WO2000042188A2 - Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses - Google Patents
Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses Download PDFInfo
- Publication number
- WO2000042188A2 WO2000042188A2 PCT/US2000/000006 US0000006W WO0042188A2 WO 2000042188 A2 WO2000042188 A2 WO 2000042188A2 US 0000006 W US0000006 W US 0000006W WO 0042188 A2 WO0042188 A2 WO 0042188A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- mature
- amino acids
- polypeptide
- contiguous amino
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to compositions related to proteins which function in controlling physiology, development, and differentiation of mammalian cells, e.g., cells of a mammalian immune system.
- mammalian cells e.g., cells of a mammalian immune system.
- it provides nucleic acids, proteins, antibodies, and mimetics which regulate cellular physiology, development, differentiation, or function of various cell types, including hematopoietic cells.
- the immune system of vertebrates consists of a number of organs and several different cell types.
- Two major cell types include the myeloid and lymphoid lineages .
- lymphoid cell lineage are B cells, which were originally characterized as differentiating in fetal liver or adult bone marrow, and T cells, which were originally characterized as differentiating in the thy us . See, e.g., Paul (ed. 1998) Fundamental Immunology (4th ed. ) Raven Press, New York.
- cytokines In many aspects of the development of an immune response or cellular differentiation, soluble proteins known as cytokines play a critical role in regulating cellular interactions. These cytokines apparently mediate cellular activities in many ways. They have been shown, in many cases, to modulate proliferation, growth, and differentiation of hematopoietic stem cells into the vast number of progenitors composing the lineages responsible for an immune response. However, the cellular molecules which are expressed by different developmental stages of cells in these maturation pathways are still incompletely identified. Moreover, the roles and mechanisms of action of signaling molecules which induce, sustain, or modulate the various physiological, developmental, or proliferative states of these cells is poorly understood.
- Medical science relies, in large degree, to appropriate recruitment or suppression of the immune system in effecting cures for insufficient or improper physiological responses to environmental factors.
- the lack of understanding of how the immune system is regulated or differentiates has blocked the ability to advantageously modulate the normal defensive mechanisms to biological challenges.
- Medical conditions characterized by abnormal or inappropriate regulation of the development or physiology of relevant cells thus remain unmanageable.
- the discovery and characterization of specific cytokines will contribute to the development of therapies for a broad range of degenerative or other conditions which affect the immune system, hematopoietic cells, as well as other cell types.
- the present invention provides solutions to some of these and many other problems.
- the present invention is based, in part, upon the discovery of cDNA clones encoding various cytokine-like proteins which exhibit significant sequence similarity to the cytokine designated CTLA-8.
- the invention embraces isolated genes encoding the proteins of the invention, variants of the encoded proteins, e.g., mutations (muteins) of the natural sequences, species and allelic variants, fusion proteins, chemical mimetics, antibodies, and other structural or functional analogs. Various uses of these different nucleic acid or protein compositions are also provided.
- the invention provides an isolated or recombinant polynucleotide comprising sequence from: a) a mammalian IL-173, which: encodes at least 8 contiguous amino acids of SEQ ID NO: 6, 8, 10, or 12; encodes at least two distinct segments of at least 5 contiguous amino acids of SEQ ID NO : 6, 8, 10, or 12 ; or comprises one or more segments at least 21 contiguous nucleotides of SEQ ID NO: 5, 7,
- a mammalian IL-174 which: encodes at least 8 contiguous amino acids of SEQ ID NO: 14, 16, or 18; encodes at least two distinct segments of at least 5 contiguous amino acids of SEQ ID NO: 14, 16, or 18; or comprises one or more segments at least 21 contiguous nucleotides of SEQ ID NO: 14, 16, or 18;
- a mammalian IL-176 which: encodes at least 8 contiguous amino acids of SEQ ID NO: 28; encodes at least two distinct segments of at least 5 contiguous amino acids of SEQ ID NO: 28; or comprises one or more segments at least 21 contiguous nucleotides of SEQ ID NO: 27;
- a mammalian IL-177 which: encodes at least 8 contiguous amino acids of SEQ ID NO: 30; encodes at least two distinct segments of at least 5 contiguous amino acids of SEQ ID NO: 30; or comprises one or more segments at least 21 contiguous nucleotides of
- (IL-174) which: encodes at least 12 contiguous amino acids of SEQ ID NO: 14, 16, or 18; encodes at least two distinct segments of at least 7 and 10 contiguous amino acids of SEQ ID NO: 14, 16, or 18; or comprises at least 27 contiguous nucleotides of SEQ ID NO: 13, 15, or 17; c) (IL-176) which: encodes at least 12 contiguous amino acids of SEQ ID NO: 28; encodes at least two distinct segments of at least 7 and 10 contiguous amino acids of SEQ ID NO: 28; or comprises at least 27 contiguous nucleotides of SEQ ID NO: 27; or d) (IL-177) which: encodes at least 12 contiguous amino acids of SEQ ID NO: 30; encodes at least two distinct segments of at least 7 and 10 contiguous amino acids of SEQ ID NO: 30; or comprises at least 27 contiguous nucleotides of SEQ ID NO: 29.
- Certain embodiments will include those polynucleotides: a) (IL-173) which: encode at least 16 contiguous amino acid residues of SEQ ID NO: 6, 8, 10, or 12 ; encode at least two distinct segments of at least 10 and 13 contiguous amino acid residues of SEQ ID NO: 6, 8, 10, or 12; comprise at least 33 contiguous nucleotides of SEQ ID NO: 5, 7, 9, or 11; or comprise the entire mature coding portion of SEQ ID NO : 5, 7, 9, or 11; b) (IL-174) which: encode at least 16 contiguous amino acid residues of SEQ ID NO: 14, 16, or 18; encode at least two distinct segments of at least 10 and 13 contiguous amino acid residues of SEQ ID NO: 14, 16, or 18; comprise at least 33 contiguous nucleotides of SEQ ID NO: 13, 15, or 17; or comprise the entire mature coding portion of SEQ ID NO: 13, 15, or 17; c) (IL-176) which: encode at least 16 contiguous amino acids of SEQ ID NO: 28; encode at
- Various methods are provided, e.g., making: a) a polypeptide comprising expressing the described expression vector, thereby producing the polypeptide; b) a duplex nucleic acid comprising contacting a described polynucleotide with a complementary nucleic acid, thereby resulting in production of the duplex nucleic acid; or c) a described polynucleotide comprising amplifying using a PCR method.
- the invention provides an isolated or recombinant polynucleotide which hybridizes under stringent wash conditions of at least 55° C and less than 400 iriM salt to: a) the described (IL-173) polynucleotide which consists of the coding portion of SEQ ID NO: 5, 7, 9, or 11; b) the described (IL-174) polynucleotide which consists of the coding portion of SEQ ID NO: 13, 15, or 17; the described (IL-176) polynucleotide which consists of the coding portion of SEQ ID NO: 27; or d) the described (IL-177) polynucleotide which consists of the coding portion of SEQ ID NO: 29.
- wash conditions are at least 65° C and less than 300 M salt; or b) which comprises at least 50 contiguous nucleotides of the coding portion of: SEQ ID NO: 5, 7, 9, or 11 (IL-173); SEQ ID NO: 13, 15, or 17 (IL-174); SEQ ID NO: 27 (IL-176); or SEQ ID NO: 29 (IL-177) .
- kits comprising a described polynucleotide, and: a) instructions for the use of the polynucleotide for detection; b) instructions for the disposal of the polynucleotide or other reagents of the kit; or c) both a and b.
- a cell containing the described expression vector wherein the cell is: a prokaryotic cell; a eukaryotic cell; a bacterial cell; a yeast cell; an insect cell; a mammalian cell; a mouse cell; a primate cell; or a human cell.
- Polypeptide embodiments include, e.g., an isolated or recombinant antigenic polypeptide: a) (IL-173) comprising at least: i) one segment of 8 identical contiguous amino acids from SEQ ID NO: 6, 8, 10, or 12 ; or ii) two distinct segments of at least 5 contiguous amino acids from SEQ ID NO: 6, 8, 10, or 12; c) (IL-174) comprising at least: i) one segment of 8 identical contiguous amino acids from SEQ ID NO: 14, 16, or 18; or ii) two distinct segments of at least 5 contiguous amino acids from SEQ ID NO: 14, 16, or 18; c) (IL-176) comprising at least: i) one segment of 8 identical contiguous amino acids from SEQ ID NO: 28; or ii) two distinct segments of at least 5 contiguous amino acids from SEQ ID NO: 28; or d) (IL-177) comprising at least: i) one segment of 8 identical contiguous amino acids from SEQ ID NO: 30; or ii
- Additional embodiments include such a described polypeptide, wherein: a) the segment of 8 identical contiguous amino acids is at least 14 contiguous amino acids; or b) one of the segments of at least 5 contiguous amino acids comprises at least 7 contiguous amino acids.
- polypeptide comprises a mature sequence of SEQ ID NO: 6, 8, 10, or 12; b) binds with selectivity to a polyclonal antibody generated against an immunogen of a mature SEQ ID NO: 6, 8, 10, or 12; c) comprises a plurality of distinct polypeptide segments of 10 contiguous amino acids of SEQ ID NO : 6, 8, 10, or 12 ; d) is a natural allelic variant of SEQ ID NO: 6, 8, 10, or 12 ; e) has a length at least 30 amino acids; or f) exhibits at least two non-overlapping epitopes which are selective for the mature SEQ ID NO: 6, 8, 10, or 12 ; B) (IL-174) the polypeptide: a) comprises mature SEQ ID NO: 14, 16, or 18; b) binds with selectivity to a polyclonal antibody generated against an immunogen of mature SEQ ID NO: 14, 16, or 18; c) comprises a plurality
- Various other embodiments include such a described polypeptide, which: a) is in a sterile composition; b) is not glycosylated; c) is denatured; d) is a synthetic polypeptide; e) is attached to a solid substrate; f ) is a fusion protein with a detection or purification tag; g) is a 5-fold or less substitution from a natural sequence; or h) is a deletion or insertion variant from a natural sequence .
- Methods of using described polypeptides are also provided, e.g.,: a) to label the polypeptide, comprising labeling the polypeptide with a radioactive label; b) to separate the polypeptide from another polypeptide in a mixture, comprising running the mixture on a chromatography matrix, thereby separating the polypeptides ; c) to identify a compound that binds selectively to the polypeptide, comprising incubating the compound with the polypeptide under appropriate conditions; thereby causing the compound to bind to the polypeptide; or d) to conjugate the polypeptide to a matrix, comprising derivatizing the polypeptide with a reactive reagent, and conjugating the polypeptide to the matrix.
- Antibodies are also provided, including a binding compound comprising an antigen binding portion from an antibody which binds with selectivity to such a described polypeptide, wherein the polypeptide: a) (IL-173) comprises the mature polypeptide of SEQ ID NO: 6, 8, 10, or 12 ; b) (IL-174) comprises SEQ ID NO: 14, 16, or 18; c) (IL-176) comprises SEQ ID NO: 28; or d) (IL- 177) comprises SEQ ID NO: 30. Certain embodiments embrace such a binding compound, wherein the antibody is a polyclonal antibody which is raised against the polypeptide of: a) (IL- 173) SEQ ID NO: 6, 8, 10, or 12 ; b) (IL-174) SEQ ID NO: 14, 16, or 18 ?
- IL-176 SEQ ID NO: 28; or d) (IL-177) SEQ ID NO: 30.
- Other embodiments include such a described binding compound, wherein the: a) antibody: i) is immunoselected; ii) binds to a denatured protein; or iii) exhibits a Kd to the polypeptide of at least 30 mM; or b) the binding compound: i) is attached to a solid substrate, including a bead or plastic membrane; ii) is in a sterile composition; or iii) is detectably labeled, including a radioactive or fluorescent label.
- Methods are provided, e.g., producing an antigen: antibody complex, comprising contacting a polypeptide comprising sequence from SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 28, or 30 with a described binding compound under conditions which allow the complex to form.
- the binding compound is an antibody
- the polypeptide is in a biological sample.
- Kits are provided, e.g., comprising a described binding compound and: a) a polypeptide of SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 28, or 30; b) instructions for the use of the binding compound for detection; or c) instructions for the disposal of the binding compound or other reagents of the kit.
- a method if provided of evaluating the selectivity of binding of an antibody to a protein of SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 28, or 30, comprising contacting a described antibody to the protein and to another cytokine; and comparing binding of the antibody to the protein and the cytokine .
- the present invention provides DNA sequence encoding various mammalian proteins which exhibit structural features characteristic of cytokines, particularly related to the cytokine designated CTLA-8 (also referred to as IL-17) .
