WO2000073388A1 - Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung - Google Patents
Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung Download PDFInfo
- Publication number
- WO2000073388A1 WO2000073388A1 PCT/EP2000/004696 EP0004696W WO0073388A1 WO 2000073388 A1 WO2000073388 A1 WO 2000073388A1 EP 0004696 W EP0004696 W EP 0004696W WO 0073388 A1 WO0073388 A1 WO 0073388A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- water
- meth
- polyurethane
- aqueous
- insoluble
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G18/00—Polymeric products of isocyanates or isothiocyanates
- C08G18/06—Polymeric products of isocyanates or isothiocyanates with compounds having active hydrogen
- C08G18/08—Processes
- C08G18/10—Prepolymer processes involving reaction of isocyanates or isothiocyanates with compounds having active hydrogen in a first reaction step
- C08G18/12—Prepolymer processes involving reaction of isocyanates or isothiocyanates with compounds having active hydrogen in a first reaction step using two or more compounds having active hydrogen in the first polymerisation step
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08F—MACROMOLECULAR COMPOUNDS OBTAINED BY REACTIONS ONLY INVOLVING CARBON-TO-CARBON UNSATURATED BONDS
- C08F283/00—Macromolecular compounds obtained by polymerising monomers on to polymers provided for in subclass C08G
- C08F283/006—Macromolecular compounds obtained by polymerising monomers on to polymers provided for in subclass C08G on to polymers provided for in C08G18/00
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G18/00—Polymeric products of isocyanates or isothiocyanates
- C08G18/06—Polymeric products of isocyanates or isothiocyanates with compounds having active hydrogen
- C08G18/08—Processes
- C08G18/0804—Manufacture of polymers containing ionic or ionogenic groups
- C08G18/0819—Manufacture of polymers containing ionic or ionogenic groups containing anionic or anionogenic groups
- C08G18/0823—Manufacture of polymers containing ionic or ionogenic groups containing anionic or anionogenic groups containing carboxylate salt groups or groups forming them
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08G—MACROMOLECULAR COMPOUNDS OBTAINED OTHERWISE THAN BY REACTIONS ONLY INVOLVING UNSATURATED CARBON-TO-CARBON BONDS
- C08G18/00—Polymeric products of isocyanates or isothiocyanates
- C08G18/06—Polymeric products of isocyanates or isothiocyanates with compounds having active hydrogen
- C08G18/28—Polymeric products of isocyanates or isothiocyanates with compounds having active hydrogen characterised by the compounds used containing active hydrogen
- C08G18/65—Low-molecular-weight compounds having active hydrogen with high-molecular-weight compounds having active hydrogen
- C08G18/66—Compounds of groups C08G18/42, C08G18/48, or C08G18/52
- C08G18/6633—Compounds of group C08G18/42
- C08G18/6637—Compounds of group C08G18/42 with compounds of group C08G18/32 or polyamines of C08G18/38
- C08G18/664—Compounds of group C08G18/42 with compounds of group C08G18/32 or polyamines of C08G18/38 with compounds of group C08G18/3203
- C08G18/6644—Compounds of group C08G18/42 with compounds of group C08G18/32 or polyamines of C08G18/38 with compounds of group C08G18/3203 having at least three hydroxy groups
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D175/00—Coating compositions based on polyureas or polyurethanes; Coating compositions based on derivatives of such polymers
- C09D175/04—Polyurethanes
Definitions
- the invention relates to aqueous binder dispersions for aqueous coating compositions based on polyurethanes containing water-insoluble celulose esters, which can be (meth) acrylated. It also relates to processes for their preparation and processes for multi-layer coating using the coating agents, in particular as a water-based lacquer in processes for producing decorative multi-layer coatings of the water-based lacquer / clear lacquer type.
- Basecoats based on organic solvents which contain celulose esters such as cellulose acetobutyrate are known for the production of decorative multi-layer lacquers of the basecoat / clearcoat type.
- Celiulose esters give basecoats based on organic solvents special rheological properties which, in the case of effect basecoats, lead to a favorable effect expression within the finished two-layer effect coating.
- EP-based lacquers containing water-insoluble celulose esters are known from EP-A-0 069 936 and from WO 97/49739.
- EP-A-0 069 936 describes dispersions of cellulose esters in water which are suitable as binders in waterborne basecoats and are prepared by copolymerizing a mixture of a water-soluble resin from the group consisting of polyester resins, acrylic resins and alkyd resins and alpha, beta-ethylenically unsaturated monomers in the presence of the dissolved Celiulose esters, the cellulose ester content, based on the total solids content of the dispersion, being between 5 and 40%.
- WO 97/49739 describes dispersions which are suitable as binders in waterborne basecoats and contain at least 5% by weight, preferably 10 to 30% by weight, of celulose ester, based on the resin solids of the dispersion, which are dispersions based on vinyl polymers, which are prepared by copolymerizing previously prepared aqueous emulsions of celulose ester dissolved in a mixture of vinyl monomers.
- the vinyl monomers include polyunsaturated vinyl monomers.
- the water-based lacquers of the prior art containing water-insoluble celulose esters have low processing solids in comparison to corresponding water-based lacquers containing no water-insoluble celulose esters.
- the celiosis esters contained in the known basecoat layers weaken the weather resistance of basecoat / clearcoat two-coat coatings.
- the object of the invention is to provide aqueous coating compositions with a rheologically effective content of Celiuloseester, which do not have the above disadvantages and which are particularly suitable for multi-layer coatings, in particular for the preparation of color and / or effect basecoat layers.
- the object is achieved if the aqueous dispersions of polyurethane resins, which can be (meth) acrylated, which form an object of the invention, are used as binders in aqueous coating compositions, the (meth) acrylated polyurethane dispersions, if appropriate, 0.5 to 5% by weight. %, preferably up to less than 5% by weight of water-insoluble celulose ester, based on the
- Dispersion solids included. It was by no means to be expected that the binder dispersions according to the invention in aqueous coating compositions with their low contents of 0.5 to 5% by weight of water-insoluble celulose ester in the (meth) acrylated polyurethane dispersion particles would have the theological properties according to the task.
- the invention further provides aqueous coating compositions which contain aqueous binder dispersions based on polyurethane resins, which can be (meth) acrylated, and which are characterized in that the (meth) acrylated polyurethane dispersion particles, if appropriate, 0.5 to 5% by weight , based on their solids content, contain water-insoluble Celiuloseester.
- the optionally (meth) acrylated polyurethane dispersion particles consist of 0.5 to 5% by weight, preferably up to less than 5% by weight, of water-insoluble cellulose esters and 95 (preferably more than 95) to 99.5% by weight of optionally ( meth) acrylated polyurethane resin.
- the aqueous coating compositions according to the invention contain one or more aqueous binder dispersions based on polyurethane resins A) and / or (meth) acrylated polyurethane resins B) with a content of 0.5 to 5% by weight, preferably up to less than 5% by weight, more water-insoluble Celiulose ester, based on the dispersion solid.
- the aqueous binder dispersions are either dispersions of polyurethane resins A), each of which is mixed with a corresponding amount of water-insoluble celulose ester before the addition of substantial amounts of water for the purpose of being converted into the disperse phase, and then converted into the disperse phase by adding water, or it are dispersions (meth) acrylated polyurethane resins B) which are mixed before or after their (meth) acrylation, but in any case before the addition of substantial amounts of water for the purpose of transferring them to the disperse phase with a corresponding amount of water-insoluble celiosis ester and then by addition be transferred from water to the disperse phase.
