WO2003101474A1 - Combination chemotherapy with chlorotoxin - Google Patents
Combination chemotherapy with chlorotoxin Download PDFInfo
- Publication number
- WO2003101474A1 WO2003101474A1 PCT/US2003/017410 US0317410W WO03101474A1 WO 2003101474 A1 WO2003101474 A1 WO 2003101474A1 US 0317410 W US0317410 W US 0317410W WO 03101474 A1 WO03101474 A1 WO 03101474A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- chlorotoxin
- carcinoma
- seq
- peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43513—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
- C07K14/43522—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from scorpions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/17—Amides, e.g. hydroxamic acids having the group >N—C(O)—N< or >N—C(S)—N<, e.g. urea, thiourea, carmustine
- A61K31/175—Amides, e.g. hydroxamic acids having the group >N—C(O)—N< or >N—C(S)—N<, e.g. urea, thiourea, carmustine having the group, >N—C(O)—N=N— or, e.g. carbonohydrazides, carbazones, semicarbazides, semicarbazones; Thioanalogues thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- the present invention relates generally to the fields of cell physiology and oncology. More specifically, the present invention relates to a novel method of treating cell proliferative disorders, such as cancers, with doses of chlorotoxin and/or derivatives thereof in combination with chemotherapeutic agents.
- Primary brain tumors Tumors that originate in brain tissue are known as primary brain tumors as opposed to secondary brain tumors that develop when cancer metastatizes to the brain.
- Primary brain tumors are classified by the type of tissue in which they begin. The most common brain tumors are gliomas, which begin in the glial (supportive) tissue.
- Astrocytomas are a type of glio a that arise from small, star-shaped cells called astrocytes. They may grow anywhere in the brain or spinal cord but most often arise in the cerebrum in adults and the brain stem, the cerebrum, and the cerebellum in children.
- a grade III astrocytoma is sometimes called anaplastic astrocytoma while a grade IV astrocytoma is usually called glioblastoma multiforme.
- Brain stem gliomas occur in the lowest, stemlike part of the brain. Tumors in this area generally cannot be removed. Most brain stem gliomas are high-grade astrocytomas. Ependymomas are a type of glioma that usually develop in the lining of the ventricles and may also occur in the spinal cord. Although these tumors can develop at any age, they are most common in childhood and adolescence. Oligodendrogliomas arise in the cells that produce myelin, the fatty covering that protects nerves. These rare tumors usually arise in the cerebrum, grow slowly, usually do not spread into surrounding brain tissue and occur most often in middle-aged adults but have been found in people of all ages.
- Schwannomas are benign tumors that begin in Schwann cells, which produce the myelin that protects the acoustic nerve.
- Acoustic neuromas are a type of schwannoma and occur mainly in adults.
- Craniopharyngiomas develop in the region of the pituitary gland near the hypothalamus and are usually benign, however, they are sometimes considered malignant because they can press on or damage the hypothalamus and affect vital functions.
- Germ cell tumors arise from primitive (developing) sex cells or germ cells. The most frequent type of germ cell tumor in the brain is the germinoma. Pineal region tumors occur in or around the pineal gland, a tiny organ near the center of the brain. The tumor can be slow growing
- pineal region is very difficult to reach, and these tumors often camiot be removed.
- Primitive neuroectodermal tumors are found both in the central and peripheral nervous systems. Primitive neuroectodermal tumors found only in the peripheral nervous system are referred to as peripheral primitive neuroectodermal tumors. Primitive neuroectodermal tumors manifest preferentially in children and have capacity for developing into a variety of neuronal, astrocytic, ependymal, muscular and melanotic lines. The conceptual basis of grouping these tumors together is based upon sharing common progenitor cells as well as sharing similar neoplastic transformations leading to tumors of similar morphological features and biological behavior. However, there remains controversy in placing all primitive neuroectodermal tumors into the same categories.
- Supratentorial primitive neuroectodermal tumors include cerebral medulloblastomas, cerebral neuroblastomas, ependymoblastoma and other primitive neuroectodermal tumors, such as pineoblastomas.
- Peripheral neuroblastic tumors of the adrenal gland (medulla) and sympathetic nervous system are the most common type of childhood tumor outside of the central nervous system.
- Primary sites for these primitive neuroectodermal tumors are in the adrenals, abdominal, thoracic, cervical and pelvic sympathetic ganglia but include other primary sites as orbit, kidney, lung, skin, ovary, spermatic cord, and urinary bladder.
- Medulloblastomas are members of the primitive neuroectodermal tumors that are described as highly malignant embryonal tumors of the central nervous system found in the cerebellum.
- the other common post-surgery adjuvant cancer treatment is relatively ineffective against neuroectodermal tumors.
- chemotherapy against neuroectodermal tumors with nitrosourea agents is not curative.
- Many other cancer treating agents have been studied and tested, but generally they have a minimal effect on extending survival because many agents do not cross the blood-brain barrier.
- the current prognosis for patients diagnosed with neuroectodermal tumors is not favorable.
- the median survival term for patients diagnosed with malignant astrocytomas having surgery and no adjuvant treatment is about fourteen weeks. Radiation therapy after surgery extends the median to about thirty-six weeks.
- the current two year survival rate for all forms of treatment is less than ten percent.
- Lung cancer kills more Americans annually than the next four most frequently diagnosed neoplasms combined (Greenlee et al. (2001) CA Cancer J. Clin. 51, 15-36).
- Approximately eighty percent of primary lung tumors are of the non-small cell variety, which includes squamous cell and large cell carcinomas, as well as adenocarcinomas.
- Single-modality therapy is considered appropriate for most cases of early and late stage non-small cell lung cancer.
- Early stage tumors are potentially curable with surgery, chemotherapy, or radiotherapy, and late stage patients usually receive chemotherapy or best supportive care.
- Intermediate stage or locally advanced non-small cell lung cancer which comprises twenty- five to thirty-five percent of all cases, is more typically treated with multi-modality therapy.
- Breast cancer also presents treatment difficulties using known agents.
- the incidence of breast cancer in the United States has been rising at a rate of about two percent per year since 1980, and the American Cancer Society estimated that 192,000 cases of invasive breast cancer were diagnosed in 2001.
- Breast cancer is usually treated with surgery, radiotherapy, chemotherapy, hormone therapy or combinations of the various methods.
- a major reason for the failure of cancer chemotherapy in breast cancer is the development of resistance to the cytotoxic drugs.
- Combination therapy using drugs with different mechanisms of action is an accepted method of treatment which prevents development of resistance by the treated tumor.
- Anti-angiogenic agents are particularly useful in combination therapy because they are not likely to cause resistance development since they do not act on the tumor, but on normal host tissue. Compositions (see U.S. patent 5,905,027) and methods (see U.S.
- patent 6,028,174 for diagnosing and treating neuroectodermal tumors (e.g., gliomas and meningiomas) have been developed based on the ability of chlorotoxin to bind to tumor cells of neuroectodermal origin (Soroceanu et al. (1998) Cancer Res. 58, 4871-4879; Ullrich et al. (1996) Neuroreport 7, 1020-1024; Ullrich et t. (1996) Am. J. Physiol. 270, C1511-C1521).
- neuroectodermal tumors e.g., gliomas and meningiomas
- Diagnosis of neuroectodermal tumors is accomplished by identification of labeled chlorotoxin bound to tumor cells while treatment of neuroectodermal tumors is accomplished by targeting tumors with cytotoxic agents linked to chlorotoxin.
- Chlorotoxin is a thirty-six amino acid protein naturally derived from leiurus quinquestriatus scorpion venom (DeBin et al. (1993) Am. J. Physiol. 264, C361-369).
- the present invention expands this area of therapeutics by providing a method for treating cancer using chlorotoxin, in combination with other, conventional cancer treating agents.
- the invention includes methods for treating cancer comprising administering chlorotoxin or a chlorotoxin derivative in combination with at least one chemotherapeutic agent.
- chlorotoxin or a chlorotoxin derivative is administered prior to administration of the chemotherapeutic agent, while in other embodiments it is administered simultaneously with the chemotherapeutic agent while in yet other embodiments, it is administered subsequent to the chemotherapeutic agent.
- the chemotherapeutic agent is selected from the group consisting of alkylating agents, purine antagonists, pyrimidine antagonists, plant alkaloids, intercalating antibiotics, aromatase inhibitors, anti-metabolites, mitotic inhibitors, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, anti-hormones and anti-androgens.
- chemotherapeutic agents examples include, but are not limited to, BCNU, cisplatin, gemcitabine, hydroxyurea, paclitaxel, temozomide, topotecan, fluorouracil, vincristine, vinblastine, procarbazine, dacarbazine, altretamine, cisplatin, methotrexate, mercaptopurine, thioguanine, fludarabine phosphate, cladribine, pentostatin, fluorouracil, cytarabine, azacitidine, vinblastine, vincristine, etoposide, teniposide, irinotecan, docetaxel, doxorubicin, daunorubicin, dactinomycin, idarubicin, plicamycin, mitomycin, bleomycin, tamoxifen, flutamide, leuprolide, goserelin,
- the methods of the invention are useful for treating types of cancer selected from the group consisting of lung cancer, bone cancer, liver cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, chronic or acute leukemia, lymphocytic lymphomas, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis,
- the invention also includes compositions for treating cancer comprising chlorotoxin or a chlorotoxin derivative and at least one chemotherapeutic agent.
- the chemotherapeutic agent is selected from the group consisting of alkylating agents, purine antagonists, pyrimidine antagonists, plant alkaloids, intercalating antibiotics, aromatase inhibitors, anti-metabolites, mitotic inhibitors, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, anti-hormones and anti- androgens.
- chemotherapeutic agents examples include, but are not limited to, BCNU, cisplatin, gemcitabine, hydroxyurea, paclitaxel, temozomide, topotecan, fluorouracil, vincristine, vinblastine, procarbazine, dacarbazine, altretamine, cisplatin, methotrexate, mercaptopurine, thioguanine, fludarabine phosphate, cladribine, pentostatin, fluorouracil, cytarabine, azacitidine, vinblastine, vincristine, etoposide, teniposide, irinotecan, docetaxel, doxorubicin, daunorubicin, dactinomycin, idarubicin, plicamycin, mitomycin, bleomycin, tamoxifen, flutamide, leuprolide, goserelin
- compositions of the invention are useful for treatment of one or more types of cancer selected from the group consisting of lung cancer, bone cancer, liver cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, chronic or acute leukemia, lymphocytic lymphomas, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis,
- the invention also includes methods for detecting the presence of cancer in a patient comprising administering a detectable amount of labeled chlorotoxin or a chlorotoxin derivative, including radiolabeled chlorotoxin or a derivative thereof.
- Acceptable radiolabels include, but are not limited to, 3 H, 14 C, 18 F, 19 F, 31 P, 32 P, 35 S, 131 1, 125 I, 123 1, 64 Cu, 187 Re, In, 90 Y, 99m Tc and 177 Lu.
- Types of detectable cancer include, but are not limited to, lung cancer, bone cancer, liver cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, chronic or acute leukemia, lymphocytic lymphomas, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, neoplasms of the central
- Figure 1 depicts the effect of temodar in combination with chlorotoxin in vitro.
