | Sanofi-Aventis Deutschland Gmbh | Method for cleavage of solid phase-bound peptides from the solid phase |
| WO2019197469A1 (en) | 2018-04-10 | 2019-10-17 | Sanofi-Aventis Deutschland Gmbh | Lixisenatide synthesis with capping |
| US10457714B2 (en) | 2013-10-17 | 2019-10-29 | Zealand Pharma A/S | Acylated glucagon analogues |
| US10501516B2 (en) | 2016-05-24 | 2019-12-10 | Takeda Pharmaceutical Company Limited | Peptide compound |
| WO2020087305A1 (zh) * | 2018-10-30 | 2020-05-07 | 刘建宁 | 具有glp-1受体激动剂活性的glp-1多肽及其用途 |
| US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
| US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
| US10905745B2 (en) | 2016-12-09 | 2021-02-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
| US10925885B2 (en) | 2005-05-26 | 2021-02-23 | Metabasis Therapeutics, Inc. | Thyromimetics for the treatment of fatty liver diseases |
| US11034747B2 (en) | 2013-10-17 | 2021-06-15 | Zealand Pharma A/S | Glucagon analogues and methods of use |
| WO2021142736A1 (en) * | 2020-01-16 | 2021-07-22 | Shanghai Benemae Pharmaceutical Corporation | Dosing regimen of glp-1 |
| US11202789B2 (en) | 2016-11-21 | 2021-12-21 | Viking Therapeutics, Inc. | Method of treating glycogen storage disease |
| WO2022034062A1 (en) * | 2020-08-12 | 2022-02-17 | Txp Pharma Ag | Exendin-4 peptide analogues |
| US11707472B2 (en) | 2017-06-05 | 2023-07-25 | Viking Therapeutics, Inc. | Compositions for the treatment of fibrosis |
| US11787828B2 (en) | 2018-03-22 | 2023-10-17 | Viking Therapeutics, Inc. | Crystalline forms and methods of producing crystalline forms of a compound |
| US11795204B2 (en) | 2012-07-23 | 2023-10-24 | Zealand Pharma A/S | Glucagon analogues |
| US12102646B2 (en) | 2018-12-05 | 2024-10-01 | Viking Therapeutics, Inc. | Compositions for the treatment of fibrosis and inflammation |
| US12558307B2 (en) | 2009-07-06 | 2026-02-24 | Sanofi-Aventis | Insulin preparations containing methionine |
Families Citing this family (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1076066A1 (en) * | 1999-07-12 | 2001-02-14 | Zealand Pharmaceuticals A/S | Peptides for lowering blood glucose levels |
| US7635463B2 (en) | 2002-02-27 | 2009-12-22 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials |
| WO2003072143A1 (en) * | 2002-02-27 | 2003-09-04 | Pharmain, Ltd. | Compositions for delivery of therapeutics and other materials, and methods of making and using the same |
| WO2005112977A2 (en) * | 2004-04-23 | 2005-12-01 | Pharmain, Ltd. | Compositions for treatment with glucagon-like peptide, and methods of making and using the same |
| US20060099282A1 (en) * | 2004-11-10 | 2006-05-11 | Kazuoki Ishihara | Product of coromandel and method for its use |
| KR101529318B1 (ko) | 2005-12-19 | 2015-06-16 | 파마인 코포레이션 | 치료제를 전달하기 위한 소수성 코어 담체 조성물, 이조성물의 제조 방법 및 그 조성물의 이용 방법 |
| US7960336B2 (en) * | 2007-08-03 | 2011-06-14 | Pharmain Corporation | Composition for long-acting peptide analogs |
| US8563527B2 (en) * | 2007-08-20 | 2013-10-22 | Pharmain Corporation | Oligonucleotide core carrier compositions for delivery of nucleic acid-containing therapeutic agents, methods of making and using the same |
| US20090176892A1 (en) * | 2008-01-09 | 2009-07-09 | Pharmain Corporation | Soluble Hydrophobic Core Carrier Compositions for Delivery of Therapeutic Agents, Methods of Making and Using the Same |
| US20110118180A1 (en) * | 2009-11-13 | 2011-05-19 | Sanofi-Aventis Deutschland Gmbh | Method of treatment of diabetes type 2 comprising add-on therapy to metformin |
| AU2009238272B2 (en) * | 2009-11-13 | 2014-05-08 | Sanofi-Aventis Deutschland Gmbh | Method of treatment of diabetes type 2 comprising add-on therapy to metformin |
| AU2011202239C1 (en) | 2010-05-19 | 2017-03-16 | Sanofi | Long-acting formulations of insulins |