- CTLA-8 also referred to as IL-17
- Rat, mouse, human forms and a viral homolog of the CTLA-8 have been described and their sequences available from GenBank. See Rouvier, et al . (1993) J. Immunol. 150:5445-5456; Yao, et al . (1995) Immunity 3:811-821; Yao, et al . (1995) J. Immunol. 155:5483-5486; and Kennedy, et al . (1996) J. Interferon and
- Cytokine Res . 16:611-617 The CTLA-8 has activities implicated in arthritis, kidney graft rejection, tumorigenicity, virus- host interactions, and innate immunity; and appears to exhibit certain regulatory functions similar to IL-6. See PubMed (search for IL-17); Chabaud, et al . (1998) J. Immunol. 63:139- 148; Amin, et al . (1998) Curr. Qpin. Rheumatol. 10:263-268; Van Kooten, et al . (1998) J. Am. Soc . Nephrol . 9:1526-1534; Fossiez, et al . (1998) Int. Rev. Immunol.
- IL-17 is the first member of this newly recognized family of cytokines related to TGF- ⁇
- Applicants have designated the family IL-170, with the new members IL-172, IL-173, IL-174, IL-176, IL-177; and IL-171 and IL-175.
- the fold for this family is predicted to be that of the TGF- ⁇ family of cytokines.
- the TGF- ⁇ family of cytokines, and the IL-170 family share the common feature of a cystine knot motif, characterized by a particular spacing of cysteine residues. See, e.g., Sun and Davies (1995) Ann . Rev . Biophvs. Biomolec. Struct. 24:269-291; McDonald, et al .
- the fourth cysteine corresponds to that at mouse IL-172 (SEQ ID NO: 4) cysl41; at human IL-173 (SEQ ID NO: 6) cysll9; at mouse IL-174 (SEQ ID NO: 16) cysl04; and at human IL-171 (SEQ ID NO: 21) cys50.
- the disulfide linkages should be cysteines 2 with 5; and 3 with 6; and 1 with 4. Functional significance of the fold similarity suggests formation of dimers for the IL-170 family. As a consequence, IL-170 dimers would bring together two cell surface receptors, through which signal transduction will occur.
- CTLA-8 related proteins are designated CTLA-8 related, or generally IL-170, proteins.
- the natural proteins should be capable of mediating various physiological responses which would lead to biological or physiological responses in target cells, e.g., those responses characteristic of cytokine signaling.
- Initial studies had localized the message encoding this protein to various cell lines of hematopoietic cells.
- Genes encoding the original CTLA-8 (IL-17) antigen have been mapped to mouse chromosome IA and human chromosome 2q31.
- Murine CTLA-8 was originally cloned by Rouvier, et al . (1993) J. Immunol. 150:5445-5456.
- the human IL-173 has been mapped to chromosome 13qll. Similar sequences for proteins in other mammalian species should also be available.
- CTLA-8 when cultured with synoviocytes, is able to induce the secretion of IL-6 from these cells. This induction is reversed upon the addition of a neutralizing antibody raised against human CTLA-8. Endothelial, epithelial, fibroblast and carcinoma cells also exhibit responses to treatment with CTLA-8. This data suggests that CTLA-8 may be implicated in inflammatory fibrosis, e.g., psoriasis, scleroder ia, lung fibrosis, or cirrhosis. CTLA-8 may also cause proliferation of carcinomas or other cancer cells inasmuch as IL-6 often acts as a growth factor for such cells. As such, the newly discovered other related family members are likely to have similar or related biological activities. The descriptions below are directed, for exemplary purposes, to a murine or human IL-170 proteins, but are likewise applicable to related embodiments from other species.
- Tables 1-6 disclose the nucleotide and amino acid sequences of various new IL-170 family member sequences.
- the described nucleotide sequences and the related reagents are useful in constructing DNA clones useful for extending the clones in both directions for full length or flanking sequence detemination, expressing IL-170 polypeptides , or, e.g., isolating a homologous gene from another natural source.
- sequences will be useful in isolating other genes, e.g., allelic variants, from mouse, and similar procedures will be applied to isolate genes from other species, e.g., warm blooded animals, such as birds and mammals.
- Cross hybridization will allow isolation of genes from other species.
- a number of different approaches should be available to successfully isolate a suitable nucleic acid clone from other sources .
- Table 1 Nucleotide sequence encoding a primate, e . g . , human, IL-172 polypeptide and predicted amino acid sequence . Also can use complementary nucleic acid sequences for many purposes . Predicted signal cleavage site indicated, but may be a few residues on either side; putative glycosylation site at residues 55-57 . SEQ ID NO : 1 and 2 .
- Particularly interesting segments include, e . g . , those which begin or end with glnl ; vall9 ; pro20 ; pro22 ; lys34 ; pro35 ; leu78 ; ser79 ; glu98 ; ala99 ; phellO ; thrill ; cysl43 ; or argl44 .
- Nucleotide sequence encoding a rodent, e . g . , mouse, IL-172 polypeptide and predicted amino acid sequence can be used for many purposes .
- Particularly interesting segments include, e . g . , those which begin or end with argl ; alal7 ; prol ⁇ ; pro20 ; his21 ; lys32 ; pro33 ; leu76 ; ser77 ; glu96 ; ala97 ; phel08 ; thrl09 ; cysl41 ; or argl42 .
- Table 2 Nucleotide sequence encoding a primate , e . g . , human, IL-173 polypeptide and predicted amino acid sequence . Also can use complementary nucleic acid sequences for many purposes . SEQ ID NO : 5 and 6 .
- GAC CGC CGC TTC CGG ACG CCC ACC AAC CTG CGC AGC GTG TCG CCC TGG 192 Asp Arg Arg Phe Arg Thr Pro Thr Asn Leu Arg Ser Val Ser Pro Trp 50 55 60 GCC TAC AGA ATC TCC TAC GAC CCG GCG AGG TAC CCC AGG TAC CTG CCT 240
- Supplementary nucleotide sequence encoding a primate , e . g . , human, IL-173 polypeptide and predicted amino acid sequence . Also can use complementary nucleic acid sequences for many purposes .
- Important predicted motifs include, e.g., cAMP PK at 50-53, 66- 69, 72-75, and 113-116; Ca Phos at 82-84 and 166-168; myristoly sites at 57-61 and 164-166; phosphorylation sites at 50, 53, 72, 75, 80, 82, 113, and 116.
- Nucleotide sequence encoding a rodent, e.g., rat, IL-173 polypeptide and predicted amino acid sequence also can use complementary nucleic acid sequences for many purposes. SEQ ID NO: 9 and 10.
- FPRYLPEAYCLCRGCLTGLYGEEDFRFRSAPVFSPAWLRRTAA Supplementary nucleotide sequence encoding a rodent, e.g., mouse, IL-173 polypeptide and predicted amino acid sequence. Also can use complementary nucleic acid sequences for many purposes. SEQ ID NO: 11 and 12.
- Important predicted motifs include, e.g., cAMP PK sites at 50-53, 66-69, 72-75, and 113-116; Ca phosphorylation sites at 82-84, 159 161, and 166-168; myristoly sites at 57-61 and 101-105; N-glycosy sites at 51-53 and 164-166; phosphorylation sites at 50, 53, 72, 80, 82, 113, and 116; and PKC phosphorylation sites at 4-6
- Table 3 Nucleotide sequence encoding a primate, e.g., human, IL-174 polypeptide and predicted amino acid sequence. Also can use complementary nucleic acid sequences for many purposes. SEQ ID NO: 13 and 14. tgagtgtgca gtgccagc atg tac cag gtg gtt gca ttc ttg gca atg gtc 51
- cAMP PK sites at 21- 24 , 53 -56 , and 95 -98 Ca phosphorylation sites at 15 -17 , 16-18 , and 45-47 ; myristoly sites at 12 -16 , 115- 119 , and 118- 122 ; N- glycosyl site at 104-107 ; phosphorylation sites at 21 , 23 , 43 , 53 , 56 , 95 , 98 , and 131 ; PKC phosphorylation sites at 41-43 and 119 -121 ; and tyrosine kinase site at 95-102 .
- Nucleotide sequence encoding a rodent e . g . , mouse , IL-174 polypeptide and predicted amino acid sequence . Also can use complementary nucleic acid sequences for many purposes . SEQ ID NO : 15 and 16 .
- Important predicted motifs include, e.g., cAMP PK sites at 29- 32 and 61-64; Ca phosphorylation sites at 18-20, 53-55, and 67- 69; myristoly site at 123-127; N-glycosylation site at 112-114; and phosphorylation sites at 29, 31, 51, 53, 61, 64, 139, and 141; and PKC phosphorylation sites at 2-4, 49-51, and 127-129.
- Table 4 Nucleotide sequence encoding a primate, e.g., human, IL-171 under IUPAC code. Also can use complementary nucleic acid sequences for many purposes.
- SEQ ID NO: 20 and 21 are PATENTIN translatable cDNA and polypeptide sequences :
- GCT TCC CAC ATA CTT GGG
- GCT GGC ATC CCG nGC TGAGACAGCC CCCTGTTCTA 389 Ala Ser His He Leu Gly Ala Gly He Pro Xaa 115 120
- Table 5 Nucleotide sequence encoding a primate, e.g., human, IL-175 sequence under IUPAC code. Also can use complementary nucleic acid sequences for many purposes.
- SEQ ID NO: 25 and 26 are PATENTIN translatable cDNA and polypepti sequences. Predicted signal cleavage site indicated, but may be few residues on either side; putative glycosylation site at resid 53-55: GAGAAAGAGC TTCCTGCACA AAGTAAGCCA CCAGCGCAAC ATGACAGTGA AGACCCTGCA 60
- Particularly interesting segments include, e . g . , those which begin or end with argl ; cysl7 ; prol ⁇ , prol9 ; val20 ; thr49 ; ser50 ; arg69 ; pro70 ; and the end of the sequence available .
- Table 6 Nucleotide sequence encoding a primate, e . g . , human, IL-176 . Also can use complementary nucleic acid sequences for many purposes .
- SEQ ID NO : 27 and 28 tc gtg ccg tat ctt ttt aaa aaa att att ctt cac ttt ttt gcc tec 47
- Table 7 Alignment of various CTLA-8/IL-170 family members.
- the rat CTLA-8 sequence is SEQ ID NO: 31 (see GB L13839; 293329/30); mouse CTLA-8 sequence is SEQ ID NO: 32 (see GB 1469917/8); human CTLA-8 is SEQ ID NO: 33 (see GB U32659; 115222/3); and Herpes Sai iri virus ORF13 is SEQ ID NO: 34 (see GB Y13183; 2370235).
- IL-17_Hs PSVIWEAKCRYLGCVNADGN--VDYHMNSVPIQQEILWRKGHQPCPN SFR IL-17_Rt PSVI EAQCRHQRCVNAEGK--LDHHMNSVLIQQEILVLKREPEKCPF TFR
- Particularly intersting segments include, e.g., those corresponding to the segments of IL-172 or IL-175, indicated above, with the other family members.
- Purified protein or polypeptides are useful for generating antibodies by standard methods, as described above. Synthetic peptides or purified protein can be presented to an immune system to generate a specific binding composition, e.g. , monoclonal or polyclonal antibodies. See, e.g., Coligan (1991) Current Protocols in Immunology Wiley/Greene; and Harlow and
- the specific binding composition could be used for screening of an expression library made from a cell line which expresses an IL-170 protein.
- the screening can be standard staining of surface expressed protein, or by panning. Screening of intracellular expression can also be performed by various staining or immunofluorescence procedures.
- the binding compositions could be used to affinity purify or sort out cells expressing the protein.
- This invention contemplates use of isolated DNA or fragments to encode a biologically active corresponding IL-170 protein or polypeptide.
- this invention covers isolated or recombinant DNA which encodes a biologically active protein or polypeptide and which is capable of hybridizing under appropriate conditions with the DNA sequences described herein.
- Said biologically active protein or polypeptide can be an intact ' antigen, or fragment, and have an amino acid sequence as disclosed in Tables 1-6.
- this invention covers the use of isolated or recombinant DNA, or fragments thereof, which encode proteins which are homologous to an IL-170 protein or which were isolated using cDNA encoding an IL-170 protein as a probe.
- the isolated DNA can have the respective regulatory sequences in the 5' and 3' flanks, e.g., promoters, enhancers, poly-A addition signals, and others.
- nucleic acid is a nucleic acid, e.g., an RNA, DNA, or a mixed polymer, which is substantially separated from other components which naturally accompany a native sequence, e.g., ribosomes, polymerases, and flanking genomic sequences from the originating species.
- the term embraces a nucleic acid sequence which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogs or analogs biologically synthesized by heterologous systems.