- D54 glioma cells were incubated with saline alone (control), temodar alone, temodar plus chlorotoxin, or pretreated with chlorotoxin twenty-four hours prior to temodar treatment.
- Figure 2 depicts the effect of chlorotoxin on temodar efficacy in vivo.
- Nude mice with established U251 glioma flank tumors were treated with saline alone (control), temodar alone, or temodar plus chlorotoxin.
- Figure 3 depicts the effect of chlorotoxin pretreatment on hydroxyurea efficacy in vivo.
- Nude mice with established D54 glioma flank tumors were treated with saline alone (control), hydroxyurea alone, or chlorotoxin plus hydroxyurea.
- Figure 4 depicts a cytotoxicity assay in which low concentrations of chlorotoxin are shown to inhibit the growth and proliferation of glioblastoma cells.
- Figure 5 depicts the effect of four day incubation and wash-out on the ability of chlorotoxin to inhibit abnormal cell growth.
- Figure 6 depicts a cytotoxicity assay in which low concentrations of chlorotoxin are shown to inhibit the growth and proliferation of prostate cancer cells.
- Figure 7 depicts an in vivo assay of the ability of chlorotoxin to inhibit the growth of glioblastoma tumor cells in athymic nude mice.
- Figure 8 depicts an in vivo assay of the ability of chlorotoxin to enhance survival of athymic nude mice with intracranial glioblastoma tumors. Cessation of intravenous treatment indicated by arrow.
- Figure 9 depicts an in vivo assay of the ability of chlorotoxin to inhibit growth of glioblastoma tumors in the flanks of athymic nude mice.
- Figure 10 depicts a series of overlapping 10-mer peptides derived from chlorotoxin. Cysteine residues of SEQ ID NO: 1 are replaced in the 10-mers with serine to prevent cross- linking of peptides.
- Figure 11 depicts binding of chlorotoxin and 10-mer peptides 1-15.
- Figure 12 depicts binding of chlorotoxin and 10-mer peptides 16-27, 1, 5 and 10.
- Figure 13 depicts binding of peptide 21, the native core 9-mer, and each alanine- substituted 9-mer peptide to both U251 and PC3 cells.
- Figure 14 depicts binding of short scorpion toxins in PC3 human prostate cancer cells.
- Figure 15 depicts the effect of peptide 21 on the proliferation of D54MG cells was studied by adding increasing doses of peptide 21 to the cells and then measuring the uptake of 3 H-thymidine.
- the invention includes compositions and methods for killing a cancer cell by first administering to a cancer cell chlorotoxin in combination with a chemotherapeutic agent.
- the present invention includes a method of retarding the growth of a tumor by administering chlorotoxin to tumor simultaneously with the chemotherapeutic agent.
- the invention includes compositions and methods for killing a cancer cell or retarding the growth of a tumor by first administering chlorotoxin (or a chlorotoxin derivative) and subsequently administering a chemotherapeutic agent.
- the present invention also includes a method of killing a cancer cell or retarding the growth of a tumor by first administering a chemotherapeutic agent and subsequently administering chlorotoxin (or a chlorotoxin derivative).
- a chemotherapeutic agent or a chlorotoxin derivative
- the prior, simultaneous or subsequent administration of chlorotoxin or a derivative thereof may also have the effect of reducing the amount of chemotherapeutic agent necessary for successful treatment thus reducing the severe side effects associated with chemotherapeutic agents.
- This invention includes a pharmaceutical composition for the treatment of abnormal cell growth in a mammal, including a human, comprising an amount of chlorotoxin or a chlorotoxin derivative, in combination with an chemotherapeutic agent, that is effective in enhancing the effects of the chemotherapeutic agent in inhibiting abnormal cell growth (i.e., acts as an adjuvant for the chemotherapeutic agent) and a pharmaceutically acceptable carrier.
- an chemotherapeutic agent that is effective in enhancing the effects of the chemotherapeutic agent in inhibiting abnormal cell growth (i.e., acts as an adjuvant for the chemotherapeutic agent) and a pharmaceutically acceptable carrier.
- abnormal gell growth refers to cell growth that is independent of normal regulatory mechanisms (e.g., loss of contact inhibition). This includes the abnormal growth and/or proliferation of cells in both benign and malignant cells of neoplastic diseases.
- Chemotherapeutic-dependent inhibition of abnormal cell growth can occur by a variety of mechanisms including, but not limited to, cell death
- the abnormal cell growth is cancer.
- cancer refers to diseases that are characterized by uncontrolled, abnormal cell growth and/or proliferation.
- Types of cancer where the composition is useful include, but are not limited to, lung cancer, bone cancer, liver cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgldn's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis
- said abnormal cell growth is a benign proliferative disease, including, but not limited to, benign prostatic hyperplasia, hypertrophy or restinosis.
- the invention includes a pharmaceutical composition for the treatment of abnormal cell growth in a mammal, including a human, which comprises an amount of a chlorotoxin, as defined above, in combination with at least one chemotherapeutic agent and a pharmaceutically acceptable carrier.
- chemotherapeutic agent refers to any agent used in the treatment of cancer which inhibits, disrupts, prevents or interferes with abnormal cell growth and/or proliferation.
- chemotherapeutic agents include, but are not limited to, alkylating agents, purine antagonists, pyrimidine antagonists, plant alkaloids, intercalating antibiotics, aromatase inhibitors, anti-metabolites, mitotic inhibitors, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, steroid hormones and anti- androgens.
- chlorotoxin or a derivative thereof can be combined with a single species of chemotherapeutic agent while in other embodiments, chlorotoxin can be combined with multiple species of chemotherapeutic agents.
- alkylating agents include, but are not limited to, carmustine, lomustine, cyclophosphamide, ifosfamide, mechlorethamine and streptozotocin.
- antibiotics include, but are not limited to, bleomycin, dactinomycin, daunorubicin, doxorubicin, idarubicin and plicamycin.
- anti-metabolites include, but are not limited to, cytarabine, fludarabine, 5 -fluorouracil, 6-mercaptopurine, methotrexate and 6-thioguanine.
- mitotic inhibitors include, but are not limited to, navelbine, paclitaxel, vinblastine and vincristine.
- steroid hormones and anti-androgens include, but are not limited to, aminoglutethimides, estrogens, flutamide, goserelin, leuprolide, prednisone and tamoxifen.
- the invention includes a population of conjugate molecules, said conjugate molecules comprising at least one chlorotoxin peptide or a derivative thereof and at least one chemotherapeutic agent, wherein the extent of conjugation of chlorotoxin and the chemotherapeutic agent is such that the effect of the chemotherapeutic agent in a mammal receiving the conjugate may be enhanced when compared to mixtures of the chemotherapeutic agent with chlorotoxin, or the chemotherapeutic agent alone.
- the invention includes compositions comprising a population of conjugate molecules wherein at least one chlorotoxin peptide or derivative thereof is conjugated to at least one chemotherapeutic agent and a pharmaceutically acceptable excipient.
- chlorotoxin or a derivative thereof can be conjugated to a single species of chemotherapeutic agent while in other embodiments, chlorotoxin can be conjugated to multiple species of chemotherapeutic agents.
- chlorotoxin refers to the full- length, thirty-six amino acid polypeptide naturally derived from Leiurus quinquestriatus scorpion venom (DeBin et al. (1993) Am. J. Physiol. 264, C361-369) which comprises the amino acid sequence of native chlorotoxin as set forth in SEQ ID NO: 1.
- chlorotoxin includes polypeptides comprising SEQ ID NO: 1 which have been synthetically or recombinantly produced, such as those disclosed in U.S. Patent 6,319,891, which is herein incorporated by reference in its entirety.
- chlorotoxin subunit or “subunit of chlorotoxin” refers to a peptide comprising less than thirty-six contiguous amino acids of chlorotoxin and which is capable of specifically binding to cancer cells.
- chlorotoxin derivative refers to derivatives, analogs, variants, polypeptide fragments and mimetics of chlorotoxin and related peptides which retain the same activity as chlorotoxin, such as binding specifically binding to a cancer cell when compared to a normal cell, can also be used for practicing the methods of the invention.
- derivatives include, but are not limited to, peptide variants of chlorotoxin, peptide fragments of chlorotoxin, for example, fragments comprising or consisting of contiguous 10-mer peptides of SEQ ID NO: 1, 2, 3, 4, 5, 6 or 7 or comprising about residues 10-18 or 21-30 of SEQ ID NO: 1, core binding sequences, and peptide mimetics.
- Chlorotoxin and peptide derivatives thereof can be prepared using standard solid phase (or solution phase) peptide synthesis methods, as is known in the art.
- the nucleic acids encoding these peptides may be synthesized using commercially available oligonucleotide synthesis instrumentation and produced recombinantly using standard recombinant production systems. The production using solid phase peptide synthesis is necessitated if non-gene-encoded amino acids are to be included.
- chlorotoxin derivative as used herein is synonymous with “variant” also includes modifications to the chlorotoxin sequence by one or more deletions of up to 10 (e.g., 1 to 7 or 1 to 5 amino acids; insertions of a total of up to 10 (e.g., 1 to 5) amino acids internally within the amino acid sequence of chlorotoxin; or of up to a total of 100 amino acids at either terminus of the chlorotoxin sequence; or conservative substitutions of a total of up to 15 (e.g., 1 to 5) amino acids.
- Derivatives of chlorotoxin include polypeptides comprising a conservative or non- conservative substitution of at least one amino acid residue when the derivative sequence and the chlorotoxin sequence are maximally aligned.
- the substitution may be one which enhances at least one property or function of chlorotoxin, inhibits at least one property or function of chlorotoxin, or is neutral to at least one property or function of chlorotoxin.
- a "property or function" of chlorotoxin includes, but is not limited to, at least one selected from the group consisting of the ability to arrest abnormal cell growth, cause paralysis of a subject, specific binding to a benign or malignant cancer cell when compared to a non-cancer cell (i.e., normal), and killing of a benign or malignant cancer cell.
- the cancer cell may be in vivo, ex vivo, in vitro, a primary isolate from a subject, a cultured cell or a cell line.
- Derivatives of chlorotoxin further include polypeptides comprising the amino acid sequence KGRGKSY (SEQ ID NO: 8), corresponding to amino acid residues 23-29 of SEQ ID NO: 1.
- Derivatives of chlorotoxin also include polypeptides comprising the amino acid sequence TTX 1 X 2 X 3 MX 4 X 5 K (SEQ ID NO: 13) corresponding to amino acid residues 7-15 of SEQ ID NO: 1, wherein Xi is an acidic amino acid selected from the group consisting of aspartic acid and glutamic acid;
- X 2 is an amino acid selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, proline, methionine, phenylalanine, serine, threonine, tryptophan, tyrosine and valine
- Peptide variants of chlorotoxin include, but are not limited to, deletion or conservative amino acid substitution variants of SEQ ID NO: 1.
- a conservative variant refers to alterations in the amino acid sequence that do not adversely substantially affect the biological functions of the peptide.
- a substitution, insertion or deletion is said to adversely affect the peptide when the altered sequence substantially prevents or disrupts a biological function associated with the peptide (e.g., binding to a cancer cell).
- the overall charge, structure or hydrophobic/1-ydrophilic properties of the peptide can be altered without adversely affecting a biological activity.