| MX377589B (es) | 2010-12-16 | 2025-03-10 | Novo Nordisk As | Composiciones sólidas que comprenden agonista de glp-1 y sal del ácido n-(8-(2-hidroxibenzoil)amino)caprílico. |
| RU2602601C2 (ru) | 2011-04-12 | 2016-11-20 | Ново Нордиск А/С | Дважды ацилированные производные glp-1 |
| US20130143800A1 (en) * | 2011-11-07 | 2013-06-06 | Research Development Foundation | Combination therapies to treat diabetes |
| DK2827845T3 (en) | 2012-03-22 | 2019-04-01 | Novo Nordisk As | COMPOSITIONS INCLUDING A PROCEDURE AND PREPARING THEREOF |
| CN104203266B (zh) | 2012-03-22 | 2017-12-26 | 诺和诺德股份有限公司 | Glp‑1肽组合物及其制备 |
| WO2013162718A1 (en) * | 2012-04-24 | 2013-10-31 | Albert Einstein College Of Medicine Of Yeshiva University | Insulin secretion stimulated by humanin and analogs thereof |
| JP6517690B2 (ja) | 2012-06-20 | 2019-05-22 | ノヴォ ノルディスク アー/エス | ペプチド及び送達剤を含む錠剤製剤 |
| EP2983697B1 (en) | 2013-04-03 | 2018-10-31 | Sanofi | Treatment of diabetes mellitus by long acting formulations of insulins |
| JP6672140B2 (ja) | 2013-05-02 | 2020-03-25 | ノヴォ ノルディスク アー/エス | Glp−1化合物の経口投薬 |
| PL3746111T3 (pl) | 2018-02-02 | 2024-01-15 | Novo Nordisk A/S | Stałe kompozycje zawierające agonistę glp-1 i sól kwasu n-(8-(2- hydroksybenzoilo)amino kaprylowego i substancję poślizgową |
| CA3265745A1 (en) * | 2022-08-25 | 2024-02-29 | The University Of British Columbia | Mucoadhesive pharmaceutical form for the unidirectional release of therapeutic peptidic particles |
| CN116730902B (zh) * | 2023-08-07 | 2023-11-21 | 杭州湃肽生化科技有限公司 | 一种合成利拉鲁肽的方法 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1999043708A1 (en) * | 1998-02-27 | 1999-09-02 | Novo Nordisk A/S | Glp-1 derivatives of glp-1 and exendin with protracted profile of action |
| WO2001004156A1 (en) * | 1999-07-12 | 2001-01-18 | Zealand Pharmaceuticals A/S | Peptides that lower blood glucose levels |
| WO2001032158A2 (en) * | 1999-11-03 | 2001-05-10 | Bristol-Myers Squibb Company | Pharmaceutical composition comprising a combination of metformin and another antidiabetic agent |
| US6344180B1 (en) * | 1999-06-15 | 2002-02-05 | Bionebraska, Inc. | GLP-1 as a diagnostic test to determine β-cell function and the presence of the condition of IGT and type II diabetes |
| US6358924B1 (en) * | 1997-12-05 | 2002-03-19 | Eli Lilly And Company | GLP-1 formulations |
Family Cites Families (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5118666A (en) | 1986-05-05 | 1992-06-02 | The General Hospital Corporation | Insulinotropic hormone |
| US5614492A (en) | 1986-05-05 | 1997-03-25 | The General Hospital Corporation | Insulinotropic hormone GLP-1 (7-36) and uses thereof |
| US5120712A (en) | 1986-05-05 | 1992-06-09 | The General Hospital Corporation | Insulinotropic hormone |
| ATE164852T1 (de) | 1990-01-24 | 1998-04-15 | Douglas I Buckley | Glp-1-analoga verwendbar in der diabetesbehandlung |
| US5545618A (en) | 1990-01-24 | 1996-08-13 | Buckley; Douglas I. | GLP-1 analogs useful for diabetes treatment |
| DK36392D0 (da) * | 1992-03-19 | 1992-03-19 | Novo Nordisk As | Anvendelse af kemisk forbindelse |
| US5846747A (en) | 1992-03-25 | 1998-12-08 | Novo Nordisk A/S | Method for detecting glucagon-like peptide-1 antagonists and agonists |
| DK39892D0 (da) | 1992-03-25 | 1992-03-25 | Bernard Thorens | Peptid |
| US5424286A (en) | 1993-05-24 | 1995-06-13 | Eng; John | Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same |
| US5705483A (en) | 1993-12-09 | 1998-01-06 | Eli Lilly And Company | Glucagon-like insulinotropic peptides, compositions and methods |
| US5523549A (en) | 1994-05-25 | 1996-06-04 | Ceramic Powders, Inc. | Ferrite compositions for use in a microwave oven |
| US5512549A (en) | 1994-10-18 | 1996-04-30 | Eli Lilly And Company | Glucagon-like insulinotropic peptide analogs, compositions, and methods of use |