- a substantially pure molecule includes isolated forms of the molecule.
- a purified species may be separated from host components from a recombinant expression system.
- the size of homology of such a nucleic acid will typically be less than large vectors, e.g., less than tens of kB, typically less than several kB, and preferably in the 2-6 kB range.
- An isolated nucleic acid will generally be a homogeneous composition of molecules, but will, in some embodiments, contain minor heterogeneity. This heterogeneity is typically found at the polymer ends or portions not critical to a desired biological function or activity.
- a "recombinant" nucleic acid is defined either by its method of production or its structure. In reference to its method of production, e.g., a product made by a process, the process is use of recombinant nucleic acid techniques, e.g., involving human intervention in the nucleotide sequence, typically selection or production. Alternatively, it can be a nucleic acid made by generating a sequence comprising fusion of two fragments which are not naturally contiguous to each other, but is meant to exclude products of nature, e.g., naturally occurring mutants. Thus, for example, products made by transforming cells with any unnaturally occurring vector is encompassed, as are nucleic acids comprising sequence derived using any synthetic oligonucleotide process.
- Such is often done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site.
- it is performed to join together nucleic acid segments of desired functions to generate a single genetic entity comprising a desired combination of functions not found in the commonly available natural forms.
- Restriction enzyme recognition sites are often the target of such artificial manipulations, but other site specific targets, e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design.
- a similar concept is intended for a recombinant, e.g., fusion, polypeptide.
- synthetic nucleic acids which, by genetic code redundancy, encode polypeptides similar to fragments of these antigens, and fusions of sequences from various different species variants.
- a significant "fragment" in a nucleic acid context is a contiguous segment of at least about 17 nucleotides, generally at least 20 nucleotides, more generally at least 23 nucleotides, ordinarily at least 26 nucleotides, more ordinarily at least 29 nucleotides, often at least 32 nucleotides, more often at least 35 nucleotides, typically at least 38 nucleotides, more typically at least 41 nucleotides, usually at least 44 nucleotides, more usually at least 47 nucleotides, preferably at least 50 nucleotides, more preferably at least 53 nucleotides, and in particularly preferred embodiments will be at least 56 or more nucleotides. Said fragments may have termini at any location, but especially at boundaries between structural domains .
- the invention provides polynucleotides (or polypeptides) which comprise a plurality of distinct, e.g., nonoverlapping, segments of the specified length.
- the plurality will be at least two, more usually at least three, and preferably 5, 7, or even more. While the length minima are provided, longer lengths, of various sizes, may be appropriate, e.g., one of length 7, and two of length 12.
- a DNA which codes for an IL-170 protein will be particularly useful to identify genes, RNA, and cDNA species which code for related or homologous proteins, as well as DNAs which code for homologous proteins from different species. There are likely homologues in other species, including primates.
- Various CTLA-8 proteins should be homologous and are encompassed herein. However, even proteins that have a more distant evolutionary relationship to the antigen can readily be isolated under appropriate conditions using these sequences if they are sufficiently homologous. Primate CTLA-8 protein proteins are of particular interest.
- This invention further covers recombinant DNA molecules and fragments having a DNA sequence identical to or highly homologous to the isolated DNAs set forth herein.
- the sequences will often be operably linked to DNA segments which control transcription, translation, and DNA replication.
- recombinant clones derived from the genomic sequences e.g., containing introns, will be useful for transgenic studies, including, e.g., transgenic cells and organisms, and for gene therapy. See, e.g., Goodnow (1992)
- homologous nucleic acid sequences when compared, exhibit significant similarity.
- the standards for homology in nucleic acids are either measures for homology generally used in the art by sequence comparison or based upon hybridization conditions. The hybridization conditions are described in greater detail below.
- Substantial homology in the nucleic acid sequence comparison context means either that the segments, or their complementary strands, when compared, are identical when optimally aligned, with appropriate nucleotide insertions or deletions, in at least about 50% of the nucleotides, generally at least 56%, more generally at least 59%, ordinarily at least 62%, more ordinarily at least 65%, often at least 68%, more often at least 71%, typically at least 74%, more typically at least 77%, usually at least 80%, more usually at least about 85%, preferably at least about 90%, more preferably at least about 95 to 98% or more, and in particular embodiments, as high at about 99% or more of the nucleotides.
- substantial homology exists when the segments will hybridize under selective hybridization conditions, to a strand, or its complement, typically using a sequence derived from Table 2, 3, or 6.
- selective hybridization will occur when there is at least about 55% homology over a stretch of at least about 14 nucleotides, preferably at least about 65%, more preferably at least about 75%, and most preferably at least about 90%. See, Kanehisa (1984) Nuc . Acids Res. 12:203-213.
- the length of homology comparison may be over longer stretches, and in certain embodiments will be over a stretch of at least about 17 nucleotides, usually at least about 20 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 40 nucleotides, preferably at least about 50 nucleotides, and more preferably at least about 75 to 100 or more nucleotides.
- Stringent conditions in referring to homology in the hybridization context, will be stringent combined conditions of salt, temperature, organic solvents, and other parameters, typically those controlled in hybridization reactions.
- Stringent temperature conditions will usually include temperatures in excess of about 30° C, more usually in excess of about 37° C, typically in excess of about 45° C, more typically in excess of about 55° C, preferably in excess of about 65° C, and more preferably in excess of about 70° C.
- Stringent salt conditions will ordinarily be less than about 1000 mM, usually less than about 500 mM, more usually less than about 400 mM, typically less than about 300 mM, preferably less than about 200 mM, and more preferably less than about 150 mM.
- Hybridization under stringent conditions should give a background of at least 2-fold over background, preferably at least 3-5 or more.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence (s) relative to the reference sequence, based on the designated program parameters.
- Optical alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1981) Adv. Ap l . Math. 2:482, by the homology alignment algorithm of Needleman and Wunsch (1970) . Mol .
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment.
- PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (1987) J. Mol . Evol . 35:351-360.
- the method used is similar to the method described by Higgins and Sharp (1989) CABIOS 5:151-153.
- the program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids.
- the multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments.
- the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. For example, a reference sequence can be compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps .
- HSPs high scoring sequence pairs
- the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and
- nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- a further indication that two nucleic acid sequences of polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions, as described below.
- CTLA-8-like proteins from other mammalian species can be cloned and isolated by cross-species hybridization of closely related species, e.g., human, as disclosed in Tables 1-7. Homology may be relatively low between distantly related species, and thus hybridization of relatively closely related species is advisable. Alternatively, preparation of an antibody preparation which exhibits less species specificity may be useful in expression cloning approaches .
- primate e.g., human
- rodent e.g., mouse
- IL-173 polypeptide sequence is shown in Table 2.
- primate e.g., human
- IL-174 sequence is assigned SEQ ID NO: 14.
- a rodent e.g., urine
- IL-174 is also described in Table 3.
- the peptide sequences allow preparation of peptides to generate antibodies to recognize such segments.
- rodent IL-170 protein shall encompass, when used in a protein context, a protein having designated amino acid sequences shown in Tables 1-7, or a significant fragment of such a protein. It also refers to a primate or rodent derived polypeptide which exhibits similar biological function or interacts with IL-170 protein specific binding components. These binding components, e.g., antibodies, typically bind to an IL-170 protein with high affinity, e.g., at least about 100 nM, usually better than about 30 nM, preferably better than about 10 nM, and more preferably at better than about 3 nM.
- Homologous proteins would be found in mammalian species other than rat or humans, e.g., mouse, primates, and in the herpes virus genome, e.g., ORF13. Non-mammalian species should also possess structurally or functionally related genes and proteins.
- polypeptide as used herein includes a significant fragment or segment, and encompasses a stretch of amino acid residues of at least about 8 amino acids, generally at least 10 amino acids, more generally at least 12 amino acids, often at least 14 amino acids, more often at least 16 amino acids, typically at least 18 amino acids, more typically at least 20 amino acids, usually at least 22 amino acids, more usually at least 24 amino acids, preferably at least 26 amino acids, more preferably at least 28 amino acids, and, in particularly preferred embodiments, at least about 30 or more amino acids.
- the specific ends of such a segment will be at any combinations within the protein, preferably encompassing structural domains.
- binding composition refers to molecules that bind with specificity to IL-170 protein, e.g., in a ligand- receptor type fashion, an antibody-antigen interaction, or compounds, e.g., proteins which specifically associate with IL- 170 protein, e.g., in a natural physiologically relevant protein-protein interaction, either covalent or non-covalent .
- the molecule may be a polymer, or chemical reagent. No implication as to whether IL-170 protein is either the ligand or the receptor of a ligand-receptor interaction is represented, other than the interaction exhibit similar specificity, e.g., specific affinity.
- a functional analog may be a protein with structural modifications, or may be a wholly unrelated molecule, e.g., which has a molecular shape which interacts with the appropriate binding determinants .
- the proteins may serve as agonists or antagonists of a receptor, see, e.g., Goodman, et al . (eds. 1990) Goodman & Gilman's: The Pharmacological Bases of Therapeutics (8th ed. ) , Pergamon Press .
- Solubility of a polypeptide or fragment depends upon the environment and the polypeptide. Many parameters affect polypeptide solubility, including temperature, electrolyte environment, size and molecular characteristics of the polypeptide, and nature of the solvent. Typically, the temperature at which the polypeptide is used ranges from about 4° C to about 65° C. Usually the temperature at use is greater than about 18° C and more usually greater than about 22° C. For diagnostic purposes, the temperature will usually be about room temperature or warmer, but less than the denaturation temperature of components in the assay. For therapeutic purposes, the temperature will usually be body temperature, typically about 37° C for humans, though under certain situations the temperature may be raised or lowered in situ or in vitro.
- the electrolytes will usually approximate in situ physiological conditions, but may be modified to higher or lower ionic strength where advantageous .
- the actual ions may be modified, e.g., to conform to standard buffers used in physiological or analytical contexts.
- the size and structure of the polypeptide should generally be in a substantially stable state, and usually not in a denatured state.
- the polypeptide may be associated with other polypeptides in a quaternary structure, e.g., to confer solubility, or associated with lipids or detergents in a manner which approximates natural lipid bilayer interactions.
- the solvent will usually be a biologically compatible buffer, of a type used for preservation of biological activities, and will usually approximate a physiological solvent.
- the solvent will have a neutral pH, typically between about 5 and 10, and preferably about 7.5.
- a detergent will be added, typically a mild non- denaturing one, e.g., CHS or CHAPS, or a low enough concentration as to avoid significant disruption of structural or physiological properties of the antigen.
- Solubility is reflected by sedimentation measured in Svedberg units, which are a measure of the sedimentation velocity of a molecule under particular conditions.
- the determination of the sedimentation velocity was classically performed in an analytical ultracentrifuge, but is typically now performed in a standard ultracentrifuge. See, Freifelder (1982) Physical Biochemistry (2d ed.), W.H. Freeman; and Cantor and Schimmel (1980) Biophysical Chemistry, parts 1-3, W.H. Freeman & Co., San Francisco.
- a sample containing a putatively soluble polypeptide is spun in a standard full sized ultracentrifuge at about 50K rpm for about 10 minutes, and soluble molecules will remain in the supernatant.
- a soluble particle or polypeptide will typically be less than about 3OS, more typically less than about 15S, usually less than about 10S, more usually less than about 6S, and, in particular embodiments, preferably less than about 4S, and more preferably less than about 3S.
- DNA which encodes the IL-170 protein or fragments thereof can be obtained by chemical synthesis, screening cDNA libraries, or by screening genomic libraries prepared from a wide variety of cell lines or tissue samples.
- This DNA can be expressed in a wide variety of host cells for the synthesis of a full-length protein or fragments which can in turn, for example, be used to generate polyclonal or monoclonal antibodies; for binding studies; for construction and expression of modified molecules; and for structure/function studies.
- Each antigen or its fragments can be expressed in host cells that are transformed or transfected with appropriate expression vectors. These molecules can be substantially purified to be free of protein or cellular contaminants, other than those derived from the recombinant host, and therefore are particularly useful in pharmaceutical compositions when combined with a pharmaceutically acceptable carrier and/or diluent.
- the antigen, or portions thereof, may be expressed as fusions with other proteins.
- Expression vectors are typically self-replicating DNA or RNA constructs containing the desired antigen gene or its fragments, usually operably linked to suitable genetic control elements that are recognized in a suitable host cell. These control elements are capable of effecting expression within a suitable host. The specific type of control elements necessary to effect expression will depend upon the eventual host cell used.
- the genetic control elements can include a prokaryotic promoter system or a eukaryotic promoter expression control system, and typically include a transcriptional promoter, an optional operator to control the onset of transcription, transcription enhancers to elevate the level of mKNA expression, a sequence that encodes a suitable riboso e binding site, and sequences that terminate transcription and translation.