- the amino acid sequence can be altered, for example to render the peptide more hydrophobic or hydrophilic, without adversely affecting the biological activities of the peptide.
- the methods of the invention include corresponding polypeptide toxins of other scorpion species that display similar or related activity to chlorotoxin for the diagnosis and treatment of diseases associated with abnormal cell proliferation as described herein, including cancer.
- similar or related activity to chlorotoxin is defined as binding to cells displaying abnormal cell growth, including benign cells exhibiting abnormal growth and malignant cancer cells.
- polypeptide toxins include, but are not limited to, toxins which contain one or more of the binding domains of chlorotoxin set forth in SEQ ID NO: 8 or SEQ ID NO: 13, and any of the consensus sequences set forth in Table 1.
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR Small Toxin (SEQ ID NO 15) RCKPCFTTUPQMSKKCADCCGGKGKGKCYGPQCLC- Consensus (SEQ ID NO 16) C PCFTTD QMAKKC DCCGGKGKGKCYGPQCLC
- Chlorotoxin (SEQ ID NO 1 ) MCMPCFTTDHQ ARKCDDCCGG GRGKCYGPQCLCR--
- Toxin LQH (SEQ ID NO 17 )
- RCSPCFTTDQQMTK CYnCCGGRGKGKCYGPQCICAPY Consensus (SEQ ID NO 18)
- C PCFTTD QM KKC DCCGGKGKGKCYGPQCIC
- Chlorotoxin SEQ ID NO 1
- Chlorotoxin (SEQ ID NO ]_ j M C MP C FTT DHQ
- Chlorotoxin (SEQ ID NO 1 ) ARKCDDCCGGKGRGKCYGPQCLCR
- Insect toxin 15 (lesser Asian Scorpion) - Mesobuthus eupeus
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLGR- toxin 15 (SEQ ID NO 23) MCMPCFTTDPNM ⁇ NKCRDCCGG-tiK-KCFGPQCLCNR
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR toxin 15 (SEQ ID NO 25) MCMPC TT PNMANKCRDCCGGGKKCFGPQCLCNR-
- Insectotoxin II (lesser Asian Scorpion) - Mesobuthus eupeus
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR— toxin II (SEQ ID NO 27 ) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR— toxin II (SEQ ID NO 27 ) MCMPCFTTRPDMAQQCRACCK —RGKCFGPQCLCGYD Consensus (SEQ ID NO 28) MCMPCFTT MA C CC G RGKCFGPQCLC
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQM ⁇ RKCDDCCGGKGRGKCYGPQCLCR toxin II (SEQ ID NO 29) MCMPCFTTRPDMAQQCRACCKGRGKCFGPQCLCGYD Consensus (SEQ ID NO 30) MCMPCFTT MA C CC GKGK C
- Insectotoxin 15A (lesser Asian Scorpion) - Mesobuthus eupeus
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR- toxin 15A (SEQ ID NO 31) MCMPCFTTDPNMAKKCRDCCGGNG—KCFGPQCLCNR
- Chlorotoxin (SEQ ID NO 1) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR toxin 15A (SEQ ID NO 3333)) MCMPCFTTDPNMAKKCRDCCGGNGKCFGPQCLCNR-
- Neurotoxin P2 Muscle scorpion
- Chlorotoxin (SEQ ID NO 1 ) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-- Neurotoxin (SEQ ID NO 35 ) -CGPCFTTDPYTESKCATCCGG—RGKCVGPQCLCNRI Consensus (SEQ ID NO 36) C PCFTTD KC CCGG RGKC GPQCLC
- Chlorotoxin (SEQ ID NO 1) CYGPQCLCR— Small Toxin (SEQ ID NO 15) CYGPQCLC Toxin LQH (SEQ ID NO 17) CYGPQCICAPY Chinese (SEQ ID NO 19) CFGPQCLCNRI toxin 15 (SEQ ID NO 25) CFGPQCLCNR- toxin II (SEQ ID NO 29) CFGPQCLCGYD toxin 15A (SEQ ID NO 33) CFGPQCLCNR- Neurotoxin (SEQ ID NO 37) CVGPQCLpNRI Consensus (SEQ ID NO 39) CFGPQCLCNR
- Chlorotoxin (SEQ ID NO 1) MCMPCF TDHQMARKCDDCCGGKGRGKCYGPQCLCR—
- Toxin LQH (SEQ ID NO 17 RCSPCFTTDQQMTKKCYDCCGGKGKGKCYGPQCICAPY
- Chlorotoxin (SEQ ID NO 1) CYGPQCLCR CT-Neurotox (SEQ ID NO 19) GPQCLCNRI toxin 15 (SEQ ID NO 25) GPQCLCNR- toxin II (SEQ ID NO 29) GPQCLCGYD toxin 15A (SEQ ID NO 33) GPQCLCNR- Neurotoxin (SEQ ID NO 37) GPQCLCNRI Consensus (SEQ ID NO 41) GPQCLCNR
- Pep8-Ctlx (SEQ ID NO 42) CGGKGRGKCY Pep8-SCX1_BUTSI (SEQ ID NO 43) €GGKGKGKCY
- Pep21-SCX1_BUTSI (SEQ ID NO 62) TTDPQMSKKG
- Pep21-SCXP_ANDMA (SEQ ID NO 74) TTDPYTESKC
- related scorpion toxin refers to any of the toxins or related peptides, such as those disclosed in Table 1, displaying amino acid and/or nucleotide sequence identity to chlorotoxin.
- related scorpion toxins include, but are not limited to, CT neurotoxin from Mesobuthus martensii (GenBank Accession AAD47373), Neurotoxin BmK 41-2 from Buthus martensii karsch (GenBank Accession A59356), Neurotoxin Bml2-b from Buthus martensii (GenBank Accession AAK16444), Probable Toxin LQH 8/6 from Leiurus quinquestriatus hebraeu (GenBank Accession P55966), Small toxin from Mesobuthus tamulus Sindicus (GenBank Accession PI 5229), the sequences of which are all herein incorporated by reference in their entirety.
- BLAST Basic Local Alignment Search Tool
- blastp, blastn, blastx, tblastn and tblastx Altschul et al. (1997) Nucleic Acids Res. 25, 3389-3402 and Karlin et al. (1990) Proc. Natl. Acad. Sci. USA 87, 2264-2268, both fully incorporated by reference
- the approach used by the BLAST program is to first consider similar segments, with gaps (non-contiguous) and without gaps (contiguous), between a query sequence and a database sequence, then to evaluate the statistical significance of all matches that are identified and finally to summarize only those matches which satisfy a preselected threshold of significance.
- search parameters for histogram, descriptions, alignments, expect i.e., the statistical significance tlireshold for reporting matches against database sequences
- cutoff, matrix and filter low complexity
- the default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al (1992) Proc. Natl. Acad. Sci. USA 89, 10915-10919, fully incorporated by reference), recommended for query sequences over eighty-five nucleotides or amino acids in length.
- the scoring matrix is set by the ratios of M (i.e., the reward score for a pair of matching residues) to N (i.e., the penalty score for mismatching residues), wherein the default values for M and N are +5 and -4, respectively.
- the present invention encompasses the allelic variants, conservative substitution variants, and the members of the scorpion toxin peptide family, having an amino acid sequence of at least about seventy-five percent, at least about eighty-five percent, at least about ninety percent sequence, at least about ninety-five percent, or at least about ninety-nine percent sequence identity with the entire chlorotoxin sequence set forth in SEQ ID NO: 1. Identity or homology with respect to such sequences is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the known peptides, after alignment the sequences.
- Fusion proteins or N-terminal, C-terminal or internal extensions, deletions, or insertions into the peptide sequence shall not be construed as affecting homology.
- extensions include, but are not limited to, the following sequences:
- the chlorotoxin peptide variants include peptides having a fragment of the amino acid sequence set forth in SEQ ID NO: 1, having at least about 7, 8, 9, 10, 15, 20, 25, 30, or 35 contiguous amino acid residues.
- the peptide variants further include those fragments associated with the activity of chlorotoxin.
- Such fragments also referred to as polypeptides, may contain functional regions of the chlorotoxin peptide identified as regions of the amino acid sequence which correspond to Icnown peptide domains, as well as regions of pronounced hydrophilicity.
- Variants may also include peptide with at least two core sequences linked to one another, in any order, with intervening amino acids removed or replaced by a linker sequence. The regions are all easily identifiable by using commonly available protein sequence analysis software such as Mac Vector (Oxford Molecular).
- Contemplated peptide variants further include those containing predetermined mutations by, e.g., homologous recombination, site-directed or PCR mutagenesis, and the alleles or other naturally occurring variants of the family of peptides; and derivatives wherein the peptide has been covalently modified by substitution, chemical, enzymatic or other appropriate means with a moiety other than a naturally occurring amino acid (for example a detectable moiety such as an enzyme or radioisotope).
- Examples of chlorotoxin variant peptides include, but are not limited to the following sequences: MCMPCFTTDHQMARKCDDCCGGKGRGKCFGPQCLCR ( SEQ ID NO : 5 ) ,
- RCKPCFTTDPQMSKKCADCCGGKGKGKCYGPQCLC SEQ ID NO : 6
- RCSPCFTTDQQMTKKCYDCCGGKGKGKCYGPQCICAPY SEQ ID NO : 7 .
- the present invention includes peptide mimetics that mimic the three-dimensional structure of chlorotoxin.
- peptide mimetics may have significant advantages over naturally occurring peptides including, for example, more economical production, greater chemical stability, enhanced pharmacological properties (half-life, absorption, potency, efficacy, etc.), altered specificity (e.g., a broad-spectrum of biological activities), reduced antigenicity and others.
- mimetics are peptide-containing molecules that mimic elements of chlorotoxin peptide secondary structure.
- the underlying rationale behind the use of peptide mimetics is that the peptide backbone of proteins exists chiefly to orient amino acid side chains in such a way as to facilitate molecular interactions, such as those of antibody and antigen.
- a peptide mimetic is expected to permit molecular interactions similar to the natural molecule.
- peptide analogs are commonly used in the pharmaceutical industry as non-peptide drugs with properties analogous to those of the template peptide. These types of non-peptide compounds are also referred to as peptide mimetics or peptidomimetics (Fauchere (1986) Adv. Drug Res.
- Peptide mimetics that are structurally similar to therapeutically useful peptides may be used to produce an equivalent therapeutic or prophylactic effect.
- peptide mimetics are structurally similar to a paradigm polypeptide (i.e., a polypeptide that has a biochemical property or pharmacological activity), but have one or more peptide linkages optionally replaced by a linkage by methods known in the art.
- Labeling of peptide mimetics usually involves covalent attachment of one or more labels, directly or through a spacer (e.g., an amide group), to non-interfering positions on the peptide mimetic that are predicted by quantitative structure-activity data and molecular modeling.
- Such non-interfering positions generally are positions that do not form direct contacts with the macromolecules to which the peptide mimetic binds to produce the therapeutic effect.
- Derivitization (e.g., labeling) of peptide mimetics should not substantially interfere with the desired biological or pharmacological activity of the peptide mimetic.
- peptide mimetics can be enhanced through the use of combinatorial chemistry to create drug libraries.