| US6110703A (en) | 1996-07-05 | 2000-08-29 | Novo Nordisk A/S | Method for the production of polypeptides |
| WO1998005351A1 (en) | 1996-08-08 | 1998-02-12 | Amylin Pharmaceuticals, Inc. | Methods for regulating gastrointestinal motility |
| US6277819B1 (en) | 1996-08-30 | 2001-08-21 | Eli Lilly And Company | Use of GLP-1 or analogs in treatment of myocardial infarction |
| US6384016B1 (en) | 1998-03-13 | 2002-05-07 | Novo Nordisk A/S | Stabilized aqueous peptide solutions |
| US6268343B1 (en) | 1996-08-30 | 2001-07-31 | Novo Nordisk A/S | Derivatives of GLP-1 analogs |
| US6006753A (en) | 1996-08-30 | 1999-12-28 | Eli Lilly And Company | Use of GLP-1 or analogs to abolish catabolic changes after surgery |
| IL128332A0 (en) * | 1996-08-30 | 2000-01-31 | Novo Nordisk As | GLP-1 derivatives |
| UA65549C2 (uk) | 1996-11-05 | 2004-04-15 | Елі Ліллі Енд Компані | Спосіб регулювання ожиріння шляхом периферійного введення аналогів та похідних glp-1 (варіанти) та фармацевтична композиція |
| EP0996459B1 (en) | 1997-01-07 | 2005-09-21 | Amylin Pharmaceuticals, Inc. | Use of exendins and agonists thereof for the reduction of food intake |
| US5846937A (en) | 1997-03-03 | 1998-12-08 | 1149336 Ontario Inc. | Method of using exendin and GLP-1 to affect the central nervous system |
| CA2299425A1 (en) | 1997-08-08 | 1999-02-18 | Amylin Pharmaceuticals, Inc. | Novel exendin agonist compounds |
| WO1999025727A2 (en) | 1997-11-14 | 1999-05-27 | Amylin Pharmaceuticals, Inc. | Novel exendin agonist compounds |
| ATE383867T1 (de) | 1997-11-14 | 2008-02-15 | Amylin Pharmaceuticals Inc | Neuartige exendin agonisten |
| JP4394279B2 (ja) | 1998-03-09 | 2010-01-06 | ジーランド ファーマ アクティーゼルスカブ | 酵素加水分解に対する傾向が減少した薬理学的に活性なペプチド複合体 |
| JP2002526554A (ja) | 1998-10-07 | 2002-08-20 | メディカル カレッジ オブ ジョージア リサーチ インスティチュート,インコーポレイテッド | 骨親和性ホルモンとして用いられるグルコース依存性インスリン親和性ペプチド |
| US6284725B1 (en) | 1998-10-08 | 2001-09-04 | Bionebraska, Inc. | Metabolic intervention with GLP-1 to improve the function of ischemic and reperfused tissue |
| US6271241B1 (en) | 1999-04-02 | 2001-08-07 | Neurogen Corporation | Cycloalkyl and aryl fused aminoalkyl-imidazole derivatives: modulators and GLP-1 receptors |
| CA2363712C (en) | 1999-05-17 | 2011-05-10 | Conjuchem Inc. | Long lasting insulinotropic peptides |
| US6506724B1 (en) * | 1999-06-01 | 2003-01-14 | Amylin Pharmaceuticals, Inc. | Use of exendins and agonists thereof for the treatment of gestational diabetes mellitus |
-
2003
- 2003-07-02 EP EP03762471A patent/EP1525219B1/en not_active Revoked
- 2003-07-02 WO PCT/DK2003/000463 patent/WO2004005342A1/en not_active Ceased
- 2003-07-02 JP JP2004518465A patent/JP5685355B2/ja not_active Expired - Fee Related
- 2003-07-02 MX MXPA04012497A patent/MXPA04012497A/es active IP Right Grant
- 2003-07-02 CA CA002490564A patent/CA2490564A1/en not_active Abandoned
- 2003-07-02 DE DE60327771T patent/DE60327771D1/de not_active Expired - Lifetime
- 2003-07-02 AU AU2003243929A patent/AU2003243929B2/en not_active Ceased
- 2003-07-02 ES ES03762471T patent/ES2327328T3/es not_active Expired - Lifetime
- 2003-07-02 DK DK03762471T patent/DK1525219T3/da active
- 2003-07-02 EP EP08016668A patent/EP2028192A1/en not_active Withdrawn
- 2003-07-02 AT AT03762471T patent/ATE432289T1/de not_active IP Right Cessation
- 2003-07-02 US US10/517,563 patent/US20060057137A1/en not_active Abandoned
-
2004
- 2004-12-02 IL IL165531A patent/IL165531A/en unknown
-
2008
- 2008-11-24 US US12/277,148 patent/US20090088369A1/en not_active Abandoned
-
2009
- 2009-06-15 AU AU2009202390A patent/AU2009202390B8/en not_active Ceased
-
2010
- 2010-09-16 IL IL208184A patent/IL208184A/en active IP Right Grant
- 2010-12-15 AU AU2010257216A patent/AU2010257216B2/en not_active Ceased
-
2012