- dispersions of polyurethane resins A each of which is mixed with a corresponding amount of water-insoluble celulose ester before the addition of substantial amounts of water for the purpose of being converted into the disperse phase, and then converted into the disperse phase by adding water
- the dispersions (meth) acrylated polyurethane resins B) can be prepared by acrylating the polyurethane resins in the non-aqueous phase (meth), then mixing them with a corresponding amount of water-insoluble celulose ester and then converting them to the disperse phase by adding water or by they are mixed in the non-aqueous phase with a corresponding amount of water-insoluble celulose ester, then (meth) acrylated and then converted into the disperse phase by adding water.
- the polyurethane resins are preferably mixed in the non-aqueous phase with a corresponding amount of water-insoluble celulose ester, then converted into the disperse phase by adding substantial amounts of water and then acrylated in the aqueous dispersion (meth).
- (meth) acrylation means that for the preparation of the (meth) acrylated polyurethane resins B) a radical polymerization of (meth) acrylic unsaturated monomers is carried out in the presence of polyurethane resins.
- water-insoluble celulose esters are only insufficiently miscible with the polyurethane resins A) which are still free from water or can be mixed with the polyurethane resins which are still water-free to be (meth) acrylated, or are only insufficiently soluble therein, it is expedient to mix the water-insoluble celulose esters with the still to mix water-free polyurethane resins.
- the water-insoluble cellulose esters are, for example, cellulose acetopropionate or cellulose acetobutyrate, both of which are commercially available, for example from Eastman, in various water-insoluble variants with different hydroxyl, acetyl and propionyl or butyryl contents. Cellulose acetobutyrate is preferred, in particular with high butyryl contents between 35 and 55% by weight.
- Celiulose esters for example those containing 20 to 60% by weight of celulose ester, can be used in polar organic, preferably water-miscible, solvents.
- solvents which can be used are esters, glycol ethers, glycol ether esters, glycol esters, ketones and N-alkylpyrrolidones. Butyl glycol and N-methylpyrrolidone are preferred.
- the solvent or solvents can be partially or completely removed after the formation of the dispersion, for example by distillation, if appropriate under reduced pressure.
- the (meth) acrylating polyurethane resins it may also be expedient to use part or all of the amount of the olefinically unsaturated monomers used for the (meth) acrylation as a solvent for the water-insoluble celulose esters.
- the olefinically unsaturated monomers can be used as the sole solvent or in a mixture with organic solvents.
- the polyurethane resins A) are, for example, isocyanate group-free carboxy-functional polyurethane prepolymers AI) or preferably in any manner to polyurethane resins A2) chain-extended carboxy-functional polyurethane prepolymers, each of which is added with a corresponding amount of water-insoluble before it is added to the disperse phase for the purpose of being converted into the disperse phase Celiulose esters are mixed.
- isocyanate group free used here and below means “isocyanate group free” and includes “essentially isocyanate group free”, for example in the expression “isocyanate group free carboxy-functional polyurethane prepolymers” are also carboxy-functional polyurethane prepolymers with a residual isocyanate group content corresponding to an NCO number of 0.5 based on solid resin and less% included.
- Isocyanate-free carboxy functional polyurethane prepolymers AI can be prepared, for example, by:
- a corresponding amount of water-insoluble celulose ester is added to the polyurethane prepolymer before the addition of substantial amounts of water for the purpose of dispersion formation and mixed homogeneously therewith.
- the linear or branched, non-gelled, carboxyl group-containing and isocyanate-functional polyurethane prepolymer can be prepared in process step 1), for example, by reacting one or more compounds with at least two isocyanate-reactive groups, in particular one or more polyols, preferably diols, with one or more organic polyisocyanates, preferably diisocyanates and with one or more compounds with more than one, preferably two groups reactive toward isocyanate groups and at least one carboxyl group.
- a branched, but preferably linear, polyurethane prepolymer containing lateral and / or terminal NCO groups that can be used as a starting product can be prepared by reaction in an anhydrous environment of at least one linear or branched compound which carries at least two groups that are reactive toward isocyanate, for example with a weight average molecular weight (Mw) of 60 to 10,000, preferably 60 to 6000, with a2) at least one organic polyisocyanate, in particular diisocyanate and a3) at least one compound with more than one isocyanate-reactive groups and at least one carboxyl group, for example with a number-average Molar mass (Mn) up to 10,000, preferably up to 2,000, in an NCO / OH ratio of more than 1 to 4: 1, preferably 1.1 to 2: 1, particularly preferably 1.1 to 1.7: 1 .
- Mw weight average molecular weight
- Mn number-average Molar mass
- the above-mentioned linear or branched compound of component al) is preferably at least one polyol based on one or more polyethers, polyesters and / or polycarbonates, with at least two OH groups in the molecule and a number average molecular weight (Mn) from 600 to 10,000, preferably more than 1,000 and less than 6,000, optionally with the use of one or more at least difunctional low molecular weight alcohols and / or amines and / or amino alcohols with a molecular weight of less than 600, preferably less than 400.
- Mn number average molecular weight
- Any organic polyisocyanates such as e.g. Diisocyanates are used. Aliphatic, cyclo-Uphatic, aromatic or araliphatic diisocyanates can be used. Examples of suitable diisocyanates are hexane diisocyanate, isophorone diisocyanate, bis (4-isocyanatocyclohexyl) methane, bis (4-isocyanatophenyl) methane, tetramethylxylylene diisocyanate and 1,4-cyclohexane diisocyanate.
- component a3) it is preferred to use low molecular weight compounds which contain more than one, preferably two or at least two groups reacting with isocyanate groups and at least one carboxyl group.
- Suitable groups reacting with isocyanate groups are in particular hydroxyl groups and primary and secondary amino groups.
- the carboxyl groups can be introduced, for example, by using hydroxyalkane carboxylic acids as component a3).
- Dihydroxyalkanoic acids in particular alpha, alpha-dimethylolalkanoic acids such as alpha, alpha-dimethylolpropionic acid, are preferred.
- the carboxy-functional polyurethane resins A2) can be, for example, aqueous polyurethane dispersions A2a) which can be prepared by chain extension of polyurethane prepolymers containing polyisocyanates reactive with active hydrogen and carboxyl groups with polyisocyanates.
- the reactive, active hydrogen is used in a suitable process section, for example before or after the reaction having groups of the polyurethane prepolymer with chain-extending polyisocyanate, a corresponding amount of water-insoluble celulose ester is added before the addition of substantial amounts of water for the purpose of dispersion formation to the polyurethane prepolymer or to the already chain-extended polyurethane resin A2a) and mixed homogeneously therewith.
- carboxy-functional polyurethane resins A2) are preferably aqueous polyurethane dispersions A2b) which can be prepared by chain extension of isocyanate- and carboxy-functional polyurethane prepolymers with polyamines, hydrazine (derivatives), water and / or polyols.
- a suitable amount of water-insoluble celulose ester is added before the addition of substantial amounts of water to form the polyurethane prepolymer or the already chain-extended polyurethane resin A2b) in a suitable process step, for example before or after the reaction of the isocyanate groups of the polyurethane prepolymer with chain extenders homogeneously mixed with it.
- polyurethane resins A2b can be produced by:
- the proportions of the individual starting materials can be chosen, for example, and the reaction can be carried out, for example, in such a way that the finished polyurethane resin A2b) has a number average molecular weight (Mn) of 2500 to 1,000,000, a hydroxyl number of 0 to 100 mg KOH / g, based on solid resin and has an acid number of 5 to 60, preferably 10 to 40 mg KOH / g, based on solid resin.
- Mn number average molecular weight
- process step 1) as described above for process step 1) in the production of the polyurethane prepolymers AI).
- polyurethane prepolymers are chain-extended by reacting the free isocyanate groups with one or more compounds which are capable of addition to isocyanate groups and effect chain extension, selected from polyamines, hydrazine (derivatives), water and / or polyols.
- chain extension selected from polyamines, hydrazine (derivatives), water and / or polyols.