- the design of peptide mimetics can be aided by identifying amino acid mutations that increase or decrease binding of a peptide to, for instance, a tumor cell.
- Approaches that can be used include the yeast two hybrid method (see Chien et al. (1991) Proc. Natl. Acad. Sci. USA 88, 9578-9582) and using the phage display method. The two hybrid method detects protein-protein interactions in yeast (Fields et al. (1989) Nature 340, 245-246).
- the phage display method detects the interaction between an immobilized protein and a protein that is expressed on the surface of phages such as lambda and M13 (Amberg et al. (1993) Strategies 6, 2-4; Hogrefe et al. (1993) Gene 128, 119-126). These methods allow positive and negative selection for peptide-protein interactions and the identification of the sequences that determine these interactions.
- compositions of the present invention can be adixdissered via parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal or buccal routes.
- an agent may be administered locally to a tumor via microinfusion.
- administration may be by the oral route.
- chlorotoxin or a derivative thereof could be administered locally to the site of a tumor, followed by oral administration of at least one chemotherapeutic agent.
- the prior administration of chlorotoxin may have the effect of reducing the amount of chemotherapeutic agent necessary for successful treatment thus reducing the severe side effects associated with chemotherapeutic agents.
- the dosage administered will be dependent upon the age, health, and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.
- the present invention further includes compositions containing chlorotoxin or derivatives thereof and one or more chemotherapeutic agents that are useful in the treatment of cancer. While individual needs vary, determination of optimal ranges of effective amounts of each component is within the skill of the art.
- Typical dosages comprise 1.0 pg/kg body weight to 100 mg/kg body weight.
- the preferred dosages for systemic administration comprise 100.0 ng/kg body weight to 10.0 mg/kg body weight.
- the preferred dosages for direct administration to a site via microinfusion comprise 1 ng/kg body weight to 1 mg/kg body weight.
- compositions of the present invention may contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries that facilitate processing of the active compounds into preparations which can be used pharmaceutically-for delivery to the site of action.
- suitable formulations for parenteral administration include aqueous solutions of the active compounds in water- soluble form, for example, water-soluble salts.
- suspensions of the active compounds as appropriate oily injection suspensions may be administered.
- Suitable lipophilic solvents or vehicles include fatty oils, for example, sesame oil or synthetic fatty acid esters, for example, ethyl oleate or triglycerides.
- Aqueous injection suspensions may contain substances which increase the viscosity of the suspension include, for example, sodium carboxymethyl cellulose, sorbitol and dextran.
- the suspension may also contain stabilizers. Liposomes can also be used to encapsulate the agent for delivery into the cell.
- the pharmaceutical formulation for systemic administration according to the invention may be formulated for enteral, parenteral or topical administration. Indeed, all three types of formulations may be used simultaneously to achieve systemic administration of the active ingredient.
- topical administration may be used. Any common topical formulation such as a solution, suspension, gel, ointment or salve and the like may be employed. Preparation of such topical formulations are described in the art of pharmaceutical formulations as exemplified, for example, by Gennaro et al. (1995) Remington's Pharmaceutical Sciences, Mack Publishing.
- the compositions could also be administered as a powder or spray, particularly in aerosol form.
- the compositions of this invention may be administered by inhalation.
- the active ingredients may be in a solution useful for administration by metered dose inhalers or in a form suitable for a dry powder inhaler.
- the compositions are suitable for administration by bronchial lavage.
- Suitable formulations for oral administration include hard or soft gelatin capsules, pills, tablets, including coated tablets, elixirs, suspensions, syrups or inhalations and controlled release forms thereof.
- the pharmaceutical composition comprises chlorotoxin or derivatives thereof in combination with at least one sustained release form of chemotherapeutic agent.
- chlorotoxin or derivatives thereof will be distributed throughout the body, prior to release of the chemotherapeutic agents, allowing for binding of chlorotoxin to the cancer cells prior to binding of the chemotherapeutic agent to the cancer cells.
- the effects of the chemotherapeutic agent may be enhanced by the earlier binding of chlorotoxin to the cancer cells.
- Such delayed release formulations may have the same effect as sequential administration of chlorotoxin followed by one or more chemotherapeutic agents.
- the invention also includes isotopically-labeled chlorotoxin or derivatives thereof, that have one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature.
- isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, fluorine, phosphorous, iodine, copper, rhenium, indium, yttrium, technecium and lutetium (i.e., 3 H, 14 C, 18 F, 19 F, 31 P, 32 P, 35 S, 131 1, 125 1, 123 1, 64 Cu, 187 Re, U1 ln, 90 Y, 99ra Tc, 177 Lu).
- isotopes which are metals (e.g., copper, rhenium, indium, yttrium, technecium and lutectium) are non-covalently attached to the chlorotoxin or derivatives thereof by chelation.
- chelation included in the invention are chelation of a metal isotope to a polyHis region fused to chlorotoxin or a derivative thereof.
- Non-metal isotopes may be covalently attached to chlorotoxin or derivatives thereof using any means acceptable.
- the invention also includes chlorotoxin or derivatives thereof labeled with a metal such as gadolinium (Gd).
- a metal such as gadolinium is covalently attached to chlorotoxin or derivative thereof by chelation.
- chelation included in the invention are chelation of a metal such as gadolinium to a polyHis region fused to chlorotoxin or a derivative thereof.
- Labeled chlorotoxin and derivatives thereof provided by this invention are also useful as radiotracers for positron emission tomography (PET) imaging or for single photon emission computerized tomography (SPECT).
- PET positron emission tomography
- SPECT single photon emission computerized tomography
- Agents of the present invention, prodrugs thereof, and pharmaceutically acceptable salts of said agents or of said prodrugs which contain the aforementioned isotopes and/or other isotopes of other atoms are within the scope of this invention.
- Trititium and carbon-14 isotopes are particularly preferred for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium can afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements and, hence, may be preferred in some circumstances.
- This invention also includes methods for the treatment of abnormal cell growth in a mammal, including a human, comprising administering to said mammal an amount of chlorotoxin or derivative thereof, or a pharmaceutical composition comprising an amount of chlorotoxin or a derivative thereof, that is effective in enhancing the effect of a chemotherapeutic agent (i.e., acts as an adjuvant for the chemotherapeutic agent) when administered prior to, or subsequent to, a chemotherapeutic agent.
- a chemotherapeutic agent i.e., acts as an adjuvant for the chemotherapeutic agent
- the abnormal cell growth is cancer, including, but not limited to, lung cancer, bone cancer, liver cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgldn's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, chronic or acute leukemia, lymphocytic lymphomas, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis,
- said abnormal cell growth is a benign proliferative disease, including, but not limited to, psoriasis, benign prostate hyperplasia, hypertrophy or restinosis.
- This invention also includes methods for the treatment of abnormal cell growth in a mammal which comprises administering to said mammal, including a human, a pharmaceutical composition comprising amount of chlorotoxin or a chlorotoxin derivative and one or more chemotherapeutic agents, that is effective in enhancing the effects of the chemotherapeutic agent in inhibiting abnormal cell growth.
- This includes the abnormal growth and/or proliferation of cancer cells including benign and malignant cells of neoplastic diseases.
- Inhibition of abnormal cell growth can occur by a variety of mechanism including, but not limited to, cell death, apoptosis, inhibition of cell division, transcription, translation, transduction, etc.
- chlorotoxin and derivatives thereof can be provided in combination, or in sequential combination with other chemotherapeutic agents that are useful in the treatment of abnormal cell growth (e.g., cancer).
- two agents are said to be administered in combination when the two agents are administered simultaneously or are administered independently in a fashion such that the agents will act at the same time.
- chlorotoxin or chlorotoxin derivatives can be used in combination with one or more chemotherapeutic agents selected from the following types of chemotherapeutic agents including, but not limited to, mitotic inhibitors, alkylating agents, anti-metabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, anti-hormones, and anti-androgens.
- chemotherapeutic agents selected from the following types of chemotherapeutic agents including, but not limited to, mitotic inhibitors, alkylating agents, anti-metabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, anti-hormones, and anti-androgens.
- alkylating agents include, but are not limited to, carmustine, lomustine, cyclophosphamide, ifosfamide, mechlorethamine and streptozotocin.
- antibiotics include, but are not limited to, bleomycin, dactinomycin, daunorubicin, doxorubicin, idarubicin and plicamycin.
- anti-metabolites include, but are not limited to, cytarabine, fludarabine, 5 -fluorouracil, 6-mercaptopurine, methotrexate and 6-thioguanine.
- mitotic inhibitors include, but are not limited to, navelbine, paclitaxel, vinblastine and vincristine.
- steroid hormones and anti-androgens include, but are not limited to, aminoglutethimides, estrogens, flutamide, goserelin, leuprolide, prednisone and tamoxifen.
- Examples of pharmaceutical formulations of the above chemotherapeutic agents include, but are not limited to, BCNU (i.e., carmustine, l,3-bis(2-chloroethyl)-l-nitrosurea, BiCNU®), cisplatin (cis-platinum, cis-diamminedichloroplatinum, Platinol®), doxorubicin (hydroxyl daunorubicin, Adriamycin®), gemcytabine (difluorodeoxycytidine, Gemzar®), hyrdoxyurea (hyroxycarbamide, Hydrea®), paclitaxel (Taxol®), temozolomide (TMZ, Temodar®), topotecan (Hycamtin®), fluorouracil (5 -fluorouracil, 5-FU, Adrucil®), vincristine (VCR, Oncovin®) and vinblastine (Velbe® or Velban®).
- chlorotoxin or derivatives thereof may be used alone or in combination with other therapeutic or diagnostic agents.
- chlorotoxin or derivatives thereof may be co-administered along with other chemotherapeutic agents typically prescribed for various types of cancer according to generally accepted oncology medical practice.
- the compositions of this invention can be utilized in vivo, ordinarily in mammals, such as humans, sheep, horses, cattle, pigs, dogs, cats, rats and mice or in vitro. The invention is particularly useful in the treatment of human subjects.
- the invention includes a therapeutic method comprising administration of chlorotoxin or a derivative thereof in combination with radiation therapy for the treatment of diseases associated with abnormal cell growth, such as cancer.
- the therapy is designed to induce apoptosis (cell death) in cancer cells, although reducing the incidence or number of metastases, and reducing tumor size also are contemplated.
- Tumor cell resistance to radiotherapy agents represents a major problem in clinical oncology.
- combination therapy with chlorotoxin could be used on radiation resistant tumors to improve the efficacy of the radiation therapy.
- the invention includes a method of treating cancer comprising administering to a mammal with cancer an amount of chlorotoxin or a derivative thereof in combination with ionizing radiation, both in sufficient doses that, when combined, cancer cell death is induced.
- the presence of the chlorotoxin reduces the amount of radiation required to treat the cancer when compared to radiation treatment alone.
- Chlorotoxin or derivatives thereof can be provided prior to said radiation, after said radiation or concurrent with said radiation.
- Radioisotopes Radiation that causes DNA damage has been used extensively and includes what are commonly known as gamma-rays, X-rays (e.g., external beam radiation generated by a linear accelerator), and the directed delivery of radioisotopes to tumor cells. It is most likely that all of these factors effect a broad range of damage on DNA, on the precursors of DNA, on the replication and repair of DNA, and on the assembly and maintenance of chromosomes.