- 2012-12-19 JP JP2012276583A patent/JP5758870B2/ja not_active Expired - Fee Related
-
2014
- 2014-02-10 US US14/177,132 patent/US20140187483A1/en not_active Abandoned
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6358924B1 (en) * | 1997-12-05 | 2002-03-19 | Eli Lilly And Company | GLP-1 formulations |
| WO1999043708A1 (en) * | 1998-02-27 | 1999-09-02 | Novo Nordisk A/S | Glp-1 derivatives of glp-1 and exendin with protracted profile of action |
| US6344180B1 (en) * | 1999-06-15 | 2002-02-05 | Bionebraska, Inc. | GLP-1 as a diagnostic test to determine β-cell function and the presence of the condition of IGT and type II diabetes |
| WO2001004156A1 (en) * | 1999-07-12 | 2001-01-18 | Zealand Pharmaceuticals A/S | Peptides that lower blood glucose levels |
| EP1329458A2 (en) * | 1999-07-12 | 2003-07-23 | Zealand Pharma A/S | Peptides that lower blood glucose levels |
| WO2001032158A2 (en) * | 1999-11-03 | 2001-05-10 | Bristol-Myers Squibb Company | Pharmaceutical composition comprising a combination of metformin and another antidiabetic agent |
Non-Patent Citations (6)
| Title |
|---|
| ANDREW A. YOUNG ET AL: "Studies in Obese Diabetic (ob/ob, db/db) Mice, Diabetic Fatty Zucker Rats, and Diabetic Rhesus Monkeys (Macaca mulatta)", DIABETES, vol. 48, May 1999 (1999-05-01), pages 1026 - 1034, XP002256109 * |
| DAVID G. PARKES ET AL: "Insulinotropic Actions of Exendin-4 and Glucagon-Like Peptide-1 In Vivo and In Vitro", METABOLISM, vol. 50, no. 5, May 2001 (2001-05-01), pages 583 - 589, XP002256111 * |
| DORIS A. STOFFERS ET AL: "Insulinotropic Glucagon-Like Peptide 1 Agonists Stimulate Expression of Homeodomain Protein IDX-1 and Increase Islet Size in Mouse Pancreas", DIABETES, vol. 49, May 2000 (2000-05-01), pages 741 - 748, XP002256114 * |
| LISA JUNTTI-BERGGREN ET AL: "The Antidiabetogenic Effect of GLP-1 Is Maintained During a 7-Day Treatment Period and Improves Diabetic Dyslipoproteinemia in NIDDM Patients", DIABETES CARE, vol. 19, no. 11, November 1996 (1996-11-01), pages 1200 - 1206, XP002256110 * |
| RÉMY BURCELIN ET AL: "Long-Lasting Antidiabetic Effect of a Dipeptidyl Peptidase IV-Resistant Analog of Glucagon-Like Peptide-1", METABOLISM, vol. 48, no. 2, February 1999 (1999-02-01), pages 252 - 258, XP002256112 * |
| U RITZEL ET AL: "A synthetic glucagon-like peptide-1 analog with improved plasma stability", JOURNAL OF ENDOCRINOLOGY, vol. 159, 1998, pages 93 - 102, XP002256113 * |
Cited By (112)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| USRE45313E1 (en) | 1999-07-12 | 2014-12-30 | Zealand Pharma A/S | Exendin variant peptides |
| WO2004050115A3 (en) * | 2002-12-03 | 2004-07-22 | Novo Nordisk As | Combination treatment using exendin-4 and thiazolidinediones |
| EP1688148A1 (en) * | 2002-12-03 | 2006-08-09 | Novo Nordisk A/S | Combination treatment using exendin-4 and thiazolidinediones |
| WO2006037810A3 (en) * | 2004-10-07 | 2006-09-08 | Novo Nordisk As | Protracted glp-1 compounds |
| US8030273B2 (en) | 2004-10-07 | 2011-10-04 | Novo Nordisk A/S | Protracted exendin-4 compounds |
| US8772232B2 (en) | 2004-10-07 | 2014-07-08 | Novo Nordisk A/S | Protracted exendin-4 compounds |
| US7893017B2 (en) | 2004-10-07 | 2011-02-22 | Novo Nordisk A/S | Protracted GLP-1 compounds |
| US10925885B2 (en) | 2005-05-26 | 2021-02-23 | Metabasis Therapeutics, Inc. | Thyromimetics for the treatment of fatty liver diseases |
| WO2007051987A1 (en) * | 2005-11-01 | 2007-05-10 | Activotec Spp Limited | Insulinotropic compounds and uses thereof |
| US8410048B2 (en) | 2006-07-11 | 2013-04-02 | Sanofi-Aventis Deutschland Gmbh | Method for producing insulin analogs having a dibasic B chain terminus |
| US8048854B2 (en) | 2006-07-11 | 2011-11-01 | Sanofi-Aventis Deutschland Gmbh | Amidated insulin glargine |