- Expression vectors also usually contain an origin of replication that allows the vector to replicate independently of the host cell. Methods for amplifying vector copy number are also known, see, e.g., Kaufman, et al . (1985) Molec. and Cell. Biol. 5:1750-1759.
- the vectors of this invention contain DNA which encodes an IL-170 protein, or a fragment thereof, typically encoding a biologically active polypeptide.
- the DNA can be under the control of a viral promoter and can encode a selection marker.
- This invention further contemplates use of such expression vectors which are capable of expressing eukaryotic cDNA coding for an IL-170 protein in a prokaryotic or eukaryotic host, where the vector is compatible with the host and where the eukaryotic cDNA coding for the antigen is inserted into the vector such that growth of the host containing the vector expresses the cDNA in question.
- expression vectors are designed for stable replication in their host cells or for amplification to greatly increase the total number of copies of the desirable gene per cell.
- an expression vector replicate in a host cell e.g., it is possible to effect transient expression of the antigen or its fragments in various hosts using vectors that do not contain a replication origin that is recognized by the host cell. It is also possible to use vectors that cause integration of an IL-170 protein gene or its fragments into the host DNA by recombination, or to integrate a promoter which controls expression of an endogenous gene.
- Vectors as used herein, comprise plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles which enable the integration of DNA fragments into the genome of the host.
- Expression vectors are specialized vectors which contain genetic control elements that effect expression of operably linked genes. Plasmids are the most commonly used form of vector but all other forms of vectors which serve an equivalent function and which are, or become, known in the art are suitable for use herein. See, e.g., Pouwels, et al . (1985 and Supplements) Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., and Rodriguez, et al . (eds. 1988) Vectors : A Survey of Molecular Cloning Vectors and Their Uses, Buttersworth, Boston, MA.
- Transformed cells include cells, preferably mammalian, that have been transformed or transfected with vectors containing an IL-170 gene, typically constructed using recombinant DNA techniques.
- Transformed host cells usually express the antigen or its fragments, but for purposes of cloning, amplifying, and manipulating its DNA, do not need to express the protein.
- This invention further contemplates culturing transformed cells in a nutrient medium, thus permitting the protein to accumulate in the culture. The protein can be recovered, either from the culture or from the culture medium.
- DNA sequences are operably linked when they are functionally related to each other.
- DNA for a presequence or secretory leader is operably linked to a polypeptide if it is expressed as a preprotein or participates in directing the polypeptide to the cell membrane or in secretion of the polypeptide.
- a promoter is operably linked to a coding sequence if it controls the transcription of the polypeptide;
- a ribosome binding site is operably linked to a coding sequence if it is positioned to permit translation.
- operably linked means contiguous and in reading frame, however, certain genetic elements such as repressor genes are not contiguously linked but still bind to operator sequences that in turn control expression.
- Suitable host cells include prokaryotes, lower eukaryotes, and higher eukaryotes.
- Prokaryotes include both gram negative and gram positive organisms, e.g., E. coli and B. subtilis.
- Lower eukaryotes include yeasts, e.g., S. cerevisiae and Pichia, and species of the genus Dictyostelium.
- Higher eukaryotes include established tissue culture cell lines from animal cells, both of non-mammalian origin, e.g., insect cells, and birds, and of mammalian origin, e.g., human, primates, and rodents .
- Prokaryotic host-vector systems include a wide variety of vectors for many different species. As used herein, E. coli and its vectors will be used generically to include equivalent vectors used in other prokaryotes . A representative vector for amplifying DNA is pBR322 or many of its derivatives.
- Vectors that can be used to express the IL-170 proteins or its fragments include, but are not limited to, such vectors as those containing the lac promoter (pUC-series) ; trp promoter (pBR322-trp) ; Ipp promoter (the pIN-series) ; lambda-pP or pR promoters (pOTS) ; or hybrid promoters such as ptac (pDR540) . See Brosius, et al . (1988) "Expression Vectors Employing
- Lower eukaryotes e.g., yeasts and Dictyostelium, may be transformed with vectors encoding IL-170 proteins.
- yeasts and Dictyostelium may be transformed with vectors encoding IL-170 proteins.
- the most common lower eukaryotic host is the baker's yeast, Saccharomyces cerevisiae. It will be used to generically represent lower eukaryotes although a number of other strains and species are also available.
- Yeast vectors typically consist of a replication origin (unless of the integrating type) , a selection gene, a promoter, DNA encoding the desired protein or its fragments, and sequences for translation termination, polyadenylation, and transcription termination.
- Suitable expression vectors for yeast include such constitutive promoters as 3-phosphoglycerate kinase and various other glycolytic enzyme gene promoters or such inducible promoters as the alcohol dehydrogenase 2 promoter or metallothionine promoter.
- Suitable vectors include derivatives of the following types: self-replicating low copy number (such as the YRp-series) , self-replicating high copy number (such as the YEp-series) ; integrating types (such as the Yip-series) , or mini-chromosomes (such as the YCp-series) .
- Higher eukaryotic tissue culture cells are the preferred host cells for expression of the functionally active IL-170 protein. In principle, many higher eukaryotic tissue culture cell lines are workable, e.g., insect baculovirus expression systems, whether from an invertebrate or vertebrate source. However, mammalian cells are preferred, in that the processing, both cotranslationally and posttranslationally.
- Transformation or transfection and propagation of such cells has become a routine procedure.
- useful cell lines include HeLa cells, Chinese hamster ovary (CHO) cell lines, baby rat kidney (BRK) cell lines, insect cell lines, bird cell lines, and monkey (COS) cell lines.
- Expression vectors for such cell lines usually include an origin of replication, a promoter, a translation initiation site, RNA splice sites (if genomic DNA is used) , a polyadenylation site, and a transcription termination site. These vectors also usually contain a selection gene or amplification gene.
- Suitable expression vectors may be plasmids, viruses, or retroviruses carrying promoters derived, e.g., from such sources as from adenovirus, SV40, parvoviruses, vaccinia virus, or cytomegalovirus .
- suitable expression vectors include pCDNAl; pCD, see Okaya a, et al . (1985) Mol. Cell Biol. 5:1136- 1142; pMClneo Poly-A, see Thomas, et al . (1987) Cell 51:503- 512; and a baculovirus vector such as pAC 373 or pAC 610, see O'Reilly, et al .
- IL-170 protein polypeptide in a system which provides a specific or defined glycosylation pattern.
- the usual pattern will be that provided naturally by the expression system.
- the pattern will be modifiable by exposing the polypeptide, e.g., an unglycosylated form, to appropriate glycosylating proteins introduced into a heterologous expression system.
- the IL-170 protein gene may be co-transformed with one or more genes encoding mammalian or other glycosylating enzymes. Using this approach, certain mammalian glycosylation patterns will be achievable or approximated in prokaryote or other cells.
- the IL-170 protein, or a fragment thereof, may be engineered to be phosphatidyl inositol (PI) linked to a cell membrane, but can be removed from membranes by treatment with a phosphatidyl inositol cleaving enzyme, e.g., phosphatidyl inositol phospholipase-C .
- PI phosphatidyl inositol
- a phosphatidyl inositol cleaving enzyme e.g., phosphatidyl inositol phospholipase-C .
- IL-170 protein has been characterized, fragments or derivatives thereof can be prepared by conventional processes for synthesizing peptides. These include processes such as are described in Stewart and Young (1984) Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL; Bodanszky and Bodanszky (1984) The Practice of Peptide Synthesis, Springer-Verlag, New York; and Bodanszky (1984) The Principles of Peptide Synthesis, Springer-Verlag, New York.
- an azide process for example, an acid chloride process, an acid anhydride process, a mixed anhydride process, an active ester process (for example, p-nitrophenyl ester, N- hydroxysuccinimide ester, or cyanomethyl ester) , a carbodiimidazole process, an oxidative-reductive process, or a dicyclohexylcarbodiimide (DCCD) /additive process
- Solid phase and solution phase syntheses are both applicable to the foregoing processes.
- the IL-170 protein, fragments, or derivatives are suitably prepared in accordance with the above processes as typically employed in peptide synthesis, generally either by a so-called stepwise process which comprises condensing an amino acid to the terminal amino acid, one by one in sequence, or by coupling peptide fragments to the terminal amino acid. Amino groups that are not being used in the coupling reaction are typically protected to prevent coupling at an incorrect location.
- the C-terminal amino acid is bound to an insoluble carrier or support through its carboxyl group.
- the insoluble carrier is not particularly limited as long as it has a binding capability to a reactive carboxyl group.
- examples of such insoluble carriers include halomethyl resins, such as chloromethyl resin or bromomethyl resin, hydroxymethyl resins, phenol resins, tert- alkyloxycarbonyl-hydrazidated resins, and the like.
- An amino group-protected amino acid is bound in sequence through condensation of its activated carboxyl group and the reactive amino group of the previously formed peptide or chain, to synthesize the peptide step by step. After synthesizing the complete sequence, the peptide is split off from the insoluble carrier to produce the peptide.
- This solid-phase approach is generally described by Merrifield, et al . (1963) in J . Am. Chem. Soc. 85:2149-2156.
- the prepared protein and fragments thereof can be isolated and purified from the reaction mixture by means of peptide separation, for example, by extraction, precipitation, electrophoresis and various forms of chromatography, and the like.
- the IL-170 proteins of this invention can be obtained in varying degrees of purity depending upon its desired use. Purification can be accomplished by use of the protein purification techniques disclosed herein or by the use of the antibodies herein described in immunoabsorbant affinity chromatography.
- This immunoabsorbant affinity chromatography is carried out by first linking the antibodies to a solid support and then contacting the linked antibodies with solubilized lysates of appropriate source cells, lysates of other cells expressing the protein, or lysates or supernatants of cells producing the IL-170 protein as a result of DNA techniques, see below.
- This invention also encompasses proteins or peptides having substantial amino acid sequence homology with the amino acid sequence of the IL-170 protein.
- the variants include species or allelic variants.
- Amino acid sequence homology, or sequence identity is determined by optimizing residue matches, if necessary, by introducing gaps as required. This changes when considering conservative substitutions as matches.
- Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- homologous amino acid sequences are typically intended to include natural allelic and interspecies variations in each respective protein sequence.
- Typical homologous proteins or peptides will have from 25-100% homology (if gaps can be introduced), to 50-100% homology (if conservative substitutions are included) with the amino acid sequence of the IL-170 protein.
- Homology measures will be at least about 35%, generally at least 40%, more generally at least 45%, often at least 50%, more often at least 55%, typically at least 60%, more typically at least 65%, usually at least 70%, more usually at least 75%, preferably at least 80%, and more preferably at least 80%, and in particularly preferred embodiments, at least 85% or more. See also Needleham, et al . (1970) J. Mol. Biol. 48:443-453; Sankoff, et al .
- the isolated DNA encoding an IL-170 protein can be readily modified by nucleotide substitutions, nucleotide deletions, nucleotide insertions, and inversions of nucleotide stretches. These modifications result in novel DNA sequences which encode these antigens, their derivatives, or proteins having similar physiological, immunogenic, or antigenic activity. These modified sequences can be used to produce mutant antigens or to enhance expression. Enhanced expression may involve gene amplification, increased transcription, increased translation, and other mechanisms. Such mutant IL-170 protein derivatives include predetermined or site-specific mutations of the respective protein or its fragments.
- “Mutant IL-170 protein” encompasses a polypeptide otherwise falling within the homology definition of the murine IL-170 or human IL-170 protein as set forth above, but having an amino acid sequence which differs from that of IL-170 protein as found in nature, whether by way of deletion, substitution, or insertion.
- site specific mutant IL-170 protein generally includes proteins having significant homology with the corresponding protein having sequences from Tables 1-6, and as sharing various biological activities, e.g., antigenic or immunogenic, with those sequences, and in preferred embodiments contain most of the disclosed sequences. Similar concepts apply to different IL-170 proteins, particularly those found in various warm blooded animals, e.g., mammals and birds. As stated before, it is emphasized that descriptions are generally meant to encompass all IL-170 proteins, not limited to the mouse embodiment specifically discussed.
- IL-170 protein mutagenesis can be conducted by making amino acid insertions or deletions. Substitutions, deletions, insertions, or any combinations may be generated to arrive at a final construct. Insertions include amino- or carboxy- terminal fusions . Random mutagenesis can be conducted at a target codon and the expressed mutants can then be screened for the desired activity. Methods for making substitution mutations at predetermined sites in DNA having a known sequence are well known in the art, e.g., by M13 primer mutagenesis or polymerase chain reaction (PCR) techniques. See also Sambrook, et al . (1989) and Ausubel , et al . (1987 and Supplements).