- X-rays e.g., external beam radiation generated by a linear accelerator
- radioisotopes to tumor cells. It is most likely that all of these factors effect a broad range of damage on DNA, on the precursors of DNA, on the replication and repair of DNA, and on the assembly and maintenance of chromosomes.
- treatment is usually given as one treatment per day. Occasionally two treatments per day will be given, where a day has been missed, or with certain cancer therapy indications.
- the standard dosing ranges from about 1.8 Gy to about 2.0 Gy per day,
- the invention includes diagnostic methods for the determination of the presence and location of abnormal cell growth in an organ or body area of a patient, hi one embodiment of this method, the abnormal cell growth is cancer, including, but not limited to, lung cancer, bone cancer, liver cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, chronic or acute leukemia, lymphocytic lymphomas
- the present methods comprise administration of a detectable quantity of a composition comprising a detectable amount of chlorotoxin or a derivative thereof to a patient.
- detectable amount refers to the amount of labeled chlorotoxin or derivative thereof administered to a patient that is sufficient to enable detection of binding of the labeled chlorotoxin or derivative thereof to one or more abnormal cells including malignant cancer cells in a tumor.
- imaging effective amount refers to the amount of the labeled chlorotoxin or derivative thereof administered to a patient that is sufficient to enable imaging of binding of the labeled chlorotoxin or derivative thereof to one or more abnormal cells including malignant cancer cells in a tumor.
- the invention employs isotopically-labeled chlorotoxin or derivatives thereof which, in conjunction with non-invasive neuroimaging techniques such as magnetic resonance spectroscopy (MRS) or imaging (MRI), or gamma imaging such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT), are used to identify and quantify abnormal cells in vivo including malignant cells in tumors.
- non-invasive neuroimaging techniques such as magnetic resonance spectroscopy (MRS) or imaging (MRI), or gamma imaging such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT)
- PET positron emission tomography
- SPECT single-photon emission computed tomography
- the radiation emitted from the tumor or area being examined is measured and expressed either as total binding, or as a ratio in which total binding in one tissue is normalized to (for example, divided by) the total binding in another tissue or the entire body of the same subject during the same in vivo imaging procedure.
- Total binding in vivo is defined as the entire signal detected in a tumor or tissue by an in vivo imaging technique without the need for correction by a second injection of an identical quantity of labeled compound along with a large excess of unlabeled, but otherwise chemically identical compound.
- the terms "subject” or "patient” refers to a mammal, preferably a human, and most preferably a human suspected of having abnormal cells, including malignant cells in a tumor.
- the type of detection instrument available is a major factor in selecting a given label.
- radioactive isotopes are particularly suitable for in vivo imaging in the methods of the present invention.
- the type of instrument used will guide the selection of the radioisotope.
- the radioisotope chosen must have a type of decay detectable by a given type of instrument.
- Another consideration relates to the half-life of the radioisotope. The half-life should be long enough so that it is still detectable at the time of maximum uptake by the target, but short enough so that the host does not sustain deleterious radiation.
- the isotopically-labeled chlorotoxin or derivative thereof can be detected using gamma imaging where emitted gamma irradiation of the appropriate wavelength is detected.
- gamma imaging include, but are not limited to, positron emission tomography (PET) imaging or for single photon emission computerized tomography (SPECT).
- PET positron emission tomography
- SPECT single photon emission computerized tomography
- the chosen radiolabel will lack a particulate emission, but will produce a large number of photons.
- the radiolabel will be a positron-emitting radioisotope which will be detected by the PET camera.
- chlorotoxin or derivatives thereof are made which are useful for in vivo detection and imaging of tumors. These compounds are to be used in conjunction with non-invasive neuroimaging techniques such as magnetic resonance spectroscopy (MRS) or imaging (MRI), positron emission tomography (PET), and single-photon emission computed tomography (SPECT).
- MRS magnetic resonance spectroscopy
- PET positron emission tomography
- SPECT single-photon emission computed tomography
- chlorotoxin or derivatives thereof may be labeled with any acceptable radioisotope described above by general organic chemistry techniques known to the art (see March (1992) Advanced Organic Chemistry: Reactions, Mechanisms & Structure, Wiley). Chlorotoxin and derivatives thereof also may be radiolabeled with isotopes of copper, fluorine, carbon, bromine, etc.
- Chlorotoxin and derivatives thereof also may be radiolabeled with acceptable isotopes such as iodine for SPECT by any of several techniques known to the art (see Kulkarni (1991) Int. J. Rad. Appl. Inst. 18, 647-648).
- chlorotoxin and derivatives thereof may be labeled with any suitable radioactive iodine isotope, such as, but not limited to 131 I or 123 I by iodination of a diazotized amino derivative directly via diazonium iodide (see Greenbaum (1936) Am. J. Pharm. 108, 17-18), or by conversion of the unstable diazotized amine to the stable triazene, or by conversion of a non-radioactive halogenated precursor to a stable tri-alkyl tin derivative which then can be converted to the iodo compound by several methods well known to the art (see Chumpradit et al. (1991) J. Med. Chem. 34, 877-878 and Zhuang et al. (1994) J. Med. Chem. 37, 1406-1407).
- any suitable radioactive iodine isotope such as, but not limited to 131 I or 123 I by iodination of a diazot
- Chlorotoxin and derivatives thereof also may be radiolabeled with known metal radiolabels, such as 64 Cu or 99m Tc. Modification of the substituents to introduce ligands that bind such metal ions can be effected without undue experimentation by one of ordinary skill in the radiolabeling art including covalent attachment to a polyHis region in a modified chlorotoxin peptide or derivative thereof.
- the metal radiolabeled chlorotoxin or derivatives thereof can then be used to detect and image tumors.
- the diagnostic methods of the present invention may use isotopes detectable by nuclear magnetic resonance spectroscopy for purposes of in vivo imaging and spectroscopy.
- Radioisotopes for purposes of this invention include beta-emitters, gamma-emitters, positron-emitters and x-ray emitters. These radioisotopes include, but are not limited to, 131 1, 123 1, 18 F, U C, 75 Br and 76 Br.
- Suitable stable isotopes for use in Magnetic Resonance Imaging (MRI) or Spectroscopy (MRS), according to this invention include, but are not limited to, 19 F and 13 C.
- Suitable radioisotopes for in vitro identification and quantification of abnormal cells including tumor cells, in a tissue biopsy or post-mortem tissue include 125 1, 14 C and 3 H.
- the preferred radiolabels are 64 Cu or 18 F for use in PET in vivo imaging, 123 I or 131 I for use in SPECT imaging in vivo, 19 F for MRS and MRI and 3 H or 14 C for in vitro methods.
- any conventional method for visualizing diagnostic probes can be utilized in accordance with this invention.
- the dosage of the isotopically-labeled chlorotoxin and derivatives thereof will vary depending on considerations such as age, condition, sex, and extent of disease in the patient, contraindications, if any, concomitant therapies and other variables, to be adjusted by the skilled artisan. Dosage can vary from 0.001 mg/kg to 1000 mg/kg, preferably 0.1 mg/kg to 100 mg/kg. Administration to the patient may be local or systemic and accomplished intravenous, intra-arterial, intra-thecal (via the spinal fluid), intra-cranial or the like. Administration may also be intra-dermal or intra-cavitary, depending upon the body site under examination.
- the area of the subject under investigation is examined by routine imaging techniques such as 1V--RS/MRI, SPECT, planar scintillation imaging, PET, and emerging imaging techniques, as well.
- routine imaging techniques such as 1V--RS/MRI, SPECT, planar scintillation imaging, PET, and emerging imaging techniques, as well.
- the exact protocol will necessarily vary depending upon factors specific to the patient, as noted above, and depending upon the body site under examination, method of administration and type of label used; the determination of specific procedures would be routine to the skilled artisan.
- the amount (total or specific binding) of the bound isotopically-labeled chlorotoxin or derivatives thereof is measured and compared (as a ratio) with the amount of isotopically-labeled chlorotoxin or derivatives thereof bound to the cerebellum of the patient. This ratio is then compared to the same ratio in age-matched normal brain.
- chemotherapeutic agent activity in vitro A tissue culture method was optimized to test the effects of various chemotherapeutic agents on multiple cancer cell lines (see Table 1).
- Cells were plated on 96-well microtiter tissue culture plates at a density of approximately 1000-2000 cells per well, depending on the specific cell line. Cells were allowed to adhere twenty-four hours in a 37°C, humidified cell culture incubator supplied with five percent carbon dioxide.
- cells were treated with decreasing concentrations of a specific cytotoxic compound for two to five days. Following treatment, the cytotoxic effect of the drug was quantified using the Cell Counting Kit-8 (CCK-8) (Dojindo Inc.) according to the manufacturer's instructions.
- Example 1 Effect of chlorotoxin on chemotherapeutic agent activity in vitro
- a concentration of the chemotherapeutic agent approaching the IC 50 but usually just below was used in each assay.
- Various amounts of chlorotoxin were then titrated in combination with a concentration of chemotherapeutic agent near or below its IC 50 and the effect of chlorotoxin on the cytotoxic effects of the chemotherapeutic agent measured two to three days following adminstration. Concentration of chlorotoxin employed in this assay ranged from micoromolar down to nanomolar concentrations.
- Hydroxyurea and temodar dosage was based on the lowest dosage (10 mg/kg body weight) used in previous studies to determine clearance from the body in the treatment of sickle cell disease paradigm in nude mice (Iyamu et al. (2001) Chemotherapy 47, 270-278).
- Nude mice were ear-tagged and given an identification number were inoculated with five million U251 glioma cells in 0.10 ml mixture with five percent methyl cellulose under light anesthesia according to standard operating procedures for flank tumor inoculations (Iyamu et al. (2001) Chemotherapy 47, 270-278). Flank tumors had developed and were established approximately thirty days following inoculation.
- mice with established flank tumors were each treated with 0.100 ml injection (i.p) of sterilized solutions consisting of either of saline, saline and hydroxyurea or temodar (13.2 mg/kg body weight), or saline, hydroxyurea or temodar (13.2 mg/kg) and chlorotoxin (0.080 mg/kg body weight).
- Tumor volume was calculated based on the measurements with the same set of calipers on the indicated days by determining the length x width x height of the tumor of non-anesthetized mice. As each animal had different-sized tumors at the beginning of the experiment, the data is presented in final form as percent change of the tumor growth from the initial date of the injection protocol.
- PET imaging studies with labled chlorotoxin The following illustrative procedure may be utilized when performing PET imaging studies on patients in the clinic.
- the patient is fasted for at least twelve hours allowing water intake ad libitum and is premedicated with 0.3-0.4 ml Acepromazine injected intra-muscular on the day of the experiment.
- a twenty-gauge, two inch intravenous catheter is inserted into the contra-lateral ulnar vein for administration of radiolabeled chlorotoxin.
- the patient is positioned in the PET camera and a tracer dose of [ 15 0]H 2 O is administered via the intravenous catheter.
- the image thus obtained is used to insure that the patient is positioned correctly to include complete imaging of the desired areas including the tumor.
- [ 64 Cu] radiolabeled chlorotoxin ( ⁇ 20 mCi) is administered via the intravenous catheter.