| DE102008003568A1 (de) | 2008-01-09 | 2009-07-16 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| US8633156B2 (en) | 2008-01-09 | 2014-01-21 | Sanofi-Aventis Deutschland Gmbh | Insulin derivatives having an extremely delayed time-action profile |
| US9644017B2 (en) | 2008-01-09 | 2017-05-09 | Sanofi-Aventis Deutschland Gmbh | Insulin derivatives having an extremely delayed time-action profile |
| DE102008003566A1 (de) | 2008-01-09 | 2009-07-16 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| DE102008025008A1 (de) | 2008-05-24 | 2009-11-26 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| DE102008025007A1 (de) | 2008-05-24 | 2009-11-26 | Sanofi-Aventis Deutschland Gmbh | Neue Insulinderivate mit extrem verzögertem Zeit-/ Wirkungsprofil |
| US10117909B2 (en) | 2008-10-17 | 2018-11-06 | Sanofi-Aventis Deutschland Gmbh | Combination of an insulin and a GLP-1 agonist |
| EP3677275A1 (de) | 2008-10-17 | 2020-07-08 | Sanofi-Aventis Deutschland GmbH | Kombination von einem insulin und einem glp-1-agonisten |
| CN102256618A (zh) * | 2008-10-17 | 2011-11-23 | 赛诺菲-安万特德国有限公司 | 胰岛素和glp-1激动剂的组合 |
| RU2682671C2 (ru) * | 2008-10-17 | 2019-03-20 | Санофи-Авентис Дойчланд Гмбх | Комбинация инсулина и агониста glp-1 |
| EP3228320A1 (de) | 2008-10-17 | 2017-10-11 | Sanofi-Aventis Deutschland GmbH | Kombination von einem insulin und einem glp-1-agonisten |
| CN105396126A (zh) * | 2008-10-17 | 2016-03-16 | 赛诺菲-安万特德国有限公司 | 胰岛素和glp-1激动剂的组合 |
| DE102008051834A1 (de) | 2008-10-17 | 2010-04-22 | Sanofi-Aventis Deutschland Gmbh | Kombination von einem Insulin und einem GLP-1-Agonisten |
| US9526764B2 (en) | 2008-10-17 | 2016-12-27 | Sanofi-Aventis Deutschland Gmbh | Combination of an insulin and a GLP-1-agonist |
| DE102008053048A1 (de) | 2008-10-24 | 2010-04-29 | Sanofi-Aventis Deutschland Gmbh | Kombination von einem Insulin und einem GLP-1-Agonisten |
| US12558307B2 (en) | 2009-07-06 | 2026-02-24 | Sanofi-Aventis | Insulin preparations containing methionine |
| DE102009038210A1 (de) | 2009-08-20 | 2011-03-03 | Sanofi-Aventis Deutschland Gmbh | Kombination von einem Insulin und einem GLP-1-Agonisten |
| EP3345593A1 (de) | 2009-11-13 | 2018-07-11 | Sanofi-Aventis Deutschland GmbH | Pharmazeutische zusammensetzung umfassend despro36exendin-4(1-39)-lys6-nh2 und methionin |
| US10029011B2 (en) | 2009-11-13 | 2018-07-24 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist, an insulin and methionine |
| US10028910B2 (en) | 2009-11-13 | 2018-07-24 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1-agonist and methionine |
| WO2011058082A1 (de) | 2009-11-13 | 2011-05-19 | Sanofi-Aventis Deutschland Gmbh | Pharmazeutische zusammensetzung umfassend einen glp-1-agonisten und methionin |
| US12303598B2 (en) | 2009-11-13 | 2025-05-20 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1-agonist and methionine |
| WO2011058083A1 (de) | 2009-11-13 | 2011-05-19 | Sanofi-Aventis Deutschland Gmbh | Pharmazeutische zusammensetzung umfassend einen glp-1-agonisten, ein insulin und methionin |
| US9707176B2 (en) | 2009-11-13 | 2017-07-18 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist and methionine |
| EP3831402A1 (de) | 2009-11-13 | 2021-06-09 | Sanofi-Aventis Deutschland GmbH | Pharmazeutische zusammensetzung umfassend einen glp-1-agonisten, ein insulin und methionin |
| EP3417871A1 (de) | 2009-11-13 | 2018-12-26 | Sanofi-Aventis Deutschland GmbH | Pharmazeutische zusammensetzung umfassend einen glp-1-agonisten, ein insulin und methionin |
| EP2554183A1 (de) | 2009-11-13 | 2013-02-06 | Sanofi-Aventis Deutschland GmbH | Pharmazeutische Zusammensetzung umfassend einen GLP-1-Agonisten, ein Insulin und Methionin |
| DE102010011919A1 (de) | 2010-03-18 | 2011-09-22 | Sanofi-Aventis Deutschland Gmbh | Pharmazeutische Zusammensetzung umfassend einen GLP-1-Agonisten und Methionin |