- PCR polymerase chain reaction
- the mutations in the DNA normally should not place coding sequences out of reading frames and preferably will not create complementary regions that could hybridize to produce secondary mRNA structure such as loops or hairpins.
- the present invention also provides recombinant proteins, e.g., heterologous fusion proteins using segments from these proteins.
- a heterologous fusion protein is a fusion of proteins or segments which are naturally not normally fused in the same manner.
- the fusion product of an immunoglobulin with an IL-170 polypeptide is a continuous protein molecule having sequences fused in a typical peptide linkage, typically made as a single translation product and exhibiting properties derived from each source peptide.
- a similar concept applies to heterologous nucleic acid sequences.
- new constructs may be made from combining similar functional domains from other proteins.
- antigen-binding or other segments may be "swapped" between different new fusion polypeptides or fragments. See, e.g., Cunningham, et al . (1989) Science 243:1330-1336; and O'Dowd, et al. (1988) J. Biol. Chem. 263:15985-15992.
- new chimeric polypeptides exhibiting new combinations of specificities will result from the functional linkage of biologically relevant domains and other functional domains .
- the phosphoramidite method described by Beaucage and Carruthers (1981) Tetra . Letts.
- a double stranded fragment will often be obtained either by synthesizing the complementary strand and annealing the strand together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence, e.g., PCR techniques .
- IL-170 proteins may result from the inhibition of binding of the antigen to its natural binding partner, e.g., through competitive inhibition.
- in vitro assays of the present invention will often use isolated protein, membranes from cells expressing a recombinant membrane associated IL-170 protein, soluble fragments comprising binding segments, or fragments attached to solid phase substrates. These assays will also allow for the diagnostic determination of the effects of either binding segment mutations and modifications, or protein mutations and modifications, e.g., analogs.
- This invention also contemplates the use of competitive drug screening assays, e.g., where neutralizing antibodies to antigen or binding partner fragments compete with a test compound for binding to the protein.
- the antibodies can be used to detect the presence of any polypeptide which shares one or more antigenic binding sites of the protein and can also be used to occupy binding sites on the protein that might otherwise interact with a binding partner.
- neutralizing antibodies against the IL-170 protein and soluble fragments of the antigen which contain a high affinity receptor binding site can be used to inhibit antigen function in tissues, e.g., tissues experiencing abnormal physiology.
- “Derivatives” of the IL-170 antigens include amino acid sequence mutants, glycosylation variants, and covalent or aggregate conjugates with other chemical moieties.
- Covalent derivatives can be prepared by linkage of functionalities to groups which are found in the IL-170 amino acid side chains or at the N- or C- termini, by means which are well known in the art. These derivatives can include, without limitation, aliphatic esters or amides of the carboxyl terminus, or of residues containing carboxyl side chains, O-acyl derivatives of hydroxyl group-containing residues, and N-acyl derivatives of the amino terminal amino acid or amino-group containing residues, e.g., lysine or arginine .
- Acyl groups are selected from the group of alkyl-moieties including C3 to C18 normal alkyl, thereby forming alkanoyl aroyl species. Covalent attachment to carrier proteins may be important when immunogenic moieties are haptens .
- glycosylation alterations are included, e.g., made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing, or in further processing steps. Particularly preferred means for accomplishing this are by exposing the polypeptide to glycosylating enzymes derived from cells which normally provide such processing, e.g., mammalian glycosylation enzymes. Deglycosylation enzymes are also contemplated. Also embraced are versions of the same primary amino acid sequence which have other minor modifications, including phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine .
- a major group of derivatives are covalent conjugates of the IL-170 protein or fragments thereof with other proteins or polypeptides. These derivatives can be synthesized in recombinant culture such as N- or C-terminal fusions or by the use of agents known in the art for their usefulness in cross- linking proteins through reactive side groups. Preferred antigen derivatization sites with cross-linking agents are at free amino groups, carbohydrate moieties, and cysteine residues .
- Fusion polypeptides between the IL-170 proteins and other homologous or heterologous proteins are also provided.
- Homologous polypeptides may be fusions between different surface markers, resulting in, e.g., a hybrid protein exhibiting receptor binding specificity.
- heterologous fusions may be constructed which would exhibit a combination of properties or activities of the derivative proteins.
- Typical examples are fusions of a reporter polypeptide, e.g., luciferase, with a segment or domain of an antigen, e.g., a receptor-binding segment, so that the presence or location of the fused antigen may be easily determined. See, e.g., Dull, et al . , U.S. Patent No. 4,859,609.
- Other gene fusion partners include bacterial ⁇ -galactosidase, trpE,
- Protein A Protein A, ⁇ -lactamase, alpha amylase, alcohol dehydrogenase, and yeast alpha mating factor. See, e.g., Godowski, et al . (1988) Science 241:812-816.
- polypeptides may also have amino acid residues which have been chemically modified by phosphorylation, sulfonation, biotinylation, or the addition or removal of other moieties, particularly those which have molecular shapes similar to phosphate groups.
- the modifications will be useful labeling reagents, or serve as purification targets, e.g., affinity ligands.
- Fusion proteins will typically be made by either recombinant nucleic acid methods or by synthetic polypeptide methods. Techniques for nucleic acid manipulation and expression are described generally, for example, in Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed. ) , Vols. 1-3, Cold Spring Harbor Laboratory. Techniques for synthesis of polypeptides are described, for example, in
- This invention also contemplates the use of derivatives of the IL-170 proteins other than variations in amino acid sequence or glycosylation. Such derivatives may involve covalent or aggregative association with chemical moieties. These derivatives generally fall into the three classes: (1) salts, (2) side chain and terminal residue covalent modifications, and (3) adsorption complexes, for example with cell membranes.
- covalent or aggregative derivatives are useful as immunogens, as reagents in immunoassays, or in purification methods such as for affinity purification of antigens or other binding proteins.
- an IL-170 antigen can be immobilized by covalent bonding to a solid support such as cyanogen bromide-activated Sepharose, by methods which are well known in the art, or adsorbed onto polyolefin surfaces, with or without glutaraldehyde cross- linking, for use in the assay or purification of anti-IL-170 protein antibodies or its receptor or other binding partner.
- the IL-170 antigens can also be labeled with a detectable group, for example radioiodinated by the chloramine T procedure, covalently bound to rare earth chelates, or conjugated to another fluorescent moiety for use in diagnostic assays.
- a detectable group for example radioiodinated by the chloramine T procedure, covalently bound to rare earth chelates, or conjugated to another fluorescent moiety for use in diagnostic assays.
- Purification of IL-170 protein may be effected by immobilized antibodies or binding partners .
- a solubilized IL-170 antigen or fragment of this invention can be used as an immunogen for the production of antisera or antibodies specific for the protein or fragments thereof.
- the purified antigen can be used to screen monoclonal antibodies or binding fragments prepared by immunization with various forms of impure preparations containing the protein.
- the term "antibodies” also encompasses antigen binding fragments of natural antibodies.
- the purified IL-170 proteins can also be used as a reagent to detect any antibodies generated in response to the presence of elevated levels of the protein or cell fragments containing the antigen, both of which may be diagnostic of an abnormal or specific physiological or disease condition. Additionally, antigen fragments may also serve as immunogens to produce the antibodies of the present invention, as described immediately below.
- this invention contemplates antibodies raised against amino acid sequences encoded by nucleotide sequences shown in Tables 1-6, or fragments of proteins containing them.
- this invention contemplates antibodies having binding affinity to or being raised against specific fragments which are predicted to lie outside of the lipid bilayer.
- the present invention contemplates the isolation of additional closely related species variants. Southern blot analysis established that similar genetic entities exist in other mammals, e.g., rat and human. It is likely that the IL- 170 proteins are widespread in species variants, e.g., rodents, lagomorphs, carnivores, artiodactyla, perissodactyla, and primates .
- the invention also provides means to isolate a group of related antigens displaying both distinctness and similarities in structure, expression, and function. Elucidation of many of the physiological effects of the antigens will be greatly accelerated by the isolation and characterization of distinct species variants.
- the present invention provides useful probes for identifying additional homologous genetic entities in different species.
- the isolated genes will allow transformation of cells lacking expression of a corresponding IL-170 protein, e.g., either species types or cells which lack corresponding antigens and should exhibit negative background activity. Expression of transformed genes will allow isolation of antigenically pure cell lines, with defined or single specie variants. This approach will allow for more sensitive detection and discrimination of the physiological effects of IL-170 proteins.
- Subcellular fragments e.g., cytoplasts or membrane fragments
- cytoplasts or membrane fragments can be isolated and used. Dissection of the critical structural elements which effect the various physiological or differentiation functions provided by the proteins is possible using standard techniques of modern molecular biology, particularly in comparing members of the related class. See, e.g., the homolog-scanning mutagenesis technique described in Cunningham, et al . (1989) Science 243:1339-1336; and approaches used in O'Dowd, et al . (1988) J. Biol. Chem. 263:15985-15992; and Lechleiter, et al . (1990) EMBO J. 9:4381-4390.
- functional domains or segments can be substituted between species variants to determine what structural features are important in both binding partner affinity and specificity, as well as signal transduction.
- An array of different variants will be used to screen for molecules exhibiting combined properties of interaction with different species variants of binding partners.
- Antigen internalization may occur under certain circumstances, and interaction between intracellular components and "extracellular" segments of proteins involved in interactions may occur.
- the specific segments of interaction of IL-170 protein with other intracellular components may be identified by mutagenesis or direct biochemical means, e.g., cross-linking or affinity methods. Structural analysis by crystallographic or other physical methods will also be applicable. Further investigation of the mechanism of biological function will include study of associated components which may be isolatable by affinity methods or by genetic means, e.g., complementation analysis of mutants.
- the controlling elements associated with the antigens may exhibit differential developmental, tissue specific, or other expression patterns. Upstream or downstream genetic regions, e.g., control elements, are of interest. Structural studies of the antigen will lead to design of new variants, particularly analogs exhibiting agonist or antagonist properties on binding partners. This can be combined with previously described screening methods to isolate variants exhibiting desired spectra of activities. Expression in other cell types will often result in glycosylation differences in a particular antigen. Various species variants may exhibit distinct functions based upon structural differences other than amino acid sequence. Differential modifications may be responsible for differential function, and elucidation of the effects are now made possible.
- the present invention provides important reagents related to antigen-binding partner interaction.
- antigen-binding partner interaction e.g., murine IL- 170 and human IL-170 protein
- the invention encompasses other antigens, e.g., mouse and other mammalian species or allelic variants, as well as variants thereof.
- Antibodies can be raised to the various IL-170 proteins, including species or allelic variants, and fragments thereof, both in their naturally occurring forms and in their recombinant forms. Additionally, antibodies can be raised to IL-170 proteins in either their active forms or in their inactive forms. Anti-idiotypic antibodies are also contemplated.
- Antibodies, including binding fragments and single chain versions, against predetermined fragments of the antigens can be raised by immunization of animals with conjugates of the fragments with immunogenic proteins.
- Monoclonal antibodies are prepared from cells secreting the desired antibody. These antibodies can be screened for binding to normal or defective IL-170 proteins, or screened for agonistic or antagonistic activity, e.g., mediated through a binding partner. These monoclonal antibodies will usually bind with at least a Krj of about 1 mM, more usually at least about 300 ⁇ M, typically at least about 10 ⁇ M, more typically at least about 30 ⁇ M, preferably at least about 10 ⁇ M, and more preferably at least about 3 ⁇ M or better.
- An IL-170 polypeptide that specifically binds to or that is specifically immunoreactive with an antibody e.g., such as a polyclonal antibody, generated against a defined immunogen, e.g., such as an immunogen consisting of an amino acid sequence of mature SEQ ID NO: 8 or fragments thereof or a polypeptide generated from the nucleic acid of SEQ ID NO : 7 is typically determined in an immunoassay.
- an antibody e.g., such as a polyclonal antibody
- a defined immunogen e.g., such as an immunogen consisting of an amino acid sequence of mature SEQ ID NO: 8 or fragments thereof or a polypeptide generated from the nucleic acid of SEQ ID NO : 7 is typically determined in an immunoassay.
- the immunoassay typically uses a polyclonal antiserum which was raised, e.g., to a protein of SEQ ID NO: 8. This antiserum is selected to have low crossreactivity against appropriate other IL-170 family members, preferably from the same species, and any such crossreactivity is removed by immunoabsorption prior to use in the immunoassay. Appropriate selective serum preparations can be isolated, and characterized.
- the protein e.g., of SEQ ID NO: 8 is isolated as described herein.
- recombinant protein may be produced in a mammalian cell line.