- an infusion is begun of the radiolabeled chlorotoxin which is evaluated at multiple dose rates (0.1, 1.0 or 10 mpk/day).
- the [ 64 Cu] radiolabeled chlorotoxin is again injected via the catheter. Images are again acquired for up to ninety minutes. Within ten minutes of the injection of radiotracer and at the end of the imaging session, 1.0 ml blood samples are obtained for determining the plasma concentration of the radiolabeled chlorotoxin.
- D54 glioblastoma cells were plated at a density of about 1000 cells/well in a 96-well flat bottom plate and incubated in 5% C0 2 at 37°C. After twenty-four hours chlorotoxin was added at 1:4 limiting dilutions to a final concentration of 20, 5, 1.25, 0.313, 0.078, 0.0195, 0.0049, 0.0012, 0.00031 or 0.00008 nM. Control cells received vehicle only. Twenty-four hours after treatment, the effect of chlorotoxin was quantified using the MTT mitochondrial enzyme substrate with the Cell Counting Kit-8 (CCK-8) (Dojindo Inc.) according to the manufacturer's instructions.
- CCK-8 Cell Counting Kit-8
- D54 glioblastoma cells were plated at a density of about 1000 cells/well in a 96-well flat bottom plate and incubated in 5% C0 2 at 37°C. After twenty-four hours chlorotoxin was added at 1:4 limiting dilutions to a final concentration (in nM) of 20, 5, 1.25, 0.313, 0.078, 0.02, 0.0049, 0.0012, 0.0003, or 0.00008. Control cells received vehicle only. After twenty- four hours, half of the cells were washed free of chlorotoxin, the medium replaced with fresh medium. Cells in both conditions, chlorotoxin left on and chlorotoxin removed, were incubated for an additional four days.
- PC3 prostate cancer cells were plated at a density of about 1000 cells/well in a 96- well flat bottom plate and incubated in 5% C0 2 at 37°C. After twenty-four hours chlorotoxin was added at 1:2 limiting dilutions to a final concentration (nM) of 20, 10, 5, 2.5, 1.25, 0.625, 0.313, 0.156, 0.078, and 0.039. Control cells received PBS vehicle only. Twenty-four hours after treatment, the effect of chlorotoxin was quantified using the MTT mitochondrial enzyme substrate with the CCK-8 as in Example 1. Figure 6 shows that chlorotoxin incubation inhibited proliferation of the D54 cells at all concentrations tested as evidenced by the lower number of viable cells/well versus PBS control
- mice received a subcutaneous injection of 5 x 10 7 human D54 glioblastoma cells in their right flank to produce human glioma flank xenografts in these mice.
- Animals in Groups II and III received 2 Gy 60 C whole-body irradiation at 15, 22, 29, 36, 43 and 50 days after D54 injection. Tumor size was measured three times weekly and is depicted in Figure 7.
- Example 9 Intracranial D54MG glioma xenografts were established in athymic nude mice by the implantation of 1 x 10 6 D54MG cells in the brain of each subject. A treatment regimen was begun 14 days post-implantation with tail vein intravenous injections two times per week. The control group of seven mice were administered saline vehicle only. A second group of mice, comprising eight animals, were each administered a low dose of chlorotoxin of 0.2 ⁇ g/dose and a third group of mice, comprising eight animals, were administered a high dose of chlorotoxin of 2.0 ⁇ g/dose. Animals were followed until death and survival time was plotted on a Kaplan-Meier chart, indicating median survival (Figure 8).
- Example 10 In a separate investigation, D54MG glioma xenografts were established peripherally by implanting 10 x 10 6 D54MG cells in the flanks of athymic nude mice. Tumors were palpable at 14 days, with individual tumor volumes of approximately 43 mm 3 . Again, the treatment regimen was begun 14 days post-implantation with tail vein intravenous injections two times per week. The control group of seven mice were administered saline vehicle only. A second group of mice, comprising eight animals, were each administered a low dose of chlorotoxin of 0.2 ⁇ g/dose. Tumor size was measured at the time of each injection, and plotted as a percent of original tumor size (Figure 9). Intravenous treatment was ended at 42 days and the measurement of the tumors was continued for several weeks. These results demonstrate that low-dose chlorotoxin alone can dramatically decrease the tumor growth in this flank model.
- Binding of the 10-mer peptides to PC3 prostate cancer cells in vitro was measured by incubating cultured PC3 cells with individual peptides. Binding was detected and quantified by incubating the peptide exposed cells with HRP-avidin using a commercial kit according to manufacturer's instructions.
- FIG 11 shows that the 10-mer peptide 4 of SEQ ID NO: 1 does not bind to PC3, indicating that the lysine residue which starts peptide 5 must be the start of the binding site. Peptides 5-8 bind, but the binding is lost in peptide 9. This suggests that the tyrosine residue is another key, since this is present in peptide 8 but lost in peptide 9. This indicated that a first binding region of chlorotoxin resides within the 7-mer sequence KGRGKSY (SEQ ID NO: 8) residing at amino acid residues 23-29 of SEQ ID NO: 1 which are common to peptides 5-8.
- Figure 12 shows that peptide 19 of SEQ ID NO: 1 does not bind PC3 cells but peptide 20 does, indicating that the threonine residue which starts peptide 20 may be the start of a second binding site because peptides 20-24 bind most strongly. Binding decreases again in peptide 25, suggesting that the peptide 24 terminal arginine residue is another key, since this is present in peptide 24 but lost in peptide 25. This indicates that a second binding region of chlorotoxin resides within the 9-mer sequence TDHQM-AR (SEQ ID NO: 9) residing at amino acid residues 8-14 of SEQ ID NO: 1 which are common to peptides 20-24.
- TDHQM-AR SEQ ID NO: 9-mer sequence
- the binding in this second core sequence is broader, which may be a reflection of very similar amino acids present at the ends of the region. For example, there are two threonine residues at peptides 20 and 21, and there is a lysine at the end of peptide 22 next to the arginine residue.
- chlorotoxin derivatives were each analyzed in the crayfish assay and compared to chlorotoxin (Table 4). Each of these derivatives comprises the putative end-amino acids, the T and the R within the sequence corresponding to peptide 21.
- Chlorotoxin is a 36-amino acid peptide with 8 cysteines, depicted below in bold type with the sequences of peptide number 8 (beta-region peptide) and peptide number 21 (alpha- region peptide) identified using the overlapping 10-mers in Example 12 underlined below:
- the entire peptides were synthesized as a 10-mer with a biotin at the amino terminus as well as shorter sequences reducing the size of the peptide by one amino acid at the amino terminus each time.
- beta peptide 8 the sequences of peptide 8 noted in Table 5 were evaluated and probed for binding to U251 glioma cells:
- alanine scan variants were synthesized by replacing each amino acid of the 9-mer peptide TDHQMARJKS (SEQ ID NO: 10) sequentially as depicted in Table 7.
- Peptide 21, the native core 9-mer, and each alanine-substituted 9-mer peptide was synthesized with a biotin at the amino terminus and evaluated for their binding versus both U251 and PC3 cells ( Figure 13).
- the pattern for U251 and PC3 binding are generally similar.
- Replacement of the aspartic acid (D) residue in the second position of the 9-mer increased binding of the peptide to cells and replacement of the Q residue in the fourth position produced a large increase of peptide binding to cells.
- the peptide TAHAMARKS (SEQ ID NO: 11) should be more active than the parent peptide TDHQMARKS (SEQ ID NO: 10). Based on the binding of the peptide TDHAMARKS, this binding may be equal to or greater than chlorotoxin itself.
- chlorotoxin exhibited significant binding in PC3 human prostate cancer cells (221.93%) of background levels) and peptide 21 binding paralleled that of chlorotoxin (232.50% of background levels).
- peptide 21 of small toxin peptide (21ST) and peptide 21 of probable toxin LQH- 8/6 (21LQ) demonstrated binding levels equivalent to that of full-length chlorotoxin and chlorotoxin peptide 21 (225.26% and 242.32%, respectively).
- a negative peptide containing amino acids 26-35 of chlorotoxin SEQ ID NO: 1 exhibited binding levels comparable to background (110%>). Similar results were obtained in D54 glioblastoma cells (data not shown).
- Example 16 The purpose of this experiment was to determine if the proliferation D54MG Glioblastoma cells, as measured by 3 H-thymidine uptake, is effected by Peptide 21, a segment of the full chlorotoxin sequence.
- the sequence of peptide 21 and its relation to chlorotoxin is shown in the sequence below: Chlorotoxin: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR Peptide 21: TTDHQMARK (SEQ ID NO: 82)
- Peptide 21 (SEQ ID NO: 82) has been identified in several other reports as having binding and biological activity comparable to the full length chlorotoxin.
- D54MG cells were plated in a 24 well plate at 100,000 cells/ml/well using five rows of four wells for each concentration. The cells were allowed to adhere in normal media for twenty-four hours at 37°C and 5% carbon dioxide.
- TM-701 was diluted to a 1 nM stock solution and added to each row at the concentrations of 0, 20, 80, 160 and 320 nM.