| US10406207B2 (en) | 2010-04-27 | 2019-09-10 | Zealand Pharma A/S | Peptide conjugates of GLP-1 receptor agonists and gastrin and their use |
| US9649362B2 (en) | 2010-04-27 | 2017-05-16 | Zealand Pharma A/S | Peptide conjugates of GLP-1 receptor agonists and gastrin and their use |
| US9089538B2 (en) | 2010-04-27 | 2015-07-28 | Zealand Pharma A/S | Peptide conjugates of GLP-1 receptor agonists and gastrin and their use |
| US9981013B2 (en) | 2010-08-30 | 2018-05-29 | Sanofi-Aventis Deutschland Gmbh | Use of AVE0010 for the treatment of diabetes mellitus type 2 |
| US9821032B2 (en) | 2011-05-13 | 2017-11-21 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for improving glycemic control as add-on therapy to basal insulin |
| US9944687B2 (en) | 2011-07-04 | 2018-04-17 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| US9408893B2 (en) | 2011-08-29 | 2016-08-09 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical combination for use in glycemic control in diabetes type 2 patients |
| US9987332B2 (en) | 2011-09-01 | 2018-06-05 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition for use in the treatment of a neurodegenerative disease |
| US9364519B2 (en) | 2011-09-01 | 2016-06-14 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition for use in the treatment of a neurodegenerative disease |
| WO2013050379A1 (en) | 2011-10-04 | 2013-04-11 | Sanofi-Aventis Deutschland Gmbh | Glp-1 agonist for use in the treatment of stenosis or/and obstruction in the pancreatic duct system |
| WO2013050378A1 (en) | 2011-10-04 | 2013-04-11 | Sanofi-Aventis Deutschland Gmbh | Glp-1 agonist for use in the treatment of stenosis or/and obstruction in the biliary tract |
| US9861706B2 (en) | 2011-11-03 | 2018-01-09 | Zealand Pharma A/S | GLP-1 receptor agonist peptide gastrin conjugates |
| US11795204B2 (en) | 2012-07-23 | 2023-10-24 | Zealand Pharma A/S | Glucagon analogues |
| US9975939B2 (en) | 2012-09-17 | 2018-05-22 | Zealand Pharma A/S | Glucagon analogues |
| US10253081B2 (en) | 2012-09-17 | 2019-04-09 | Zealand Pharma A/S | Glucagon analogues |
| US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
| US9745360B2 (en) | 2012-12-21 | 2017-08-29 | Sanofi | Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists |
| US10253079B2 (en) | 2012-12-21 | 2019-04-09 | Sanofi | Functionalized Exendin-4 derivatives |
| US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
| US9839675B2 (en) | 2013-02-04 | 2017-12-12 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US9200051B2 (en) | 2013-05-28 | 2015-12-01 | Takeda Pharmaceutical Company Limited | Peptide compound |
| US10087229B2 (en) | 2013-05-28 | 2018-10-02 | Takeda Pharmaceutical Company Limited | Peptide compound |
| US10457714B2 (en) | 2013-10-17 | 2019-10-29 | Zealand Pharma A/S | Acylated glucagon analogues |
| US11884713B2 (en) | 2013-10-17 | 2024-01-30 | Zealand Pharma A/S | Acylated glucagon analogues |
| US12473339B2 (en) | 2013-10-17 | 2025-11-18 | Zealand Pharma A/S | Acylated glucagon analogues |
| US11034747B2 (en) | 2013-10-17 | 2021-06-15 | Zealand Pharma A/S | Glucagon analogues and methods of use |
| US11091528B2 (en) | 2013-10-17 | 2021-08-17 | Zealand Pharma A/S | Acylated glucagon analogues |
| US11111285B2 (en) | 2013-11-06 | 2021-09-07 | Zealand Pharma A/S | Glucagon-GLP-1-GIP triple agonist compounds |
| US10131702B2 (en) | 2013-11-06 | 2018-11-20 | Zealand Pharma A/S | Glucagon-GLP-1-GIP triple agonist compounds |
| US10093713B2 (en) | 2013-11-06 | 2018-10-09 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
| US11008375B2 (en) | 2013-11-06 | 2021-05-18 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
| US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
| US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