- An appropriate host e.g., an inbred strain of mice such as Balb/c, is immunized with the protein of SEQ ID NO: 8 using a standard adjuvant, such as Freund's adjuvant, and a standard mouse immunization protocol (see Harlow and Lane) .
- a substantially full length synthetic peptide derived from the sequences disclosed herein can be used as an immunogen.
- Polyclonal sera are collected and titered against the immunogen protein in an immunoassay, e.g., a solid phase immunoassay with the immunogen immobilized on a solid support.
- an immunoassay e.g., a solid phase immunoassay with the immunogen immobilized on a solid support.
- Polyclonal antisera with a titer of 10 ⁇ or greater are selected and tested for their cross reactivity against other IL-170 family members, e.g., IL-171, IL-172, or IL-175, using a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573.
- IL-170 family members e.g., IL-171, IL-172, or IL-175
- a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573.
- at least two IL-170 family members are used in this determination in conjunction with the target.
- IL-170 family members can be produced as recombinant proteins and isolated using standard molecular biology and protein chemistry techniques as described herein. Thus, antibody preparations can be identified or produced having desired selectivity or specificity for subsets of IL-170 family members.
- Immunoassays in the competitive binding format can be used for the crossreactivity determinations.
- the protein of mature SEQ ID NO: 8 can be immobilized to a solid support. Proteins added to the assay compete with the binding of the antisera to the immobilized antigen. The ability of the above proteins to compete with the binding of the antisera to the immobilized protein is compared to the protein of SEQ ID NO: 8. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the proteins listed above are selected and pooled. The cross-reacting antibodies are then removed from the pooled antisera by immunoabsorption with the above-listed proteins.
- the i munoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein to the immunogen protein.
- the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required is less than twice the amount of the protein of, e.g., SEQ ID NO: 8 that is required, then the second protein is said to specifically bind to an antibody generated to the immunogen.
- the antibodies, including antigen binding fragments, of this invention can have significant diagnostic or therapeutic value.
- They can be potent antagonists that bind to a binding partner and inhibit antigen binding or inhibit the ability of an antigen to elicit a biological response. They also can be useful as non-neutralizing antibodies and can be coupled to toxins or radionuclides so that when the antibody binds to the antigen, a cell expressing it, e.g., on its surface, is killed. Further, these antibodies can be conjugated to drugs or other therapeutic agents, either directly or indirectly by means of a linker, and may effect drug targeting.
- the antibodies of this invention can also be useful in diagnostic applications. As capture or non-neutralizing antibodies, they can be screened for ability to bind to the antigens without inhibiting binding by a partner. As neutralizing antibodies, they can be useful in competitive binding assays. They will also be useful in detecting or quantifying IL-170 protein or its binding partners. See, e.g., Chan (ed. 1987) Immunoassay: A Practical Guide Academic Press, Orlando, Fla.; Ngo (ed. 1988) Nonisotopic Immunoassay Plenum Press, NY; and Price and Newman (eds. 1991) Principles and Practice of Immunoassay Stockton Press, NY.
- Antigen fragments may be joined to other materials, particularly polypeptides, as fused or covalently joined polypeptides to be used as immunogens .
- An antigen and its fragments may be fused or covalently linked to a variety of immunogens, such as keyhole limpet hemocyanin, bovine serum albumin, tetanus toxoid, etc. See Microbiology, Hoeber Medical Division, Harper and Row, 1969; Landsteiner (1962) Specificity of Serological Reactions, Dover Publications, New York, and Williams, et al . (1967) Methods in Immunology and Immunochemistrv, Vol. 1, Academic Press, New York, for descriptions of methods of preparing polyclonal antisera.
- a typical method involves hyperimmunization of an animal with an antigen. The blood of the animal is then collected shortly after the repeated immunizations and the gamma globulin is isolated.
- monoclonal antibodies from various mammalian hosts, such as mice, rodents, primates, humans, etc.
- Description of techniques for preparing such monoclonal antibodies may be found in, e.g., Stites, et al . (eds.) Basic and Clinical Immunology (4th ed.), Lange Medical Publications, Los Altos, CA, and references cited therein; Harlow and Lane (1988) Antibodies : A Laboratory Manual , CSH Press; Goding (1986) Monoclonal Antibodies : Principles and Practice (2d ed.
- the polypeptides and antibodies of the present invention may be used with or without modification, including chimeric or humanized antibodies. Frequently, the polypeptides and antibodies will be labeled by joining, either covalently or non-covalently, a substance which provides for a detectable signal.
- labels and conjugation techniques are known and are reported extensively in both the scientific and patent literature. Suitable labels include radionuclides, enzymes, substrates, cofactors, inhibitors, fluorescent moieties, chemiluminescent moieties, magnetic particles, and the like.
- Patents teaching the use of such labels include U.S. Patent Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241. Also, recombinant immunoglobulins may be produced, see Cabilly, U.S. Patent No. 4,816,567.
- the antibodies of this invention can also be used for affinity chromatography in isolating the protein.
- Columns can be prepared where the antibodies are linked to a solid support, e.g., particles, such as agarose, Sephadex, or the like, where a cell lysate may be passed through the column, the column washed, followed by increasing concentrations of a mild denaturant, whereby the purified IL-170 protein will be released.
- the antibodies may also be used to screen expression libraries for particular expression products. Usually the antibodies used in such a procedure will be labeled with a moiety allowing easy detection of presence of antigen by antibody binding.
- Antibodies raised against each IL-170 protein will also be useful to raise anti-idiotypic antibodies. These will be useful in detecting or diagnosing various immunological conditions related to expression of the respective antigens.
- the present invention provides reagents which will find use in diagnostic applications as described elsewhere herein, e.g., in the general description for physiological or developmental abnormalities, or below in the description of kits for diagnosis.
- IL-170 protein naturally occurring or recombinant
- fragments thereof, and antibodies thereto should be useful in the treatment of conditions associated with abnormal physiology or development, including abnormal proliferation, e.g., cancerous conditions, or degenerative conditions.
- Abnormal proliferation, regeneration, degeneration, and atrophy may be modulated by appropriate therapeutic treatment using the compositions provided herein.
- a disease or disorder associated with abnormal expression or abnormal signaling by an IL-170 antigen should be a likely target for an agonist or antagonist of the protein.
- Recombinant antibodies which bind to IL-170 can be purified and then administered to a patient.
- These reagents can be combined for therapeutic use with additional active or inert ingredients, e.g., in conventional pharmaceutically acceptable carriers or diluents, e.g., immunogenic adjuvants, along with physiologically innocuous stabilizers and excipients.
- additional active or inert ingredients e.g., in conventional pharmaceutically acceptable carriers or diluents, e.g., immunogenic adjuvants, along with physiologically innocuous stabilizers and excipients.
- These combinations can be sterile filtered and placed into dosage forms as by lyophilization in dosage vials or storage in stabilized aqueous preparations.
- This invention also contemplates use of antibodies or binding fragments thereof, including forms which are not complement binding.
- IL-170 for binding partners or compounds having binding affinity to IL-170 antigen can be performed, including isolation of associated components. Subsequent biological assays can then be utilized to determine if the compound has intrinsic biological activity and is therefore an agonist or antagonist in that it blocks an activity of the antigen.
- This invention further contemplates the therapeutic use of antibodies to IL-170 protein as antagonists. This approach should be particularly useful with other IL-170 protein species variants.
- reagents necessary for effective therapy will depend upon many different factors, including means of administration, target site, physiological state of the patient, and other medicants administered. Thus, treatment dosages should be titrated to optimize safety and efficacy.
- dosages used in vitro may provide useful guidance in the amounts useful for in situ administration of these reagents.
- Animal testing of effective doses for treatment of particular disorders will provide further predictive indication of human dosage.
- Various considerations are described, e.g., in Gilman, et al . (eds. 1990) Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; and Remington's Pharmaceutical Sciences, 17th ed. (1990) , Mack Publishing Co., Easton, Perm. Methods for administration are discussed therein and below, e.g., for oral, intravenous, intraperitoneal, or intramuscular administration, transdermal diffusion, and others.
- Pharmaceutically acceptable carriers will include water, saline, buffers, and other compounds described, e.g., in the Merck Index, Merck & Co . , Rahway, New Jersey. Dosage ranges would ordinarily be expected to be in amounts lower than 1 mM concentrations, typically less than about 10 ⁇ M concentrations, usually less than about 100 nM, preferably less than about 10 pM (picomolar) , and most preferably less than about 1 fM (femtomolar) , with an appropriate carrier. Slow release formulations, or a slow release apparatus will often be utilized for continuous administration.
- IL-170 protein, fragments thereof, and antibodies to it or its fragments, antagonists, and agonists may be administered directly to the host to be treated or, depending on the size of the compounds, it may be desirable to conjugate them to carrier proteins such as ovalbumin or serum albumin prior to their administration.
- Therapeutic formulations may be administered in any conventional dosage formulation. While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical formulation.
- Formulations typically comprise at least one active ingredient, as defined above, together with one or more acceptable carriers thereof . Each carrier should be both pharmaceutically and physiologically acceptable in the sense of being compatible with the other ingredients and not injurious to the patient.
- Formulations include those suitable for oral, rectal, nasal, or parenteral (including subcutaneous, intramuscular, intravenous and intradermal) administration.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. See, e.g., Gilman, et al . (eds. 1990) Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th Ed. , Pergamon Press, Parrytown, NY; Remington's Pharmaceutical Sciences, 17th ed. (1990) Mack Publishing Co., Easton, Penn. ; Avis, et al . (eds. 1993) Pharmaceutical Dosage Forms: Parenteral Medications 2d ed.
- the therapy of this invention may be combined with or used in association with other therapeutic, including cytokine, reagents.
- kits and assay methods which are capable of screening compounds for binding activity to the proteins.
- automating assays have been developed in recent years so as to permit screening of tens of thousands of compounds in a short period. See, e.g., Fodor, et al . (1991) Science 251:767-773, which describes means for testing of binding affinity by a plurality of defined polymers synthesized on a solid substrate.
- suitable assays can be greatly facilitated by the availability of large amounts of purified, soluble IL-170 protein as provided by this invention.
- This invention is particularly useful for screening compounds by using recombinant antigen in any of a variety of drug screening techniques.
- the advantages of using a recombinant protein in screening for specific ligands include: (a) improved renewable source of the antigen from a specific source; (b) potentially greater number of antigen molecules per cell giving better signal to noise ratio in assays; and (c) species variant specificity (theoretically giving greater biological and disease specificity) .
- the purified protein may be tested in numerous assays, typically in vitro assays, which evaluate biologically relevant responses. See, e.g., Coligan Current Protocols in Immunology; Hood, et al . Immunology Benjamin/Cummings; Paul (ed. ) Fundamental Immunology; and Methods in Enzymology Academic Press.
- One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant DNA molecules expressing the IL-170 antigens.
- Cells may be isolated which express an antigen in isolation from other functionally equivalent antigens.
- Such cells either in viable or fixed form, can be used for standard protein-protein binding assays. See also, Parce, et al . (1989) Science 246:243-247; and Owicki, et al . (1990) Proc . Nat ' 1 Acad. Sci. USA 87:4007-4011, which describe sensitive methods to detect cellular responses.
- Viable cells could also be used to screen for the effects of drugs on IL-170 protein mediated functions, e.g., second messenger levels, i.e., Ca ++ ; cell proliferation; inositol phosphate pool changes; and others.
- second messenger levels i.e., Ca ++
- cell proliferation i.e., cell proliferation
- inositol phosphate pool changes e.g., cell proliferation
- inositol phosphate pool changes e.g., cell proliferation
- inositol phosphate pool changes e.g., cell proliferation
- inositol phosphate pool changes e.g., a separation step
- Some detection methods allow for elimination of a separation step, e.g., a proximity sensitive detection system.
- Calcium sensitive dyes will be useful for detecting Ca ++ levels, with a fluorimeter or a fluorescence cell sorting apparatus .
- Another method utilizes membranes from transformed eukaryotic or prokaryotic host cells as the source of the IL- 170 protein. These cells are stably transformed with DNA vectors directing the expression of a membrane associated IL- 170 protein, e.g., an engineered membrane bound form. Essentially, the membranes would be prepared from the cells and used in any receptor/ligand type binding assay such as the competitive assay set forth above.
- Still another approach is to use solubilized, unpurified or solubilized, purified IL-170 protein from transformed eukaryotic or prokaryotic host cells. This allows for a "molecular" binding assay with the advantages of increased specificity, the ability to automate, and high drug test throughput .
- Another technique for drug screening involves an approach which provides high throughput screening for compounds having suitable binding affinity to IL-170 and is described in detail in Geysen, European Patent Application 84/03564, published on September 13, 1984.