- the cells and peptide 21 were allowed to incubate for 24 hours at 37°C and 5% carbon dioxide. After twenty-four hours, the cells were rinsed two times with warm PBS.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Insects & Arthropods (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- General Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2003240496A AU2003240496B2 (en) | 2002-05-31 | 2003-06-02 | Combination chemotherapy with chlorotoxin |
| DE60331458T DE60331458D1 (de) | 2002-05-31 | 2003-06-02 | Kombinationschemotherapie mit chlorotoxin |
| EP03731504A EP1553962B1 (en) | 2002-05-31 | 2003-06-02 | Combination chemotherapy with chlorotoxin |
| US10/516,079 US20060088899A1 (en) | 2002-05-31 | 2003-06-02 | Combination chemotherapy with chlorotoxin |
| CA002487425A CA2487425A1 (en) | 2002-05-31 | 2003-06-02 | Combination chemotherapy with chlorotoxin |
| MXPA04011871A MXPA04011871A (es) | 2002-05-31 | 2003-06-02 | Quimioterapia en combinacion con clorotoxina. |
| AT03731504T ATE458751T1 (de) | 2002-05-31 | 2003-06-02 | Kombinationschemotherapie mit chlorotoxin |
| JP2004508829A JP2005537234A (ja) | 2002-05-31 | 2003-06-02 | クロロトキシンとの併用化学療法 |
| US12/756,162 US20100210546A1 (en) | 2002-05-31 | 2010-04-07 | Combination chemotherapy with chlorotoxin |
| US13/103,961 US20110311445A1 (en) | 2003-06-02 | 2011-05-09 | Diagnosis and treatment of myeloid and lymphoid cell cancers |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US38417102P | 2002-05-31 | 2002-05-31 | |
| US60/384,171 | 2002-05-31 | ||
| US40603302P | 2002-08-27 | 2002-08-27 | |
| US60/406,033 | 2002-08-27 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/756,162 Division US20100210546A1 (en) | 2002-05-31 | 2010-04-07 | Combination chemotherapy with chlorotoxin |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2003101474A1 true WO2003101474A1 (en) | 2003-12-11 |
Family
ID=29715313
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2003/017410 Ceased WO2003101474A1 (en) | 2002-05-31 | 2003-06-02 | Combination chemotherapy with chlorotoxin |
| PCT/US2003/017411 Ceased WO2003101475A1 (en) | 2002-05-31 | 2003-06-02 | Treatment of cell proliferative disorders with chlorotoxin |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2003/017411 Ceased WO2003101475A1 (en) | 2002-05-31 | 2003-06-02 | Treatment of cell proliferative disorders with chlorotoxin |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20060166892A1 (cg-RX-API-DMAC7.html) |
| EP (4) | EP2182004A1 (cg-RX-API-DMAC7.html) |
| JP (3) | JP2005537234A (cg-RX-API-DMAC7.html) |
| AT (1) | ATE458751T1 (cg-RX-API-DMAC7.html) |
| AU (2) | AU2003237347B2 (cg-RX-API-DMAC7.html) |
| CA (2) | CA2494451A1 (cg-RX-API-DMAC7.html) |
| DE (1) | DE60331458D1 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2341767T3 (cg-RX-API-DMAC7.html) |
| MX (1) | MXPA04011871A (cg-RX-API-DMAC7.html) |
| WO (2) | WO2003101474A1 (cg-RX-API-DMAC7.html) |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005099774A3 (en) * | 2004-04-06 | 2006-03-23 | Transmolecular Inc | Diagnosis and treatment of myeloid and lymphoid cell cancers |
| EP2029157A4 (en) * | 2006-05-19 | 2009-11-18 | Georgia Tech Res Inst | ABC TRANSPORTERLIGAND |
| US20100210546A1 (en) * | 2002-05-31 | 2010-08-19 | Transmolecular, Inc. | Combination chemotherapy with chlorotoxin |
| US20100215575A1 (en) * | 2007-10-12 | 2010-08-26 | Transmolecular, Inc. | Systemic Administration of Chlorotoxin Agents for the Diagnosis and Treatment of Tumors |
| EP2147927A3 (en) * | 2006-03-31 | 2010-09-01 | Transmolecular, Inc. | Use of 131i-tm-601 for the diagnosis and treatment of gliomas |
| US20110091380A1 (en) * | 2007-08-07 | 2011-04-21 | Transmolecular, Inc. | Chlorotoxins as drug carriers |
| WO2011097533A1 (en) | 2010-02-04 | 2011-08-11 | Transmolecular, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| WO2012136958A2 (en) | 2011-04-08 | 2012-10-11 | The University Court Of The University Of Edinburgh | Optical imaging probes |
| WO2013003507A1 (en) | 2011-06-27 | 2013-01-03 | Morphotek, Inc. | Multifunctional agents |
| US8778310B2 (en) | 2005-04-22 | 2014-07-15 | University Of Washington | Fluorescent chlorotoxin conjugate and method for intra-operative visualization of cancer |
| WO2015061592A1 (en) * | 2013-10-23 | 2015-04-30 | Merrimack Pharmaceuticals, Inc. | Liposomes for non-invasive imaging and drug delivery |
| US9023595B2 (en) | 2008-05-15 | 2015-05-05 | Morphotek, Inc. | Treatment of metastatic tumors |
| US9511155B2 (en) | 2012-04-17 | 2016-12-06 | Merrimack Pharmaceuticals, Inc. | Compositions and methods for non-invasive imaging |
| US9944683B2 (en) | 2010-05-11 | 2018-04-17 | Fred Hutchinson Cancer Research Center | Chlorotoxin variants, conjugates, and methods for their use |
| US10156559B2 (en) | 2012-12-10 | 2018-12-18 | Fred Hutchinson Cancer Research Center | Lipocalin fusion partners |
| US10478428B2 (en) | 2015-08-20 | 2019-11-19 | Ipsen Biopharm Ltd. | Combination therapy for cancer treatment |
| US10980795B2 (en) | 2012-06-13 | 2021-04-20 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies comprising liposomal irinotecan |
| US11071726B2 (en) | 2016-11-02 | 2021-07-27 | Ipsen Biopharm Ltd. | Treating gastric cancer using combination therapies comprising liposomal irinotecan, oxaliplatin, 5-fluorouracil (and leucovorin) |
| US11318131B2 (en) | 2015-05-18 | 2022-05-03 | Ipsen Biopharm Ltd. | Nanoliposomal irinotecan for use in treating small cell lung cancer |
| US11344552B2 (en) | 2015-08-21 | 2022-05-31 | Ipsen Biopharm Ltd. | Methods for treating metastatic pancreatic cancer using combination therapies comprising liposomal irinotecan and oxaliplatin |
| US11369597B2 (en) | 2012-06-13 | 2022-06-28 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies |
| US11559580B1 (en) | 2013-09-17 | 2023-01-24 | Blaze Bioscience, Inc. | Tissue-homing peptide conjugates and methods of use thereof |
| US11826399B2 (en) | 2017-09-15 | 2023-11-28 | Eisai Inc. | Chlorotoxin agents and uses thereof |
| US11866466B2 (en) | 2017-12-19 | 2024-01-09 | Blaze Bioscience, Inc. | Tumor homing and cell penetrating peptide-immuno-oncology agent complexes and methods of use thereof |
| US12048732B2 (en) | 2016-04-15 | 2024-07-30 | Blaze Bioscience, Inc. | Methods of treating breast cancer |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005053611A2 (en) * | 2003-11-26 | 2005-06-16 | Transmolecular, Inc. | Treatment of phosphatidylinositol phospholipid disorders |
| CN100590130C (zh) * | 2007-07-31 | 2010-02-17 | 厦门北大之路生物工程有限公司 | 抗癌活性肽 |
| CN102438646A (zh) * | 2008-05-15 | 2012-05-02 | 特兰斯莫莱库拉公司 | 转移性肿瘤的治疗 |
| WO2010086964A1 (ja) * | 2009-01-28 | 2010-08-05 | 株式会社 静岡カフェイン工業所 | がん治療のための併用療法 |
| CU24055B1 (es) * | 2010-09-27 | 2014-12-26 | Grupo Empresarial De Producciones Biofarmacéuticas Y Químicas Labiofam | Composiciones farmacéuticas de veneno de escorpión rhopalurus junceus |
| EP2986287A2 (en) * | 2013-04-18 | 2016-02-24 | Institut National de la Santé et de la Recherche Médicale (INSERM) | Methods and pharmaceutical compositions (ctps 1 inhibitors, e.g. norleucine) for inhibiting t cell proliferation in a subject in need thereof |
| US9522114B1 (en) * | 2014-03-27 | 2016-12-20 | University Of South Florida | Enhanced targeted drug delivery system via chitosan hydrogel and chlorotoxin |
| WO2017143259A1 (en) * | 2016-02-19 | 2017-08-24 | Dignity Health | Antibody fusion protein and related compositions for targeting cancer |
| KR101678393B1 (ko) | 2016-08-25 | 2016-12-06 | (주)넥스젠바이오텍 | 피부 세포 증식 효과가 증가한 전갈독 융합단백질 및 이를 유효성분으로 함유하는 피부 주름 개선, 피부 탄력 증대 및 항노화 화장료 조성물 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5905027A (en) * | 1995-12-27 | 1999-05-18 | Uab Research Foundation | Method of diagnosing and treating gliomas |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0491007B1 (en) * | 1989-09-08 | 1996-03-13 | The Johns Hopkins University | Structural alterations of the egf receptor gene in human gliomas |
| US5223253A (en) * | 1989-09-28 | 1993-06-29 | American Home Products Corporation | Bovine vaccine compositions and method for preventing trichomonas infections using same |
| US5750376A (en) * | 1991-07-08 | 1998-05-12 | Neurospheres Holdings Ltd. | In vitro growth and proliferation of genetically modified multipotent neural stem cells and their progeny |
| EP0922458A1 (en) * | 1993-01-14 | 1999-06-16 | Cancer Research Campaign Technology Limited | Potentiation of temozolomide by an ATase inhibitor |
| US5626862A (en) * | 1994-08-02 | 1997-05-06 | Massachusetts Institute Of Technology | Controlled local delivery of chemotherapeutic agents for treating solid tumors |
| US5756340A (en) * | 1995-05-08 | 1998-05-26 | The Regents Of The University Of California | Insect control with multiple toxins |
| JP3809502B2 (ja) * | 1995-05-30 | 2006-08-16 | 二郎 有川 | ハンタウィルス抗原蛋白質およびモノクローナル抗体 |
| JPH0971599A (ja) * | 1995-09-06 | 1997-03-18 | Nippon Seibutsu Kagaku Kenkyusho | 鶏貧血ウイルス(cav)感染鶏血清と高い反応性を示すポリペプチド及びこのポリペプチドに対する抗体、鶏貧血ウイルス感染の診断法及びワクチン |
| US6667156B2 (en) * | 1995-12-27 | 2003-12-23 | Uab Research Foundation | Diagnosis and treatment of neuroectodermal tumors |
| US6555652B1 (en) * | 1997-12-05 | 2003-04-29 | Kyogo Itoh | Tumor antigen peptide derivatives |
-
2003
- 2003-06-02 AU AU2003237347A patent/AU2003237347B2/en not_active Ceased
- 2003-06-02 EP EP09176234A patent/EP2182004A1/en not_active Withdrawn
- 2003-06-02 WO PCT/US2003/017410 patent/WO2003101474A1/en not_active Ceased
- 2003-06-02 AU AU2003240496A patent/AU2003240496B2/en not_active Expired
- 2003-06-02 WO PCT/US2003/017411 patent/WO2003101475A1/en not_active Ceased
- 2003-06-02 EP EP03731504A patent/EP1553962B1/en not_active Expired - Lifetime
- 2003-06-02 ES ES03731504T patent/ES2341767T3/es not_active Expired - Lifetime
- 2003-06-02 JP JP2004508829A patent/JP2005537234A/ja active Pending
- 2003-06-02 EP EP10178613A patent/EP2431385A3/en not_active Withdrawn
- 2003-06-02 EP EP03736810A patent/EP1539207A4/en not_active Withdrawn
- 2003-06-02 CA CA002494451A patent/CA2494451A1/en not_active Abandoned
- 2003-06-02 AT AT03731504T patent/ATE458751T1/de not_active IP Right Cessation
- 2003-06-02 MX MXPA04011871A patent/MXPA04011871A/es active IP Right Grant
- 2003-06-02 CA CA002487425A patent/CA2487425A1/en not_active Abandoned