- the chain is extended by hydrolysis of NCO groups to NH 2 groups and their spontaneous addition to NCO groups.
- the reaction of the free isocyanate groups with one or more compounds which are capable of addition to isocyanate groups and which bring about chain extension can take place before the isocyanate- and c-arboxy-functional polyurethane prepolymer obtained in process step 1) is converted into an aqueous dispersion.
- water as a chain extender is preferably used to extend the chain parallel to or after the conversion into an aqueous dispersion.
- carboxy-functional polyurethane resins A2) are aqueous polyurethane dispersions A2c) which can be prepared by chain extension of alkoxy- or acyloxysilane and carboxy-functional polyurethane prepolymers with the addition of water.
- a corresponding amount is added in a suitable process section, for example before or after the chain extension of the alkoxy- or acyloxysilane-functional polyurethane prepolymer water-insoluble celulose ester added before the addition of substantial amounts of water for the purpose of dispersion formation to the polyurethane prepolymer or to the already chain-extended polyurethane resin A2c) and mixed homogeneously therewith.
- Polyurethane prepolymers with the addition of water-produced polyurethane resins A2c) have, for example, a number-average molar mass (Mn) of 2500 to 1,000,000, a content of, for example, 2 to 150 mmol, preferably 3 to 100 mmol, particularly preferably 7 to 70 mmol of siloxane bridges (-Si-O- Si) per 100 g of solid resin, a hydroxyl number of 0 to 100, preferably 0 to 60 mg KOH / g, based on solid resin and an acid number of 5 to 60, preferably 10 to 40 mg KOH / g, based on solid resin.
- the polyurethane resins A2c) can be linear or branched or in the form of microgels.
- the polyurethane resins A2c) which are chain-extended to form siloxane bridges can be prepared, for example, by using a polyurethane prepolymer containing carboxyl groups and having at least one R'OSi group, in which
- R - C 1 - to C8-alkyl or C (O) R ", and R '" Cl- to C10-alkyl
- chain extension by adding water in at least stoichiometric amount for the hydrolysis of the R'OSi groups, converting the reaction product during or after the chain extension, if necessary after complete or partial neutralization, into an aqueous dispersion.
- the polyurethane prepolymers with R'OSi groups can be prepared, for example, by: 1) preparation of a linear or branched, non-gelled, carboxyl group-containing and isocyanate-functional polyurethane prepolymer in an organic solvent or in the absence of solvents,
- process step 1) as described above for process step 1) in the production of the polyurethane prepolymers AI).
- Some preferred examples of compounds of the general formula (I) are beta-aminoethyltriethoxysilane, gamma-aminopropyltrimethoxysilane, delta-aminobutyltriethoxysilane.
- active hydrogen-containing compounds which are capable of addition to isocyanate, for example monoalcohols, diols, polyols, glycol ethers, monoamines, diamines, polyamines, hydrazine (before the transfer of the prepolymer derivatives).
- the polyurethane resin A2c) on which the polyurethane dispersion is based can have hydroxyl groups. If this is desired, the polyurethane prepolymer containing NCO groups can be used in the preparation of the R'OSi-functionalized polyurethane prepolymer with at least one compound of the general formula (I) and with at least one alkanolamine carrying NH and / or NH groups with an OH Functionality of at least 1 can be implemented. The reaction takes place with complete consumption of the HX groups of the compounds of the general formula (I) and the NH groups of the alkanolamine.
- the isocyanate groups of the NCO-functional polyurethane prepolymer are preferably reacted with the HX groups of the compounds of the general formula (I) and the NH groups of the alkanolamine in a stoichiometric ratio.
- the alkanolamine and the compound of the general formula (I) can be reacted in a mixture or in succession with the NCO-functional polyurethane prepolymer.
- the alkanolamines carrying NH 2 and / or NH groups and having an OH functionality of at least 1 are compounds which can serve as suppliers for hydroxyl groups in the polyurethane resin dispersion A2c).
- the NH or NH 2 groups of the alkanolamines have a significantly higher reactivity compared to their OH groups compared to the isocyanate groups of the NCO-functional polyurethane prepolymer.
- suitable alkanolamines with an OH functionality of at least 1 are monoalkanolamines and dialkanolamines, for example diethanolamine, N-methylethanolamine, diisopropanolamine, monoisopropanolamine,
- Ethanolamine, 3-aminopropanol It may be expedient if one or more aliphatic C4-C36 alcohols and / or amines are used instead of or together with the NH - and / or NH groups, the implementation of which then generally with complete consumption of their OH, NH and / or NH 2 groups takes place. Fatty amines and / or fatty alcohols with more than 12 carbon atoms are preferred.
- the R'OSi and carboxy-functional, optionally neutralized polyurethane prepolymer is subjected to hydrolysis and, as a result, chain extension.
- the total amount of water required to prepare the dispersion can be used for the hydrolysis and the chain extension resulting therefrom.
- the R'OSi groups of the polyurethane prepolymer are sensitive to hydrolysis. It can be controlled via the course of the addition of water that the polyurethane resin A2c) contains silicon in the form of siloxane bridges (-Si-O-Si-) integrated in the polyurethane portion.
- the hydrolysis is preferably carried out first with a small amount of water which is not sufficient to be converted into the aqueous phase, preferably up to ten times the stoichiometric excess, particularly preferably up to five times the stoichiometric excess, calculated on the amount of water required for the hydrolysis of the R'OSi groups.
- the hydrolysis of the R'OSi groups takes place quickly.
- the HOSi groups formed by hydrolysis condense with elimination of water and the formation of siloxane bridges and thus lead to a chain-extended polyurethane resin A2c) with an increased molecular weight.
- linear, branched or crosslinked products are obtained which are practically free of R'OSi and / or HOSi groups.
- the transfer of the solvent-free or organic solution polyurethane resin into an aqueous dispersion with addition of a sufficient amount of water can take place during or after completion of the chain extension by forming siloxane bridges.
- the chain extension runs in the resin phase; if the resin has already been added sufficiently
- the amount of water is dispersed, so the chain extension runs in the dispersion particles yourself.
- the (meth) acrylated polyurethane resins B) are carboxy-functional hybrid polymers which can be prepared, for example, by free-radical polymerization (meth) acrylic and, if appropriate, further olefinically unsaturated monomers in the presence of carboxy-functional polyurethane resins, preferably in the presence of aqueous-dispersed carboxy-functional polyurethane resins.
- the carboxy-functional polyurethane resins can contain or be free from olefinic double bonds.
- a suitable amount of water-insoluble celulose ester is added to the polyurethane resin for the purpose of dispersion formation and homogeneously mixed with it in a suitable process section, for example before or after the synthesis of the (meth) acrylating polyurethane resin has been completed.
- the (meth) acrylation as such can be carried out before or preferably after the addition of the essential amounts of water.
- the water-insoluble celulose esters can also be used as a solution in part or in all of the amount of the olefinically unsaturated monomers used for (meth) acrylation.
- the olefinically unsaturated monomers can be used as the sole solvent or in a mixture with organic solvents.
- the hybrid polymers produced by polymerization (meth) acyl-unsaturated monomers in the presence of carboxy-functional, preferably in the presence of aqueous, dispersed carboxy-functional polyurethane resins are, for example, polyurethane / poly (meth) acrylate-polymer hybrids with a weight ratio of polyurethane to poly (meth) acrylate content of 0.05: 1 to 50: 1, preferably up to 10: 1, a hydroxyl number from 0 to 150, preferably below 100 mg KOH / g, based on solid resin, and an acid number from 1.5 to 60 mg KOH / g, preferably 3 to 40 mg KOH / g, based on solid resin.
- Those are preferred Carboxyl groups to at least 70%, particularly preferably only part of the polyurethane portion.