- a solid substrate e.g., plastic pins or some other appropriate surface, see Fodor, et al . (1991) .
- all the pins are reacted with solubilized, unpurified or solubilized, purified IL-170 binding composition, and washed.
- the next step involves detecting bound binding composition.
- Rational drug design may also be based upon structural studies of the molecular shapes of the IL-170 protein and other effectors or analogs.
- Effectors may be other proteins which mediate other functions in response to antigen binding, or other proteins which normally interact with the antigen.
- One means for determining which sites interact with specific other proteins is a physical structure determination, e.g., x-ray crystallography or 2 dimensional NMR techniques. These will provide guidance as to which amino acid residues form molecular contact regions.
- x-ray crystallography or 2 dimensional NMR techniques.
- Purified IL-170 protein can be coated directly onto plates for use in the aforementioned drug screening techniques. However, non-neutralizing antibodies to these ligands can be used as capture antibodies to immobilize the respective ligand on the solid phase.
- kits This invention also contemplates use of IL-170 proteins, fragments thereof, peptides, and their fusion products in a variety of diagnostic kits and methods for detecting the presence of a binding composition.
- the kit will have a compartment containing either a defined IL-170 peptide or gene segment or a reagent which recognizes one or the other, e.g., antigen fragments or antibodies.
- a kit for determining the binding affinity of a test compound to an IL-170 protein would typically comprise a test compound; a labeled compound, for example an antibody having known binding affinity for the antigen; a source of IL-170 protein (naturally occurring or recombinant) ; and a means for separating bound from free labeled compound, such as a solid phase for immobilizing the antigen.
- a labeled compound for example an antibody having known binding affinity for the antigen
- a source of IL-170 protein naturally occurring or recombinant
- a means for separating bound from free labeled compound such as a solid phase for immobilizing the antigen.
- a preferred kit for determining the concentration of, for example, an IL-170 protein in a sample would typically comprise a labeled compound, e.g., antibody, having known binding affinity for the antigen, a source of antigen (naturally occurring or recombinant) and a means for separating the bound from free labeled compound, for example, a solid phase for immobilizing the IL-170 protein. Compartments containing reagents, and instructions, will normally be provided.
- One method for determining the concentration of IL-170 protein in a sample would typically comprise the steps of: (1) preparing membranes from a sample comprised of a membrane bound IL-170 protein source; (2) washing the membranes and suspending them in a buffer; (3) solubilizing the antigen by incubating the membranes in a culture medium to which a suitable detergent has been added; (4) adjusting the detergent concentration of the solubilized antigen; (5) contacting and incubating said dilution with radiolabeled antibody to form complexes; (6) recovering the complexes such as by filtration through polyethyleneimine treated filters; and (7) measuring the radioactivity of the recovered complexes.
- Antibodies including antigen binding fragments, specific for the IL-170 protein or fragments are useful in diagnostic applications to detect the presence of elevated levels of IL- 170 protein and/or its fragments.
- diagnostic assays can employ lysates, live cells, fixed cells, immunofluorescence, cell cultures, body fluids, and further can involve the detection of antigens related to the protein in serum, or the like. Diagnostic assays may be homogeneous (without a separation step between free reagent and protein-protein complex) or heterogeneous (with a separation step) .
- RIA radioimmunoassay
- ELISA enzyme-linked immunosorbent assay
- EIA enzyme immunoassay
- EMIT enzyme-multiplied immunoassay technique
- SFIA substrate-labeled fluorescent immunoassay
- unlabeled antibodies can be employed by using a second antibody which is labeled and which recognizes the antibody to an IL-170 protein or to a particular fragment thereof.
- Similar assays have also been extensively discussed in the literature. See, e.g., Harlow and Lane (1988) Antibodies: A Laboratory Manual, CSH.
- Anti-idiotypic antibodies may have similar use to diagnose presence of antibodies against an IL-170 protein, as such may be diagnostic of various abnormal states.
- overproduction of IL-170 protein may result in production of various immunological reactions which may be diagnostic of abnormal physiological states, particularly in proliferative cell conditions such as cancer or abnormal differentiation.
- the reagents for diagnostic assays are supplied in kits, so as to optimize the sensitivity of the assay.
- the protocol, and the label either labeled or unlabeled antibody, or labeled IL-170 protein is provided. This is usually in conjunction with other additives, such as buffers, stabilizers, materials necessary for signal production such as substrates for enzymes, and the like.
- the kit will also contain instructions for proper use and disposal of the contents after use.
- the kit has compartments for each useful reagent.
- the reagents are provided as a dry lyophilized powder, where the reagents may be reconstituted in an aqueous medium providing appropriate concentrations of reagents for performing the assay.
- labeling may be achieved by covalently or non- covalently joining a moiety which directly or indirectly provides a detectable signal.
- the antigen, test compound, IL-170 protein, or antibodies thereto can be labeled either directly or indirectly.
- Possibilities for direct labeling include label groups: radiolabels such as 125 ⁇ enzymes (U.S. Pat. No. 3,645,090) such as peroxidase and alkaline phosphatase, and fluorescent labels (U.S. Pat. No.
- Possibilities for indirect labeling include biotinylation of one constituent followed by binding to avidin coupled to one of the above label groups .
- the IL-170 protein can be immobilized on various matrixes followed by washing. Suitable matrixes include plastic such as an ELISA plate, filters, and beads.
- Methods of immobilizing the IL-170 protein to a matrix include, without limitation, direct adhesion to plastic, use of a capture antibody, chemical coupling, and biotin-avidin.
- the last step in this approach involves the precipitation of protein-protein complex by any of several methods including those utilizing, e.g., an organic solvent such as polyethylene glycol or a salt such as ammonium sulfate.
- suitable separation techniques include, without limitation, the fluorescein antibody magnetizable particle method described in Rattle, et al . (1984) Clin. Chem. 30:1457-1461, and the double antibody magnetic particle separation as described in U.S. Pat. No. 4,659,678.
- oligonucleotide or polynucleotide sequences taken from the sequence of an IL-170 protein. These sequences can be used as probes for detecting levels of antigen message in samples from patients suspected of having an abnormal condition, e.g., cancer or developmental problem.
- an abnormal condition e.g., cancer or developmental problem.
- the preparation of both RNA and DNA nucleotide sequences, the labeling of the sequences, and the preferred size of the sequences has received ample description and discussion in the literature.
- an oligonucleotide probe should have at least about 14 nucleotides, usually at least about 18 nucleotides, and the polynucleotide probes may be up to several kilobases.
- Various labels may be employed, most commonly radionuclides, particularly 32p_ However, other techniques may also be employed, such as using biotin modified nucleotides for introduction into a polynucleotide. The biotin then serves as the site for binding to avidin or antibodies, which may be labeled with a wide variety of labels, such as radionuclides, fluorescers, enzymes, or the like. Alternatively, antibodies may be employed which can recognize specific duplexes, including DNA duplexes, RNA duplexes, DNA-RNA hybrid duplexes, or DNA-protein duplexes .
- the antibodies in turn may be labeled and the assay carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected.
- probes to the novel anti-sense RNA may be carried out in any conventional techniques such as nucleic acid hybridization, plus and minus screening, recombinational probing, hybrid released translation (HRT) , and hybrid arrested translation (HART) . This also includes amplification techniques such as polymerase chain reaction (PCR) .
- antisense nucleic acid including the introduction of double stranded RNA (dsRNA) to genetically interfere with gene function as described, e.g., in Misquitta, et al. (1999) Proc. Nat ' 1 Acad. Sci. USA 96:1451-1456, and/or ribozymes to block translation of a specific IL-70 mRNA.
- dsRNA double stranded RNA
- ribozymes to block translation of a specific IL-70 mRNA.
- the use of antisense methods to inhibit the in vitro translation of genes is well known in the art. Marcus-Sakura (1988) Anal . Biochem. 172:289; Akhtar (ed. 1995) Delivery Strategies for Antisense Oligonucleotide Therapeutics CRC Press, Inc.
- kits which also test for the qualitative or quantitative presence of other markers are also contemplated. Diagnosis or prognosis may depend on the combination of multiple indications used as markers. Thus, kits may test for combinations of markers. See, e.g., Viallet, et al . (1989) Progress in Growth Factor Res . 1:89-97.
- Methods for protein purification include such methods as ammonium sulfate precipitation, column chromatography, electrophoresis, centrifugation, crystallization, and others. See, e.g., Ausubel, et al . (1987 and periodic supplements); Deutscher (1990) "Guide to Protein Purification” in Methods in Enzymology, vol.
- Cytokine assays are described, e.g., in Thomson (ed. 1998) The Cytokine Handbook (3d ed. ) Academic Press, San Diego; Mire-Sluis and Thorpe (1998) Cytokines Academic Press, San Diego; Metcalf and Nicola (1995) The Hematopoietic Colony Stimulating Factors Cambridge University Press; and Aggarwal and Gutterman (1991) Human Cytokines Blackwell Pub.
- Assays for vascular biological activities are well known in the art. They will cover angiogenic and angiostatic activities in tumor, or other tissues, e.g., arterial smooth muscle proliferation (see, e.g., Koyoma, et al . (1996) Cell 87:1069-1078), monocyte adhesion to vascular epithelium (see McEvoy, et al . (1997) J. Exp . Med. 185:2069-2077), etc. See also Ross (1993) Nature 362:801-809; Rekhter and Gordon (1995) Am. J. Pathol. 147:668-677; Thyberg, et al . (1990) Atherosclerosis 10:966-990; and Gumbiner (1996) Cell 84:345- 357.
- arterial smooth muscle proliferation see, e.g., Koyoma, et al . (1996) Cell 87:1069-1078
- monocyte adhesion to vascular epithelium see McEvoy,
- IL-170 may be applied to these new entities, as described, e.g., in USSN , each of which is incorporated herein by reference for all purposes.
- Source of the IL-170 messages Various cell lines are screened using an appropriate probe for high level message expression. Appropriate cell lines are selected based upon expression levels of the appropriate IL-170 message .
- Standard PCR techniques are used to amplify an IL-170 gene sequence from a genomic or cDNA library, or from mRNA.
- a human genomic or cDNA library is obtained and screened with an appropriate cDNA or synthetic probe.
- PCR primers may be prepared. Appropriate primers are selected, e.g., from the sequences provided, and a full length clone is isolated. Various combinations of primers, of various lengths and possibly with differences in sequence, may be prepared. The full length clone can be used as a hybridization probe to screen for other homologous genes using stringent or less stringent hybridization conditions.
- oligonucleotides are used to screen a library.
- synthetic oligonucleotides in appropriate orientations are used as primers to select correct clones from a library.
- An IL-170 protein is expressed in heterologous cells, e.g., the native form or a recombinant form displaying the FLAG peptide at the carboxy terminus.
- heterologous cells e.g., the native form or a recombinant form displaying the FLAG peptide at the carboxy terminus.
- OIAexpress The High Level Expression and Protein Purification System QIAGEN, Inc. Chatsworth, CA; and Hopp, et al. (1988) Bio/Technology 6:1204-1210.
- These two forms are introduced into expression vectors, e.g., pME18S or pEEl2 , and subsequently transfected into appropriate cells, e.g., COS-7 or NSO cells, respectively.
- Electroporated cells are cultivated, e.g., for 48 hours in RPMI medium supplemented with 10% Fetal Calf Serum. Cells are then incubated with 35g_]v[ e t and 35g_c vs in order to label cellular proteins. Comparison of the proteins under reducing conditions on SDS-PAGE should show that cells transfected with full length clones should secret a polypeptide of the appropriate size, e.g., about 15,000 daltons. Treatment with endoglycosidases will demonstrate whether there are N-glycosylated forms.
- mammalian IL-170 is produced in large amounts, e.g., with transfected COS-7 cells grown in RPMI medium supplemented with 1% Nutridoma HU (Boehringer Mannheim, Mannheim, Germany) and subsequently purified. Purification may use affinity chromatography using antibodies, or protein purification techniques, e.g., using antibodies to determine separation properties.
- 1 liter of supernatant containing human IL-173 or IL-173-FLAG is passed, e.g., on a 60 ml column of Zn ++ ions grafted to a Chelating Sepharose Fast Flow matrix (Pharmacia, Upsalla, Sweden) . After washing with 10 volumes of binding buffer (His-Bind Buffer kit, Novagen, Madison, WI) , the proteins retained by the metal ions are eluted with a gradient of 20-100 mM Imidazole.
- the content of human IL-173-FLAG in the eluted fractions is determined by dot blot using the anti- FLAG monoclonal antibody M2 (Eastman Kodak, New Haven, CT) , whereas the content of human IL-173 is assessed, e.g., by silver staining of non-reducing SDS-PAGE.