- 2003-06-02 DE DE60331458T patent/DE60331458D1/de not_active Expired - Lifetime
- 2003-06-02 US US10/522,810 patent/US20060166892A1/en not_active Abandoned
-
2011
- 2011-03-09 JP JP2011052039A patent/JP5856744B2/ja not_active Expired - Lifetime
-
2015
- 2015-07-03 JP JP2015134259A patent/JP2015214562A/ja active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5905027A (en) * | 1995-12-27 | 1999-05-18 | Uab Research Foundation | Method of diagnosing and treating gliomas |
| US6028174A (en) * | 1995-12-27 | 2000-02-22 | Uab Research Foundation | Method of diagnosing and treating gliomas |
| US20020065216A1 (en) * | 1995-12-27 | 2002-05-30 | The Uab Research Foundation | Novel method of diagnosing and treating gliomas |
Cited By (45)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100210546A1 (en) * | 2002-05-31 | 2010-08-19 | Transmolecular, Inc. | Combination chemotherapy with chlorotoxin |
| JP2007532879A (ja) * | 2004-04-06 | 2007-11-15 | トランスモレキュラー, インコーポレイテッド | 骨髄およびリンパ系細胞癌の診断および処置 |
| WO2005099774A3 (en) * | 2004-04-06 | 2006-03-23 | Transmolecular Inc | Diagnosis and treatment of myeloid and lymphoid cell cancers |
| US8778310B2 (en) | 2005-04-22 | 2014-07-15 | University Of Washington | Fluorescent chlorotoxin conjugate and method for intra-operative visualization of cancer |
| EP2147927A3 (en) * | 2006-03-31 | 2010-09-01 | Transmolecular, Inc. | Use of 131i-tm-601 for the diagnosis and treatment of gliomas |
| EP2029157A4 (en) * | 2006-05-19 | 2009-11-18 | Georgia Tech Res Inst | ABC TRANSPORTERLIGAND |
| US20110091380A1 (en) * | 2007-08-07 | 2011-04-21 | Transmolecular, Inc. | Chlorotoxins as drug carriers |
| US20100215575A1 (en) * | 2007-10-12 | 2010-08-26 | Transmolecular, Inc. | Systemic Administration of Chlorotoxin Agents for the Diagnosis and Treatment of Tumors |
| US9603952B2 (en) | 2008-05-15 | 2017-03-28 | Morphotek, Inc. | Treatment of metastatic tumors |
| US9023595B2 (en) | 2008-05-15 | 2015-05-05 | Morphotek, Inc. | Treatment of metastatic tumors |
| JP2017031205A (ja) * | 2010-02-04 | 2017-02-09 | モルフォテック, インコーポレイテッド | クロロトキシンポリペプチドおよびコンジュゲートならびにその使用 |
| WO2011097533A1 (en) | 2010-02-04 | 2011-08-11 | Transmolecular, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| EP2531206A4 (en) * | 2010-02-04 | 2013-07-31 | Morphotek Inc | CHLOROTOXINPOLYPEPTIDES AND CONJUGATES AND USES THEREOF |
| JP2013518905A (ja) * | 2010-02-04 | 2013-05-23 | モルフォテック, インコーポレイテッド | クロロトキシンポリペプチドおよびコンジュゲートならびにその使用 |
| US9018347B2 (en) | 2010-02-04 | 2015-04-28 | Morphotek, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| EP3238735A1 (en) | 2010-02-04 | 2017-11-01 | Morphotek, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| CN102844044A (zh) * | 2010-02-04 | 2012-12-26 | 摩尔弗泰克有限公司 | 氯毒素多肽和结合物及其应用 |
| JP2015212307A (ja) * | 2010-02-04 | 2015-11-26 | モルフォテック, インコーポレイテッド | クロロトキシンポリペプチドおよびコンジュゲートならびにその使用 |
| US9234015B2 (en) | 2010-02-04 | 2016-01-12 | Morphotek, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| CN102844044B (zh) * | 2010-02-04 | 2016-10-26 | 摩尔弗泰克有限公司 | 氯毒素多肽和结合物及其应用 |
| US9637526B2 (en) | 2010-02-04 | 2017-05-02 | Morphotek, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| US10183975B2 (en) | 2010-02-04 | 2019-01-22 | Morphotek, Inc. | Chlorotoxin polypeptides and conjugates and uses thereof |
| US10822381B2 (en) | 2010-05-11 | 2020-11-03 | Fred Hutchinson Cancer Research Center | Chlorotoxin variants, conjugates, and methods for their use |
| US9944683B2 (en) | 2010-05-11 | 2018-04-17 | Fred Hutchinson Cancer Research Center | Chlorotoxin variants, conjugates, and methods for their use |
| WO2012136958A2 (en) | 2011-04-08 | 2012-10-11 | The University Court Of The University Of Edinburgh | Optical imaging probes |
| US9549997B2 (en) | 2011-04-08 | 2017-01-24 | The University Court Of The University Of Edinburgh | Optical imaging probes |
| US10434191B2 (en) | 2011-04-08 | 2019-10-08 | The University Court Of The University Of Edinburgh | Optical imaging probes |
| WO2013003507A1 (en) | 2011-06-27 | 2013-01-03 | Morphotek, Inc. | Multifunctional agents |
| US9968694B2 (en) | 2012-04-17 | 2018-05-15 | Merrimack Pharmaceuticals, Inc. | Compositions and methods for non-invasive imaging |
| US9511155B2 (en) | 2012-04-17 | 2016-12-06 | Merrimack Pharmaceuticals, Inc. | Compositions and methods for non-invasive imaging |
| US11369597B2 (en) | 2012-06-13 | 2022-06-28 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies |
| US10980795B2 (en) | 2012-06-13 | 2021-04-20 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies comprising liposomal irinotecan |
| US12364691B2 (en) | 2012-06-13 | 2025-07-22 | Ipsen Biopharm Ltd. | Methods for treating pancreatic cancer using combination therapies |
| US10156559B2 (en) | 2012-12-10 | 2018-12-18 | Fred Hutchinson Cancer Research Center | Lipocalin fusion partners |
| US12048750B2 (en) | 2013-09-17 | 2024-07-30 | Blaze Bioscience, Inc. | Tissue-homing peptide conjugates and methods of use thereof |
| US11559580B1 (en) | 2013-09-17 | 2023-01-24 | Blaze Bioscience, Inc. | Tissue-homing peptide conjugates and methods of use thereof |
| WO2015061592A1 (en) * | 2013-10-23 | 2015-04-30 | Merrimack Pharmaceuticals, Inc. | Liposomes for non-invasive imaging and drug delivery |
| US11318131B2 (en) | 2015-05-18 | 2022-05-03 | Ipsen Biopharm Ltd. | Nanoliposomal irinotecan for use in treating small cell lung cancer |
| US11844795B2 (en) | 2015-08-20 | 2023-12-19 | Ipsen Biopharm Ltd. | Combination therapy for cancer treatment |
| US10478428B2 (en) | 2015-08-20 | 2019-11-19 | Ipsen Biopharm Ltd. | Combination therapy for cancer treatment |
| US11344552B2 (en) | 2015-08-21 | 2022-05-31 | Ipsen Biopharm Ltd. | Methods for treating metastatic pancreatic cancer using combination therapies comprising liposomal irinotecan and oxaliplatin |
| US12048732B2 (en) | 2016-04-15 | 2024-07-30 | Blaze Bioscience, Inc. | Methods of treating breast cancer |
| US11071726B2 (en) | 2016-11-02 | 2021-07-27 | Ipsen Biopharm Ltd. | Treating gastric cancer using combination therapies comprising liposomal irinotecan, oxaliplatin, 5-fluorouracil (and leucovorin) |
| US11826399B2 (en) | 2017-09-15 | 2023-11-28 | Eisai Inc. | Chlorotoxin agents and uses thereof |
| US11866466B2 (en) | 2017-12-19 | 2024-01-09 | Blaze Bioscience, Inc. | Tumor homing and cell penetrating peptide-immuno-oncology agent complexes and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| DE60331458D1 (de) | 2010-04-08 |
| AU2003237347B2 (en) | 2009-07-23 |
| JP2005537234A (ja) | 2005-12-08 |
| ES2341767T3 (es) | 2010-06-28 |
| EP1553962A4 (en) | 2008-01-02 |
| CA2494451A1 (en) | 2003-12-11 |
| EP1553962A1 (en) | 2005-07-20 |
| EP1553962B1 (en) | 2010-02-24 |
| AU2003237347A1 (en) | 2003-12-19 |
| JP5856744B2 (ja) | 2016-02-10 |
| MXPA04011871A (es) | 2005-07-26 |
| EP1539207A4 (en) | 2008-01-02 |
| EP2431385A3 (en) | 2012-07-04 |
| JP2015214562A (ja) | 2015-12-03 |
| US20060166892A1 (en) | 2006-07-27 |
| EP2182004A1 (en) | 2010-05-05 |
| WO2003101475A1 (en) | 2003-12-11 |
| EP2431385A2 (en) | 2012-03-21 |
| CA2487425A1 (en) | 2003-12-11 |
| ATE458751T1 (de) | 2010-03-15 |
| JP2011153149A (ja) | 2011-08-11 |
| EP1539207A1 (en) | 2005-06-15 |
| AU2003240496B2 (en) | 2008-01-10 |
| AU2003240496A1 (en) | 2003-12-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2003240496B2 (en) | Combination chemotherapy with chlorotoxin | |
| US20100210546A1 (en) | Combination chemotherapy with chlorotoxin | |
| US20070258893A1 (en) | Compositions and methods for imaging expression of cell surface receptors | |
| US20100135905A1 (en) | Assessment of cancer susceptibility to molecular targeted therapy by use of recombinant peptides | |
| US8133471B2 (en) | CLK-peptide and SLK-peptide | |
| US20090004105A1 (en) | Molecular imaging of matrix metalloproteinase expression using labeled chlorotoxin | |
| DaSilva et al. | In vivo imaging of monoaminergic nerve terminals in normal and MPTP‐lesioned primate brain using positron emission tomography (PET) and [11C] tetrabenazine | |
| Schmidt et al. | Therapeutic nuclear medicine in pediatric malignancy | |
| US20150050213A1 (en) | Compositions and methods for imaging inflammation of traumatic brain injury | |
| Pauwels et al. | Molecular imaging of norepinephrine transporter-expressing tumors: current status and future prospects | |
| HK1172630A (en) | Combination therapy with chlorotoxin | |
| US20190160188A1 (en) | Radiolabeled Alpha-Melanocyte Stimulating Hormone Hybrid Peptide for Melanoma Targeting | |
| US20220001039A1 (en) | Compositions and methods for detecting ace2 expression profiles | |
| Volterrani et al. | Hybrid imaging and radionuclide therapy of neuroendocrine tumors | |
| Xie et al. | CuET Radiosensitizes FAP-Targeted Radioligand Therapy in Lung Cancer by inhibiting DNA Repair | |
| Moosa et al. | The two-week-wait referral pathway: not fit for purpose | |
| Hu et al. | Non-invasive HER2 detection in ovarian and breast cancer xenografts with 99m Tc-(HE) 3 Z HER2: V2 | |
| Jiang et al. | Combating drug-resistant Staphylococcus aureus infection with pathogen-specific positron emission tomography and targeted radionuclide therapy | |
| Burak | Radionuclide Therapy in Neuroectodermal Tumors | |
| WO2025145255A1 (en) | Lat-1 targeting amino acid derivatives and uses thereof | |
| WO2003060518A1 (fr) | Diagnostic de schizophrenie |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PH PL PT RO RU SC SD SE SG SK SL TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2003240496 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2487425 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2004/011871 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003731504 Country of ref document: EP Ref document number: 2004508829 Country of ref document: JP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2003731504 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2006088899 Country of ref document: US Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10516079 Country of ref document: US |
|
| WWP | Wipo information: published in national office |
Ref document number: 10516079 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2003240496 Country of ref document: AU Date of ref document: 20030602 Kind code of ref document: B |