- the hybrid polymers produced by polymerization in the presence of polyurethane resins containing olefinic double bonds are either linear block polymers or they have a branched structure, for example as a comb polymer, or they are in the form of microgels.
- they have a number average molecular weight (Mn) of 8000 to 1500000 and can have a content of up to 100 mmol silicon per 100 g solid resin in the form of siloxane bridges (-Si-O-Si) integrated in the polyurethane component.
- the hybrid polymers produced by polymerization in the presence of polyurethane resins free of olefinic double bonds consist of polyurethane and poly (meth) acrylate fractions.
- Polyurethane and poly (meth) acrylate components can be present as an interpenetrating network and / or the poly (meth) acrylate component is grafted onto the polyurethane component.
- the hybrid polymers produced by polymerization in the presence of polyurethane resins free of olefinic double bonds can have, for example, a content of up to 100 mmol silicon per 100 g solid resin in the form of siloxane bridges (-Si-O-Si) incorporated in the polyurethane portion.
- the olefinically unsaturated monomers which come to polymerization during the synthesis of the poly (meth) acrylate portion of the polyurethane / poly (meth) acrylate-polymer hybrids B) can be allylic or vinylically unsaturated monomers in addition to the (meth) acrylic unsaturated monomers.
- the proportion of allylic or vinylic double bonds is preferably below 10% and the proportion of (meth) acrylic double bonds is at least 50%, preferably more than 70%.
- Examples of free-radically polymerizable, olefinically unsaturated monomers that can be used to prepare the polyurethane / poly (meth) acrylate-polymer hybrids B) are those that do not have functional groups.
- Examples are (cyclo) alkyl (meth) acrylates, such as methyl (meth) acrylate, ethyl (meth) acrylate, propyl (meth) acrylate, butyl (meth) acrylate, hexyl (meth) acrylate, cyclohexyl (meth) acrylate, ethylhexyl (meth) acrylate, dodecyl (meth) acrylate, lauryl (meth) acrylate, isobornyl (meth) acrylate and monovinyl aromatic
- olefinically unsaturated monomers can also be used
- Monomers with functional groups can be used. Examples are those with CH-acidic, epoxy, hydroxyl or carboxyl groups, carboxy-functional monomers preferably not contributing to more than 30% of the acid number of the polyurethane / poly (meth) acrylate-polymer hybrid binder B).
- olefinically unsaturated monomers with hydroxyl groups which alone or together with any hydroxyl groups from the polyurethane portion can contribute to the hydroxyl number of the hybrid polymer B
- allyl alcohol but in particular hydroxyalkyl (meth) acrylates, such as hydroxyethyl (meth) acrylate, hydroxypropyl (meth) acrylate or butanediol mono (meth) acrylate,
- Glycerol mono (meth) acrylate adducts of (meth) acrylic acid with monoepoxides such as e.g. Versatic acid glycidyl ester, adducts of glycidyl (meth) acrylate with monocarboxylic acids such as e.g. Acetic acid or propionic acid.
- monoepoxides such as e.g. Versatic acid glycidyl ester
- monocarboxylic acids such as e.g. Acetic acid or propionic acid.
- carboxyl group-containing olefinically unsaturated monomers are unsaturated carboxylic acids, e.g. (Meth) acrylic, itaconic, croton, isoerotonic, aconitic, maleic and fumaric acid, half esters of maleic and fumaric acid.
- unsaturated carboxylic acids e.g. (Meth) acrylic, itaconic, croton, isoerotonic, aconitic, maleic and fumaric acid, half esters of maleic and fumaric acid.
- Small portions of monomers with at least two polymerizable, olefinic double bonds can also be used.
- the proportion of these monomers is preferably less than 5% by weight, based on the total weight of the Monomers.
- Examples of such compounds are divinylbenzene, hexanediol di (meth) acrylate, ethylene glycol di (meth) acrylate, butanediol di (meth) acrylate, trimethylolpropane tri (meth) acrylate and similar compounds.
- the aqueous binder dispersions can preferably be based on
- Polyurethane / poly (meth) acrylate-polymer hybrids B) can be produced, for example, by using a polyurethane prepolymer containing carboxyl groups and an average of 0.1 to 2 free radical polymerization-accessible olefinically unsaturated groups per molecule or free of olefinic double bonds, which has an average of up to 9 can have, for example, 0.7 to 9 R'O groups bonded to silicon per molecule, in which
- olefinically unsaturated monomers can be used before and / or after the preparation of the aqueous
- Dispersion can be added.
- some or all of the olefinically unsaturated monomers can take on the function of a solvent which is inert to isocyanate before the aqueous dispersion is prepared and which does not have to be removed again.
- the polyurethane prepolymers containing carboxyl groups are preferably prepared with, on average, 0.1 to 2 lateral and / or terminal olefinically unsaturated groups per molecule which are accessible to free-radical polymerization and, if appropriate, on average 0.7 to 9 R'O preferably bonded to lateral and / or terminal silicon Groups per
- Molecule by: 1) Preparation of a linear or branched, non-gelled, carboxyl group-containing and isocyanate-functional polyurethane prepolymer free of olefinic double bonds in an inert organic solvent (mixture) and / or in one or more olefinically unsaturated monomers which are inert to isocyanate or in the absence of solvents and olefinically unsaturated monomers,
- bl optionally with one or more olefinically unsaturated monomers capable of addition to isocyanate groups, b2) optionally with one or more NH 2 - and / or NH groups-bearing alkanolamines with an OH functionality of at least 1, and
- process step 1) as described above for process step 1) in the production of the polyurethane prepolymers AI), the isocyanate-functional polyurethane prepolymer here being in an inert organic solvent (mixture) and / or in one or more of the mixture compared to isocyanate inert olefinically unsaturated monomers or in the absence of solvents and olefinically unsaturated monomers.
- Active hydrogen is contained, for example, in hydroxyl groups, NH groups, NH 2 groups or mercaptan groups.
- Double bond in the molecule especially in the form of a (meth) acryloyl group.
- Hydroxyalkyl (meth) acrylates such as hydroxyethyl (meth) acrylate,
- Versatic acid glycidyl ester adducts of glycidyl (meth) acrylate with monocarboxylic acids such as e.g. Acetic acid or propionic acid.
- the conversion of the NCO-functional polyurethane prepolymer to the R'OS-functionalized polyurethane prepolymer takes place with complete consumption of the HX groups of the compounds I and preferably also the isocyanate-reactive groups of the optionally used olefinically unsaturated monomers.
- the polyurethane poly (meth) acrylate hybrid polymer B) can have hydroxyl groups.
- the polyurethane prepolymer containing NCO groups can be reacted in the course of optional process step a3) with at least one alkanolamine carrying NH 2 and / or NH groups and having an OH functionality of at least 1 during the preparation of the R'OSi-functionalized polyurethane prepolymer. The implementation then takes place with complete consumption of the NH 2 and or
- the alkanolamines carrying NH 2 and / or NH groups and having an OH functionality of at least 1 are compounds which can serve as suppliers for hydroxyl groups and which, alone or together with any hydroxyl groups from the polymer component, contribute to the hydroxyl number of B) .
- one or more aliphatic C4-C36 alcohols and or amines are used, the reaction of which then in the Usually takes place with complete consumption of their OH, NH and / or NH 2 groups.
- Any remaining free isocyanate groups still remaining in the polyurethane prepolymer can be reacted with the conventional active hydrogen-containing compounds which are capable of addition to isocyanate before the prepolymer is transferred to the water phase.
- the R'OSi and carboxy-functional, optionally neutralized polyurethane prepolymer is subjected to hydrolysis and, as a result, chain extension.
- the corresponding explanations given above in connection with the production of the polyurethane resins A2c) apply here.