| US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
| US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
| US9895424B2 (en) | 2014-01-09 | 2018-02-20 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US9895423B2 (en) | 2014-01-09 | 2018-02-20 | Sanofi | Stabilized pharmaceutical formulations of insulin aspart |
| US9839692B2 (en) | 2014-01-09 | 2017-12-12 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US10610595B2 (en) | 2014-01-09 | 2020-04-07 | Sanofi | Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives |
| US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
| US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US11814417B2 (en) | 2014-10-29 | 2023-11-14 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US10253078B2 (en) | 2014-10-29 | 2019-04-09 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US11001619B2 (en) | 2014-10-29 | 2021-05-11 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US12186374B2 (en) | 2014-12-12 | 2025-01-07 | Sanofi-Aventis Deutschland Gmbh | Insulin glargine/lixisenatide fixed ratio formulation |
| US9950039B2 (en) | 2014-12-12 | 2018-04-24 | Sanofi-Aventis Deutschland Gmbh | Insulin glargine/lixisenatide fixed ratio formulation |
| US10434147B2 (en) | 2015-03-13 | 2019-10-08 | Sanofi-Aventis Deutschland Gmbh | Treatment type 2 diabetes mellitus patients |
| US10159713B2 (en) | 2015-03-18 | 2018-12-25 | Sanofi-Aventis Deutschland Gmbh | Treatment of type 2 diabetes mellitus patients |
| US10336802B2 (en) | 2015-04-16 | 2019-07-02 | Zealand Pharma A/S | Acylated glucagon analogue |
| US11274136B2 (en) | 2015-04-16 | 2022-03-15 | Zealand Pharma A/S | Acylated glucagon analogue |
| US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
| US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
| WO2017178829A1 (en) * | 2016-04-15 | 2017-10-19 | Imperial Innovations Limited | Peptide analogues |
| US10501516B2 (en) | 2016-05-24 | 2019-12-10 | Takeda Pharmaceutical Company Limited | Peptide compound |
| WO2018053036A1 (en) * | 2016-09-16 | 2018-03-22 | Viking Therapeutics, Inc. | Method of reducing thyroid-associated side effects |
| US11202789B2 (en) | 2016-11-21 | 2021-12-21 | Viking Therapeutics, Inc. | Method of treating glycogen storage disease |
| US10905745B2 (en) | 2016-12-09 | 2021-02-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
| US11395847B2 (en) | 2016-12-09 | 2022-07-26 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
| EP3351262A1 (en) * | 2016-12-30 | 2018-07-25 | Istanbul Universitesi Rektorlugu | Curaglutide for in treatment of prediabetes, diabetes, obesity and metabolic diseases associated thereto |
| US11707472B2 (en) | 2017-06-05 | 2023-07-25 | Viking Therapeutics, Inc. | Compositions for the treatment of fibrosis |
| US11787828B2 (en) | 2018-03-22 | 2023-10-17 | Viking Therapeutics, Inc. | Crystalline forms and methods of producing crystalline forms of a compound |
| US12227533B2 (en) | 2018-03-22 | 2025-02-18 | Viking Therapeutics, Inc. | Crystalline forms and methods of producing crystalline forms of a compound |
| US11560402B2 (en) | 2018-04-10 | 2023-01-24 | Sanofi-Aventis Deutschland Gmbh | Method for cleavage of solid phase-bound peptides from the solid phase |
| US11028123B2 (en) | 2018-04-10 | 2021-06-08 | Sanofi-Aventis Deutschland Gmbh | Capping of unprotected amino groups during peptide synthesis |
| WO2019197466A1 (en) | 2018-04-10 | 2019-10-17 | Sanofi-Aventis Deutschland Gmbh | Method for cleavage of solid phase-bound peptides from the solid phase |
| WO2019197469A1 (en) | 2018-04-10 | 2019-10-17 | Sanofi-Aventis Deutschland Gmbh | Lixisenatide synthesis with capping |
| US11141464B2 (en) | 2018-10-30 | 2021-10-12 | Liu Jianning | GLP-1 polypeptide having GLP-1 receptor agonist activity and use thereof |