- the polyurethane prepolymer containing NCO groups obtained in process step 1) can also be carried out according to process step 2b)
- Polyurethane resin containing double bonds or free of olefinic double bonds can be chain extended.
- the corresponding explanations given above in connection with the production of the polyurethane resins A2b) apply here.
- the last synthesis step takes place in the preparation of the binder dispersion B).
- the radical polymerization can be a copolymerization or graft polymerization of the olefinically unsaturated monomers with or onto the lateral and / or terminal olefinic double formations of the polyurethane resin, or it can be a polymerization taking place in the presence of the polyurethane resin free of olefinic double bonds the olefinically unsaturated monomers used to build up the polymer component of the polyurethane poly (meth) acrylate-polymer hybrid binder B), or it is a graft polymerization initiated by H abstraction from the polyurethane resin free of olefinic double bonds that is used to build up the polymer component of the polyurethane / poly (meth) acrylate Polymer hybrid binder B) used olefinically unsaturated monomers on the polyurethane portion of the poly
- the radical polymerization can take place in such a way that the polyunsaturated monomers are polymerized in completely or only a part of the polyunsaturated monomers is polymerized in with incomplete consumption of their olefinic double bonds.
- part of the polyunsaturated monomers can be polymerized with only a part of their respective unsaturated groups, so that the polymer fraction of the resulting polyurethane / poly (meth) acrylate polymer hybrid B) can still have olefinic double bonds.
- the radical polymerization is carried out, for example, at temperatures between 20 and 95 ° C., preferably between 60 and 90 ° C.
- Usual free radical initiators are suitable, which can be used in usual amounts; Examples are peroxide compounds such as dialkyl peroxides, diacyl peroxides, organic hydroperoxides, peresters, ketone peroxides; Azo compounds such as azobisisobutyronitrile. Water-soluble radical initiators such as, for example, hydrogen peroxide, ammonium peroxodisulfate, ammonium persulfate and water-soluble azo initiators are preferred. It is also possible to carry out the polymerization as a redox polymerization using appropriate redox initiator systems such as, for example, sodium sulfite, sodium dithionite, ascorbic acid and peroxide compounds.
- peroxide compounds such as dialkyl peroxides, diacyl peroxides, organic hydroperoxides, peresters, ketone peroxides
- Azo compounds such as azobisisobutyronitrile.
- Water-soluble radical initiators such as, for example
- polyurethane prepolymers are first prepared in each case.
- the components used to construct the polyurethane prepolymers are reacted in an anhydrous environment, for example at temperatures from 20 to 140 ° C., preferably between 50 and 100 ° C. It can be carried out without solvents or it is known per se to the person skilled in the art for polyurethane synthesis suitable organic solvents worked. Water-miscible solvents or water-immiscible solvents can be used as solvents.
- the solvents can be those which can be removed at any stage in the preparation of the water-insoluble binder dispersions A) and B) (for example after their completion), for example by distillation, if appropriate under reduced pressure.
- Examples are ketones, for example acetone, methyl ethyl ketone, methyl isobutyl ketone; N-alkyl pyrrolidones, such as N-methyl pyrrolidone; Ethers, such as diethylene glycol dimethyl ether, dipropylene glycol dimethyl ether, or also cyclic urea derivatives, such as 1,3-dimethyl-3,4,5,6-tetrahydro-2 (1H) pyrimidinone.
- the solids content of the polyurethane dispersions A) and polyurethane / poly (meth) acrylate polymer hybrid dispersions B) used in the water-insoluble celiosulphate esters used to prepare the aqueous coating compositions according to the invention is, for example, between 25 and 65% by weight, preferably above 35 and below 60% .-%.
- pigments are mixed with the aqueous binder dispersions A) and or B) and, if appropriate, with further binders C), crosslinking agents, fillers, customary paint additives and solvents.
- aqueous coating compositions according to the invention can contain, in addition to the aqueous binder dispersions A) and / or B), one or more additional binders C) which are different therefrom, including, if appropriate, in the aqueous ones
- the amount of resins C) added can be 0 to 75% by weight of the total resin solids.
- resin solids means the sum of all binders A) plus B) plus C) without a crosslinker and without a paste resin content.
- Examples of such additional binders C) different from A) and B) are Conventional film-forming, water-thinnable binders known to the person skilled in the art, such as water-thinnable polyester resins, water-thinnable poly (meth) acrylate resins or water-thinnable polyester / poly (meth) acrylate hybrids, and water-thinnable polyurethane resins or polyurethane poly (meth) acrylate hybrids free of water-insoluble cellulose esters. It can be reactive or non-functional resins C).
- the aqueous coating compositions according to the invention can be self-drying (physically drying), self-crosslinking or externally crosslinking. Accordingly, the aqueous coating compositions of the invention can be used as crosslinking agents
- Binder components A), B) and / or C) contain, such as amine-formaldehyde condensation resins, e.g. Melamine resins, as well as free or blocked polyisocyanates.
- amine-formaldehyde condensation resins e.g. Melamine resins
- free or blocked polyisocyanates e.g. urethane resins
- the choice of crosslinking agents that may be used depends on the type of crosslinkable groups of A), B) and / or C) and is familiar to the person skilled in the art.
- the crosslinkers can be used individually or in a mixture.
- the mixing ratio of crosslinking agents to binders A) plus B) plus C) is preferably 10:90 to 40:60, particularly preferably 20:80 to 30:70, in each case based on the solids weight.
- aqueous coating compositions according to the invention can contain technical additives, for example rheology-influencing agents, such as highly disperse silica, inorganic sheet silicates, crosslinked or uncrosslinked polymer microparticles, polymeric urea compounds, water-soluble cellulose ethers or synthetic polymers with ionic and / or associative groups; Anti-sedatives; Leveling agent; Sunscreen; Catalysts; Anti-foaming agents;
- rheology-influencing agents such as highly disperse silica, inorganic sheet silicates, crosslinked or uncrosslinked polymer microparticles, polymeric urea compounds, water-soluble cellulose ethers or synthetic polymers with ionic and / or associative groups; Anti-sedatives; Leveling agent; Sunscreen; Catalysts; Anti-foaming agents;
- the aqueous coating compositions according to the invention contain bases as neutralizing agents for the carboxyl groups of the binders A) and B).
- bases are amines, preferably tert-amines. Suitable tertiary amines are e.g.
- Trialkylamines such as triethylamine; N-alkylmorpholines, such as N-methylmorpholine. Further examples are amino alcohols such as N-dimethylethanolamine or 2-amino-2-methyl-1-propanol.
- the solvent content of the aqueous coating compositions according to the invention is preferably below 20% by weight, particularly preferably below 15% by weight, particularly preferably below 10% by weight.
- These are customary paint solvents, they can come from the manufacture of the binders or are added separately.
- Examples of such solvents are monohydric or polyhydric alcohols, e.g. Propanol, butanol, hexanol; Glycol ethers or esters, e.g. Diethylene glycol dialkyl ether, dipropylene glycol dialkyl ether, each with C 1-6 alkyl, ethoxypropanol, butyl glycol; Glycols e.g.
- Ethylene glycol Propylene glycol, and its oligomers, N-alkyl pyrrolidones, e.g. N-methylpyrrolidone and ketones such as methyl ethyl ketone, acetone, cyclohexanone; aromatic or aliphatic hydrocarbons.
- N-alkyl pyrrolidones e.g. N-methylpyrrolidone and ketones such as methyl ethyl ketone, acetone, cyclohexanone
- aromatic or aliphatic hydrocarbons aromatic or aliphatic hydrocarbons.
- aqueous coating compositions according to the invention can contain one or more inorganic and or organic color and / or effect pigments and, if appropriate, additionally at least one filler.
- effect pigments are metal pigments, e.g. made of aluminum, copper or other metals; Interference pigments such as metal oxide coated metal pigments, e.g. titanium dioxide coated aluminum, coated mica such as titanium dioxide coated mica and graphite effect pigments.
- color pigments and fillers are titanium dioxide, micronized titanium dioxide, iron oxide pigments, carbon black, silicon dioxide, barium sulfate, micronized mica, talc, kaolin, chalk, azo pigments, phthalocyanine pigments, quinacridone pigments,
- the effect pigments are generally introduced in the form of a commercially available aqueous or non-aqueous paste, optionally mixed with preferably water-dilutable, organic solvents and additives and then mixed with the aqueous binder.
- Powdery effect pigments can initially can be processed into a paste with preferably water-dilutable organic solvents and additives.
- Color pigments and / or fillers can be rubbed, for example, in part of the aqueous binder. The rubbing can preferably also take place in a special water-thinnable paste resin. Then complete with the remaining portion of the aqueous binder or the aqueous paste resin for finished pigment pigment grinding.
- the aqueous coating compositions according to the invention are preferably waterborne basecoats of the type used for multi-layer coatings and overcoated with transparent clearcoats.
- a waterborne basecoat has, for example, a solids content of 10 to 50% by weight, for effect waterborne basecoats it is preferably 15 to 30% by weight, for plain-colored waterborne basecoats it is preferably higher, for example 20 to 45% by weight.
- the ratio of pigment to binder plus optionally crosslinking agent plus optionally paste resin in the water-based lacquer is, for example, between 0.03: 1 to 3: 1, for
- Effect waterborne basecoats are preferably 0.06: 1 to 0.6: 1, for plain-colored waterborne basecoats it is preferably higher, for example 0.06: 1 to 2.5: 1, in each case based on the solids weight.
- aqueous coating compositions according to the invention are in particular as
- Water-based paints are suitable for creating the color and / or effect coating layer within a multi-layer coating.
- the waterborne basecoat materials of the invention can be applied by customary methods. They are preferably applied by spraying in a dry layer thickness of 8 to 50 ⁇ m, for effect waterborne basecoats, for example, the dry layer thickness is preferably 10 to 25 ⁇ m, for plain-colored waterborne basecoats it is preferably higher, for example 10 to 40 ⁇ m.
- the application is preferably carried out in the wet-on-wet process, that is to say after a flash-off phase, for example at 20 to 80 ° C., the water-based lacquer layers are overcoated with a clear lacquer in a dry layer thickness of preferably 30 to 60 ⁇ m and together with this at temperatures of, for example 20 to 150 ° C dried or cross-linked.
- the drying conditions of the top coat depend on the clearcoat system used. For repair purposes, for example, temperatures of 20 to 80 ° C are preferred. Temperatures above 100 ° C., for example above 110 ° C., are preferred for the purposes of series painting.
- Both solventborne 1-component or 2-component clearcoats, water-dilutable clearcoats, powder clearcoats, aqueous powder clearcoat dispersions or radiation-curable clearcoats can be used as clearcoats.
- Multicoat paint systems created in this way can be applied to a wide variety of substrates.
- it is metallic or plastic substrates. These are often pre-coated, i.e. Plastic substrates can e.g. be provided with a plastic primer, metallic substrates generally have an electrophoretically applied primer and, if necessary, additionally one or more further lacquer layers, such as e.g. a filler layer. These layers are generally cured.
- Multi-layer coatings obtained with the water-based paints according to the invention correspond to the requirements customary today in automotive painting.
- the waterborne basecoats according to the invention are therefore suitable for the
- Vehicle painting and refinishing can also be used in other areas, e.g. plastic painting, especially vehicle parts painting.
- the invention further relates to a substrate coated with a
- Multilayer coating which has been obtained by applying at least one primer layer, applying a color and / or effect basecoat with an aqueous coating composition according to the invention, optionally drying the basecoat and applying a transparent coating as a topcoat and then heating the coated substrate. It can lead to this
- Multi-coat painting may add additional layers become.
- the coating compositions according to the invention have an advantageous one
- Theological behavior which is expressed, for example, in the case of the production of effect coatings of the effect water base coat / clear coat in the achievement of an excellent effect.
- the storage stability of the aqueous coating compositions according to the invention is good, for example in the sense of favorable settling behavior without pigment separation.
- the weathering behavior of multicoat paint systems of the basecoat / clearcoat type produced from the aqueous coating compositions according to the invention is good.
- Example 2h Preparation of a Water-Insoluble Polyurethane Dispersion Containing Celiulose Esters
- Hexanediol with an OH number of 102) are heated to 90 ° C and there are 1.8 g Trimethylolpropane and 393 g of isophorone diisocyanate were added. The reaction is carried out at 90 ° C. until the NCO number is 3.8. After cooling to 60 ° C., a solution of 35.3 g of dimethylolpropionic acid, 26.1 g of triethylamine and 150 g of N-methylpyrrolidone are added. After heating to 80 ° C is held until an NCO number of 1.5 is reached. It is mixed with the molar amount of deionized water and the solution is kept at 80 ° C. until no more NCO can be detected.
- a solution of 36 g of cellulose acetobutyrate (acetyl content 2% by weight, butyryl content 52% by weight) in 100 g of N-methylpyrrolidone is mixed in homogeneously.
- the batch is then converted into an aqueous dispersion with a solids content of 30% by weight by adding deionized water.
- 339 g of a polyester composed of adipic acid, hexanediol and isophthalic acid (OH number 104) and 19 g of dimethylolpropionic acid are dissolved in 160 g of N-methylpyrrolidone and heated to 40.degree. Then 125 g of isophorone diisocyanate are added so that a reaction temperature of 80 ° C is not exceeded. It is held until an NCO content of 2% (based on solid resin) determined according to DIN 53 185 is reached. Then 14.6 g of 3-aminopropyltriethoxysilane and 16.2 g of diethanolamine are added in succession. The reaction mixture is kept at 80 ° C.
- Example 3h Preparation of a Water-Insoluble Polyurethane Dispersion Containing Celiulose Esters
- a mixture of 12.6 g of triethylamine and 12.6 g of deionized water is added and worked in well.
- the batch is then converted into an aqueous dispersion with a solids content of 30% by weight by adding deionized water.
- Example 4a Preparation of a dispersion of a methacrylated polyurethane resin
- reaction mixture is kept at 80 ° C. until no more free NCO groups can be detected (titration). Then 128.0 g of methyl methacrylate are added. 5.4 g of triethylamine and 5.4 g of deionized water are added and worked in well. After the addition of 864.0 g of deionized water, a finely divided aqueous dispersion is obtained. 250.0 g of butyl acrylate, 125.0 g of tert-butyl acrylate and a solution of 62.0 g of deionized water and 2.0 g of ammonium peroxodisulfate are then added continuously at 80 ° C. over 2 hours. The mixture is then kept at 80 ° C. for 3 hours and adjusted to a solids content of 30% by weight with deionized water.
- Example 4b Preparation of a dispersion of a water-insoluble celulose ester containing acrylic acrylated resin
- Ammonium peroxodisulfate at 80 ° C continuously added over 2 h. The mixture is then kept at 80 ° C. for 3 hours and adjusted to a solids content of 30% by weight with deionized water.
- Example 6 preparation of an aqueous layered silicate dispersion
- 3 parts of a layered silicate (Optigel SH from Südchemie) are sprinkled into a mixture of 40 parts of deionized water and 10 parts of butyl glycol and dispersed under the dissolver at the highest power level. Thereafter, 40 parts of melamine resin of the hexamethoxymethylmelamine type and 7 parts of deionized water are mixed homogeneously.
- a water-based paint (green metallic) is produced by homogeneously mixing the following components:
- Example 7a is repeated with the difference that instead of 17 parts of the polyurethane dispersion from Example 2a, 17 parts of the polyurethane dispersion from Example 3a are used.