| WO2020087305A1 (zh) * | 2018-10-30 | 2020-05-07 | 刘建宁 | 具有glp-1受体激动剂活性的glp-1多肽及其用途 |
| US12102646B2 (en) | 2018-12-05 | 2024-10-01 | Viking Therapeutics, Inc. | Compositions for the treatment of fibrosis and inflammation |
| WO2021142736A1 (en) * | 2020-01-16 | 2021-07-22 | Shanghai Benemae Pharmaceutical Corporation | Dosing regimen of glp-1 |
| WO2022034062A1 (en) * | 2020-08-12 | 2022-02-17 | Txp Pharma Ag | Exendin-4 peptide analogues |
Also Published As
| Publication number | Publication date |
|---|---|
| US20090088369A1 (en) | 2009-04-02 |
| JP5685355B2 (ja) | 2015-03-18 |
| JP2013126981A (ja) | 2013-06-27 |
| EP1525219B1 (en) | 2009-05-27 |
| IL165531A (en) | 2011-01-31 |
| AU2010257216B2 (en) | 2012-09-27 |
| IL165531A0 (en) | 2006-01-15 |
| JP2006515267A (ja) | 2006-05-25 |
| HK1075456A1 (en) | 2005-12-16 |
| CA2490564A1 (en) | 2004-01-15 |
| DE60327771D1 (de) | 2009-07-09 |
| AU2010257216A1 (en) | 2011-01-13 |
| AU2003243929B2 (en) | 2009-06-04 |
| IL208184A (en) | 2014-12-31 |
| AU2003243929A1 (en) | 2004-01-23 |
| EP1525219A1 (en) | 2005-04-27 |
| JP5758870B2 (ja) | 2015-08-05 |
| IL208184A0 (en) | 2010-12-30 |
| AU2009202390B8 (en) | 2010-11-11 |
| US20140187483A1 (en) | 2014-07-03 |
| ES2327328T3 (es) | 2009-10-28 |
| AU2009202390A1 (en) | 2009-07-09 |
| US20060057137A1 (en) | 2006-03-16 |
| AU2009202390B2 (en) | 2010-10-07 |
| MXPA04012497A (es) | 2005-07-14 |
| ATE432289T1 (de) | 2009-06-15 |
| EP2028192A1 (en) | 2009-02-25 |
| DK1525219T3 (da) | 2009-09-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1525219B1 (en) | Glp-1 and methods for treating diabetes | |
| US6344180B1 (en) | GLP-1 as a diagnostic test to determine β-cell function and the presence of the condition of IGT and type II diabetes | |
| JP6755175B2 (ja) | インスリン投薬レジメン | |
| US20040254107A1 (en) | Biphasic mixtures of glp-1 and insulin | |
| AU2011348202A1 (en) | Methods for treating metabolic disorders and obesity with GIP and GLP-1 receptor-active glucagon-based peptides | |
| SK1432004A3 (sk) | Liečivo na znižovanie mortality a morbidity súvisiacich s kritickými ochoreniami | |
| CA2230968A1 (en) | Method of treating insulin resistance | |
| Meece | Pharmacokinetics and pharmacodynamics of liraglutide, a long‐acting, potent glucagon‐like peptide‐1 analog | |
| WO2002085406A1 (en) | Methods and compositions for treating conditions associated with insulin resistance | |
| US7256174B2 (en) | Somatostatin and somatostatin agonists for treating insulin insensitivity and Syndrome X | |
| CN114423462A (zh) | 2型糖尿病的治疗 | |
| HK1075456B (en) | Glp-1 and methods for treating diabetes | |
| WO2008062420A2 (en) | Use of glucagon and insulin in methods and compositions for the treatment of acute brain injury and neurodegenerative disorders | |
| HK1191551A (en) | Methods for treating metabolic disorders and obesity with gip and glp-1 receptor-active glucagon-based peptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 165531 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003243929 Country of ref document: AU Ref document number: PA/a/2004/012497 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2490564 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004518465 Country of ref document: JP |
|
| REEP | Request for entry into the european phase |
Ref document number: 2003762471 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003762471 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2003762471 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2006057137 Country of ref document: US Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10517563 Country of ref document: US |
|
| WWP | Wipo information: published in national office |
Ref document number: 10517563 Country of ref document: US |