- the AK4 viscosity increased after 4 weeks of storage at 40 ° C from 35 seconds to 45 seconds.
- Example 7a is repeated with the difference that instead of 17 parts of the polyurethane dispersion from Example 2a, 17 parts of the water-insoluble celiulose ester-containing polyurethane dispersion from Example 2b are used.
- the AK4 viscosity increased after 4 weeks of storage at 40 ° C from 35 seconds to 42 seconds.
- Example 7a is repeated with the difference that instead of 17 parts of the polyurethane dispersion from Example 2a, 17 parts of the water-insoluble celiulose ester-containing polyurethane dispersion from Example 3b are used. After 4 weeks of storage at 40 ° C., the AK4 viscosity rose from 35 seconds to 42 seconds.
- a water-based paint (green metallic) is produced by homogeneously mixing the following components:
- Example 7e is repeated with the difference that instead of 26 parts of the aqueous dispersion of a methacrylated polyurethane resin from Example 4a, 26 parts of the aqueous dispersion of a methacrylated polyurethane resin containing a water-insoluble celulose ester from Example 4b are used.
- the AK4 viscosity increased after 4 weeks of storage at 40 ° C from 35 seconds to 50 seconds.
- Example 8a-f (Production of base lacquer / clear lacquer two-layer lacquers)
- Example 7a-f The waterborne basecoats from Example 7a-f are each applied to a customary, phosphated and, by cathodic dip coating and with a filler, pre-coated body panel by spraying in a dry layer thickness of 16 ⁇ m. After 5 min. Flash off at 80 ° C with a commercially available two-component polyurethane clear lacquer by compressed air spraying in a dry layer thickness of 40 microns and 20 min. Branded at 140 ° C (object temperature).
- the two-coat finishes obtained were 2000 hours
- Gardner Micrometallic measuring device by measuring the brightness L * 25 ° (Brightness in the L *, a *, b * color space, measured at an angle of 25 degrees to the gloss) determined: paint 8a, 84; Paint 8b, 85; Paintwork 8c, 86; Paintwork 8d, 87; Paintwork 8e, 84; Paintwork 8f, 87.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Polymers & Plastics (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Materials Engineering (AREA)
- Manufacturing & Machinery (AREA)
- Wood Science & Technology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Paints Or Removers (AREA)
- Polyurethanes Or Polyureas (AREA)
- Macromonomer-Based Addition Polymer (AREA)
- Compositions Of Macromolecular Compounds (AREA)
Abstract
Description
Claims
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU53967/00A AU5396700A (en) | 1999-05-27 | 2000-05-24 | Aqueous binding agent dispersions, coating agents and the use thereof |
DE50009226T DE50009226D1 (de) | 1999-05-27 | 2000-05-24 | Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung |
JP2001500709A JP2003501509A (ja) | 1999-05-27 | 2000-05-24 | 水性バインダー分散体、コーティング組成物およびそれらの使用 |
US09/980,718 US6811825B1 (en) | 1999-05-27 | 2000-05-24 | Aqueous dispersion comprising polyurethane-based resins and water-insoluble cellulose ester, methods for preparing and using same, and articles coated with same |
EP00938676A EP1180125B1 (de) | 1999-05-27 | 2000-05-24 | Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung |
AT00938676T ATE286941T1 (de) | 1999-05-27 | 2000-05-24 | Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE19924415.4 | 1999-05-27 | ||
DE19924415A DE19924415A1 (de) | 1999-05-27 | 1999-05-27 | Wäßrige Bindemitteldispersionen, Überzugsmittel und deren Verwendung |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2000073388A1 true WO2000073388A1 (de) | 2000-12-07 |
Family
ID=7909424
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2000/004696 WO2000073388A1 (de) | 1999-05-27 | 2000-05-24 | Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung |
Country Status (7)
Country | Link |
---|---|
US (1) | US6811825B1 (de) |
EP (1) | EP1180125B1 (de) |
JP (1) | JP2003501509A (de) |
AT (1) | ATE286941T1 (de) |
AU (1) | AU5396700A (de) |
DE (2) | DE19924415A1 (de) |
WO (1) | WO2000073388A1 (de) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1074590A2 (de) * | 1999-08-04 | 2001-02-07 | Wolff Walsrode AG | Cellulose-Substanz-enthaltendes Überzugsmittel sowie dessen Verwendung in Lacken |
WO2004018577A1 (de) * | 2002-07-31 | 2004-03-04 | Basf Coatings Ag | Basislacke enthaltend fettsäuremodifizierte epoxyester und/oder fettsäuremodifizierte alkydharze, verfahren zu deren herstellung und deren verwendung |
WO2005090430A1 (de) * | 2004-03-15 | 2005-09-29 | Basf Aktiengesellschaft | Neue lösungsmittel in der herstellung von polyurethandispersionen |
Families Citing this family (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6355303B1 (en) | 2000-04-28 | 2002-03-12 | E. I. Du Pont De Nemours And Company | Process for the preparation of multi-layer coatings of the water-borne base coat/powder clear coat type |
DE10147546B4 (de) * | 2001-09-26 | 2006-04-13 | Basf Coatings Ag | Polyurethan, Verfahren zu seiner Herstellung und seine Verwendung |
JP4965062B2 (ja) * | 2004-01-20 | 2012-07-04 | 関西ペイント株式会社 | 塗料組成物 |
DE102006006656A1 (de) * | 2005-08-26 | 2007-03-01 | Degussa Ag | Silan enthaltendes Bindemittel für Verbundwerkstoffe |
DE102006012354A1 (de) * | 2006-03-17 | 2007-09-20 | Bayer Materialscience Ag | Wässrige Dispersionen auf Basis von Nitrocellulose-Polyurethan-Teilchen |
CN101089103B (zh) * | 2007-07-13 | 2010-10-06 | 武汉双虎汽车涂料有限公司 | 闪光电泳漆及其制备方法 |
WO2009144180A1 (de) * | 2008-05-27 | 2009-12-03 | Basf Se | Neue polyurethandispersionen |
JP5207530B2 (ja) * | 2008-07-10 | 2013-06-12 | 大日精化工業株式会社 | プラスチック用塗料 |
US8142857B2 (en) * | 2008-12-08 | 2012-03-27 | Chung-Shan Institute Of Science And Technology, Armaments Bureau, Ministry Of National Defense | Compound and method for producing the same |
JP5872099B1 (ja) * | 2015-08-24 | 2016-03-01 | 第一工業製薬株式会社 | セルロースエステル水性分散体 |
JP5872098B1 (ja) * | 2015-08-24 | 2016-03-01 | 第一工業製薬株式会社 | セルロースエステル水性分散体 |
KR101691973B1 (ko) * | 2016-03-02 | 2017-01-03 | 동광산업주식회사 | 2액형 폴리우레탄 코팅제의 제조 방법 및 이에 따라 제조된 2액형 폴리우레탄 코팅제 |
CN109735225B (zh) * | 2019-01-25 | 2022-07-15 | 佛山市高明区首邦化工有限公司 | 一种木器用高光环保漆及其制备方法 |
JP7323321B2 (ja) * | 2019-04-16 | 2023-08-08 | スリーエム イノベイティブ プロパティズ カンパニー | フィルム |
CN110423328A (zh) * | 2019-08-16 | 2019-11-08 | 陕西科技大学 | 一种羧酸磺酸盐型水性醋酸纤维乳液及其制备方法 |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0490149A2 (de) * | 1990-12-08 | 1992-06-17 | Wolff Walsrode Aktiengesellschaft | Lackbindemittelgranulate |
US5384163A (en) * | 1991-10-23 | 1995-01-24 | Basf Corporation | Cellulose esters moidified with anhydrides of dicarboxylic acids and their use in waterborne basecoats |
US5520963A (en) * | 1994-06-30 | 1996-05-28 | Dupont Canada, Inc. | Paint formulation |
Family Cites Families (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3941733A (en) * | 1975-01-02 | 1976-03-02 | Minnesota Mining And Manufacturing Company | Silanol-containing urethane dispersions |
DE2930410A1 (de) * | 1979-07-26 | 1981-02-12 | Bayer Ag | Verfahren zur herstellung von stabilen waessrigen dispersionen von oligo- oder polyurethanen, sowie ihre verwendung als beschichtungsmittel fuer flexible oder nicht- flexible substrate |
DE3126549A1 (de) | 1981-07-04 | 1983-01-20 | Bollig & Kemper, 5000 Köln | Verfahren zur herstellung von stabilen waessrigen dispersionen und deren verwendung als bindemittel zur herstellung von lacken, insbesondere zweischicht-metalleffektlacksystemen |
US4551491A (en) * | 1983-07-29 | 1985-11-05 | Inmont Corporation | Pearlescent automotive paint compositions |
DE4224617A1 (de) * | 1992-07-25 | 1994-01-27 | Herberts Gmbh | Wäßriges Überzugsmittel, Verfahren zu dessen Herstellung und dessen Verwendung bei Verfahren zur Mehrschichtlackierung |
DE4413562A1 (de) * | 1994-04-19 | 1995-10-26 | Herberts Gmbh | Wäßrige Dispersion von Siloxanbrücken enthaltenden Polyurethanen, deren Herstellung und Verwendung in Überzugsmitteln |
US6046259A (en) | 1996-06-27 | 2000-04-04 | Ppg Industries Ohio, Inc. | Stable aqueous dispersions of cellulose esters and their use in coatings |
DE19810900C2 (de) * | 1998-03-13 | 2002-11-21 | Herberts Gmbh | Mattierungs- und Strukturmittel enthaltende Pasten |
-
1999
- 1999-05-27 DE DE19924415A patent/DE19924415A1/de not_active Withdrawn
-
2000
- 2000-05-24 JP JP2001500709A patent/JP2003501509A/ja active Pending
- 2000-05-24 EP EP00938676A patent/EP1180125B1/de not_active Expired - Lifetime
- 2000-05-24 US US09/980,718 patent/US6811825B1/en not_active Expired - Fee Related
- 2000-05-24 AT AT00938676T patent/ATE286941T1/de not_active IP Right Cessation
- 2000-05-24 WO PCT/EP2000/004696 patent/WO2000073388A1/de active IP Right Grant
- 2000-05-24 AU AU53967/00A patent/AU5396700A/en not_active Abandoned
- 2000-05-24 DE DE50009226T patent/DE50009226D1/de not_active Expired - Fee Related
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0490149A2 (de) * | 1990-12-08 | 1992-06-17 | Wolff Walsrode Aktiengesellschaft | Lackbindemittelgranulate |
US5384163A (en) * | 1991-10-23 | 1995-01-24 | Basf Corporation | Cellulose esters moidified with anhydrides of dicarboxylic acids and their use in waterborne basecoats |
US5520963A (en) * | 1994-06-30 | 1996-05-28 | Dupont Canada, Inc. | Paint formulation |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1074590A2 (de) * | 1999-08-04 | 2001-02-07 | Wolff Walsrode AG | Cellulose-Substanz-enthaltendes Überzugsmittel sowie dessen Verwendung in Lacken |
EP1074590A3 (de) * | 1999-08-04 | 2002-01-02 | Wolff Walsrode AG | Cellulose-Substanz-enthaltendes Überzugsmittel sowie dessen Verwendung in Lacken |
US6509396B1 (en) | 1999-08-04 | 2003-01-21 | Wolff Walsrode Ag | Coating agent emulsion and its use in lacquers |
WO2004018577A1 (de) * | 2002-07-31 | 2004-03-04 | Basf Coatings Ag | Basislacke enthaltend fettsäuremodifizierte epoxyester und/oder fettsäuremodifizierte alkydharze, verfahren zu deren herstellung und deren verwendung |
US7423093B2 (en) | 2002-07-31 | 2008-09-09 | Basf Coatings Ag | Base paints containing fatty acid-modified epoxy esters, methods for the production thereof and their use |
WO2005090430A1 (de) * | 2004-03-15 | 2005-09-29 | Basf Aktiengesellschaft | Neue lösungsmittel in der herstellung von polyurethandispersionen |
Also Published As
Publication number | Publication date |
---|---|
ATE286941T1 (de) | 2005-01-15 |
AU5396700A (en) | 2000-12-18 |
EP1180125A1 (de) | 2002-02-20 |
DE19924415A1 (de) | 2000-11-30 |
JP2003501509A (ja) | 2003-01-14 |
US6811825B1 (en) | 2004-11-02 |
EP1180125B1 (de) | 2005-01-12 |
DE50009226D1 (de) | 2005-02-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP0256540B1 (de) | Wässriges Überzugsmittel, Verfahren zu seiner Herstellung und dessen Verwendung | |
EP0521040B1 (de) | Verfahren zur herstellung einer mehrschichtigen reparaturlackierung | |
EP0608773B2 (de) | Verfahren zur Herstellung von wässrigen Überzugsmitteln unter Verwendung von Modulsystemen | |
EP0703934B1 (de) | Verfahren zur herstellung dekorativer mehrschichtlackierungen | |
EP0297576B1 (de) | Verfahren zur Herstellung eines Mehrschichtüberzuges und hierfür geeignetes wässriges Überzugsmittel | |
EP1180125B1 (de) | Wässrige bindemitteldispersionen, überzugsmittel und deren verwendung | |
DE19652841A1 (de) | Verfahren zur Herstellung von mehrschichtigen Überzügen | |
EP1005512B1 (de) | Verfahren zur herstellung von mehrschichtigen überzügen | |
EP0614951A2 (de) | Verfahren zur Herstellung von wässrigen unifarbenen Überzugsmitteln, unter Verwendung von Modulsystemen | |
EP0960174B1 (de) | Universell einsetzbare pigmentpasten und ihre verwendung zur herstellung von wässrigen lacken | |
EP0923626B1 (de) | Wässrige überzugsmittel, ihre herstellung und verwendung bei der herstellung von mehrschichtlackierungen | |
EP0706543A1 (de) | Modulsystem und verfahren zur herstellung wässriger überzugsmittel | |
EP0662992B1 (de) | Mischsystem zur herstellung wasserverdünnbarer überzugsmittel | |
EP1053270B1 (de) | Wässrige überzugsmittel, ihre herstellung und verwendung bei der herstellung von mehrschichtlackierungen | |
EP0797633B1 (de) | Wässrige überzugsmittel und deren verwendung bei verfahren zur einschicht- und mehrschichtlackierung | |
DE19746327C1 (de) | Wäßrige Überzugsmittel, ihre Herstellung und Verwendung | |
WO1997026289A1 (de) | Wässrige polymer/polyurethan-harz-bindemitteldispersion, deren herstellung, überzugsmittel und verwendung | |
DE19808869C1 (de) | Wäßrige Überzugsmittel und deren Verwendung in einem Verfahren zur Herstellung von Mehrschichtüberzügen | |
DE19837601A1 (de) | Verfahren zur Mehrschichtlackierung | |
DE4332015A1 (de) | Verfahren zur Herstellung von Decklackschichten |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AU BR CN JP MX PL US ZA |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 09980718 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2000938676 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref country code: JP Ref document number: 2001 500709 Kind code of ref document: A Format of ref document f/p: F |
|
WWP | Wipo information: published in national office |
Ref document number: 2000938676 Country of ref document: EP |
|
WWG | Wipo information: grant in national office |
Ref document number: 2000938676 Country of ref document: EP |