- the IL-170 containing fractions are then pooled and dialyzed against PBS, and are either used in biological assays or further purified, e.g., by anion exchange HPLC on a DEAE column.
- a third step of gel filtration chromatography may be performed on a SUPERDEX G- 75 HRD30 column (Pharmacia Uppsala, Sweden) . Purification may be evaluated, e.g., by silver stained SDS-PAGE.
- Inbred Balb/c mice are immunized intraperitoneally, e.g., with 1 ml of purified human IL-173-FLAG emulsified in Freund' ⁇ complete adjuvant on day 0, and in Freund's incomplete adjuvant on days 15 and 22. The mice are boosted with 0.5 ml of purified human IL-173 administered intravenously.
- Polyclonal antiserum is collected.
- the serum can be purified to antibodies.
- the antibodies can be further processed, e.g., to Fab, Fab2 , Fv, or similar fragments.
- Hybridomas are created using, e.g., the non-secreting myeloma cells line SP2/0-Ag8 and polyethylene glycol 1000
- Hybridoma cells are placed in a 96-well Falcon tissue culture plate (Becton Dickinson, NJ) and fed with DMEM F12 (Gibco, Gaithersburg, MD) supplemented with 80 ⁇ g/ml gentamycin, 2 mM glutamine, 10% horse serum (Gibco, Gaithersburg, MD) , 1% ADCM (CRTS, Lyon,
- Hybridoma supernatants are screened for antibody production against human IL-173 by immunocytochemistry (ICC) using acetone fixed human IL-173 transfected COS-7 cells and by ELISA using human IL-173-FLAG purified from COS-7 supernatants as a coating antigen.
- ICC immunocytochemistry
- IL-173-FLAG human IL-173-FLAG purified from COS-7 supernatants as a coating antigen.
- Aliquots of positive cell clones are expanded for 6 days and cryopreserved as well as propagated in ascites from pristane (2 , 6, 10, 14-teramethylpentadecane, Sigma, St. Louis, MO) treated Balb/c mice who had received on intraperitoneal injection of pristane 15 days before.
- the antibody fraction is isolated by ammonium sulfate precipitation and anion- exchange chromatography on a Zephyr-D siliciu column (IBF Sepracor) equilibrated with 20 mM Tris pH 8.0. Proteins are eluted with a NaCl gradient (ranging from 0 to 1 M NaCl) . 2 ml fractions are collected and tested by ELISA for the presence of anti-IL-173 antibody. The fractions containing specific anti- IL-173 activity are pooled, dialyzed, and frozen. Aliquots of the purified monoclonal antibodies may be peroxidase labeled.
- Antibody preparations may be cross absorbed, depleted, or combined to create reagents which exhibit desired combinations of selectivities and specificities.
- Defined specific antigens can be immobilized to a solid matrix and used to selectively deplete or select for desired binding capacities.
- IL-173 appropriate clonal isolates are selected to quantitate levels of human IL- 173 using a sandwich assay.
- Purified antibodies are diluted, e.g., at 2 ⁇ g/ml in coating buffer (carbonate buffer, pH 9.6. 15 mM Na2C03, 35 mM NaHC03 ) .
- This diluted solution is coated onto the wells of a 96-well ELISA plate (Immunoplate Maxisorp F96 certified, NUNC, Denmark) overnight at room temperature.
- the plates are then washed manually, e.g., with a washing buffer consisting of Phosphate Buffered Saline and 0.05% Tween 20 (Technicon Diagnositics, USA) .
- the human IL-173 was identified from sequence derived from a cDNA library from an epileptic brain frontal cortex.
- the rat IL-173 was derived from a cDNA library from cochlea, brain, cerebellum, eye, lung, and kidney. Again, the genes appear to be quite rare, which suggests the expression distributions would be highly restricted.
- the mouse IL-174 was identified from sequence derived from a cDNA library derived form a mouse embryo. The gene appears to be quite rare, which suggests the expression distribution would be highly restricted.
- the human IL-171 was identified from a sequence derived from an apoptotic T cell. The gene appears to be quite rare, which suggests the expression distribution would be highly restricted.
- the human IL-172 was identified from sequences derived from human fetal heart, liver and spleen, thymus, thymus tumor, and total fetus .
- Mouse was derived from sequences derived from mouse, embryo, mammary gland, and pooled organs. Both genes appear to be quite rare, which suggests their expression distribution would be highly restricted.
- the human IL-175 was identified from a sequence derived from a 12 h thiouridine activated T cell . The gene appears to be quite rare, which suggests the expression distribution would be highly restricted.
- Chromosome mapping is a standard technique. See, e.g., BIOS Laboratories (New Haven, CT) and methods for using a mouse somatic cell hybrid panel with PCR.
- the human IL-173 gene maps to human chromosome 13qll .
- a binding composition e.g., antibody
- an expression library made from a cell line which expresses an IL-170 protein.
- Standard staining techniques are used to detect or sort intracellular or surface expressed antigen, or surface expressing transformed cells are screened by panning. Screening of intracellular expression is performed by various staining or immunofluorescence procedures. See also McMahan, et al . (1991) EMBO J. 10:2821-2832.
- Species variants are isolated using cross-species hybridization techniques based upon a full length isolate or fragment from one species as a probe, or appropriate species .
- Isolating receptors for IL-170 Methods are available for screening of an expression library made from a cell line which expresses potential IL- 170 receptors. A labeled IL-170 ligand is produced, as described above. Standard staining techniques are used to detect or sort surface expressed receptor, or surface expressing transformed cells are screened by panning. See also McMahan, et al . (1991) EMBO J. 10:2821-2832.
- Soluble antibody is added to cells and incubate for 30 min. Wash cells twice with HBSS/saponin. Add second antibody, e.g., Vector anti-mouse antibody, at 1/200 dilution, and incubate for 30 min. Prepare ELISA solution, e.g., Vector Elite ABC horseradish peroxidase solution, and preincubate for 30 min. Use, e.g., 1 drop of solution A (avidin) and 1 drop solution B (biotin) per 2.5 ml HBSS/saponin. Wash cells twice with HBSS/saponin. Add ABC HRP solution and incubate for 30 min. Wash cells twice with HBSS, second wash for 2 min, which closes cells. Then add Vector diaminobenzoic acid (DAB) for 5 to 10 min. Use 2 drops of buffer plus 4 drops DAB plus 2 drops of H2O2 per 5 ml of glass distilled water.
- DAB Vector diaminobenzoic acid
- the labeled ligand is used to affinity purify or sort out cells expressing the receptor. See, e.g., Sambrook, et al . or Ausubel, et al .
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Plant Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE60043051T DE60043051D1 (de) | 1999-01-11 | 2000-01-10 | Dafür kodierende polynukleotide. verwendungen |
| NZ511991A NZ511991A (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines. Polynucleotides encoding them. uses |
| HU0200518A HU229122B1 (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines, polynucleotides encoding them uses |
| AU27178/00A AU770807B2 (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses |
| KR1020017008503A KR20010089764A (ko) | 1999-01-11 | 2000-01-10 | 인터류킨-17과 관련된 포유류의 사이토카인, 이를코딩하는 폴리뉴클레오티드 및 이의 용도 |
| AT00905517T ATE444365T1 (de) | 1999-01-11 | 2000-01-10 | Interleukin-17 verwandte zytokine aus säugetieren. dafür kodierende polynukleotide. verwendungen |
| SI200031047T SI1141297T1 (sl) | 1999-01-11 | 2000-01-10 | Interlevkinu-17 sorodni sesalski citokini, polinukleotidi, ki jih kodirajo uporabe |
| JP2000593745A JP2002534122A (ja) | 1999-01-11 | 2000-01-10 | インターロイキン−17関連哺乳動物サイトカイン、それをコードするポリヌクレオチド、使用 |
| EP00905517A EP1141297B1 (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines. polynucleotides encoding them . uses |
| DK00905517.9T DK1141297T3 (da) | 1999-01-11 | 2000-01-10 | Interleukin-17-beslægtede mammale cytokiner. Polynucleotider, der koder for dem. Anvendelser |
| IL14360000A IL143600A0 (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines, polynucleotides encoding them and their uses |
| CA002361204A CA2361204A1 (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses |
| IL143600A IL143600A (en) | 1999-01-11 | 2001-06-06 | Il-174 polynucleotides, polypeptides and related compositions and methods |
| IL195716A IL195716A0 (en) | 1999-01-11 | 2008-12-04 | Interleukin-17 related mammalian cytokines, polynucleotides encoding them and their uses |
| IL201751A IL201751A (en) | 1999-01-11 | 2009-10-25 | Compounds that bind il-17-like cytokine and antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US22882299A | 1999-01-11 | 1999-01-11 | |
| US09/228,822 | 1999-01-11 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2000042188A2 true WO2000042188A2 (en) | 2000-07-20 |
| WO2000042188A3 WO2000042188A3 (en) | 2000-11-30 |
Family
ID=22858682
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2000/000006 Ceased WO2000042188A2 (en) | 1999-01-11 | 2000-01-10 | Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses |
Country Status (19)
| Country | Link |
|---|---|
| EP (3) | EP2341144A1 (https=) |
| JP (2) | JP2002534122A (https=) |
| KR (1) | KR20010089764A (https=) |
| CN (1) | CN1357042A (https=) |
| AR (1) | AR022236A1 (https=) |
| AT (2) | ATE444365T1 (https=) |
| AU (1) | AU770807B2 (https=) |
| CA (1) | CA2361204A1 (https=) |
| CY (1) | CY1109653T1 (https=) |
| DE (1) | DE60043051D1 (https=) |
| DK (1) | DK1141297T3 (https=) |
| ES (2) | ES2374429T3 (https=) |
| HU (1) | HU229122B1 (https=) |
| IL (4) | IL143600A0 (https=) |
| NZ (1) | NZ511991A (https=) |
| PT (1) | PT1141297E (https=) |
| SI (1) | SI1141297T1 (https=) |
| WO (1) | WO2000042188A2 (https=) |
| ZA (1) | ZA200104415B (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001079288A3 (en) * | 2000-04-18 | 2002-05-10 | Schering Corp | Cytokine uses; compositions; methods |
| WO2002008285A3 (en) * | 2000-06-22 | 2002-08-01 | Amgen Inc | Il-17 molecules and uses thereof |
| US6569645B2 (en) * | 1999-05-14 | 2003-05-27 | Genentech, Inc. | IL-17 homologous polypeptides and therapeutic uses thereof |
| EP1443055A3 (en) * | 1998-05-29 | 2005-06-08 | Human Genome Sciences, Inc. | Interleukins-21 and 22 |
| US7256264B2 (en) | 2000-08-24 | 2007-08-14 | Genentech, Inc. | Receptor for IL-17 homologous polypeptides and uses thereof |
| EP1897948A1 (en) | 1998-09-17 | 2008-03-12 | ZymoGenetics, Inc. | Mammalian transforming growth factor beta 9 |
| EP1897945A3 (en) * | 1999-12-23 | 2008-05-28 | Genentech, Inc. | IL-17 homologous polypeptides and therapeutic uses thereof |
| JP2008278887A (ja) * | 1999-12-23 | 2008-11-20 | Genentech Inc | Il−17相同的ポリペプチドとその治療上の用途 |
| JP2009178160A (ja) * | 1999-12-23 | 2009-08-13 | Genentech Inc | Il−17相同的ポリペプチドとその治療上の用途 |
| US7771719B1 (en) | 2000-01-11 | 2010-08-10 | Genentech, Inc. | Pharmaceutical compositions, kits, and therapeutic uses of antagonist antibodies to IL-17E |
| US7807155B2 (en) | 2004-08-05 | 2010-10-05 | Novartis Ag | IL-17 antagonistic antibodies |
| JP2016047051A (ja) * | 1999-12-23 | 2016-04-07 | ジェネンテック, インコーポレイテッド | Il−17相同的ポリペプチドとその治療上の用途 |
| US9650437B2 (en) | 2008-05-05 | 2017-05-16 | Novimmune S.A. | Nucleic acid encoding and method of producing anti-IL-17A/IL-17F cross-reactive antibodies |
| US11633503B2 (en) | 2009-01-08 | 2023-04-25 | Northwestern University | Delivery of oligonucleotide-functionalized nanoparticles |
| US11696954B2 (en) | 2017-04-28 | 2023-07-11 | Exicure Operating Company | Synthesis of spherical nucleic acids using lipophilic moieties |
| US11866700B2 (en) | 2016-05-06 | 2024-01-09 | Exicure Operating Company | Liposomal spherical nucleic acid (SNA) constructs presenting antisense oligonucleotides (ASO) for specific knockdown of interleukin 17 receptor mRNA |
| US11957788B2 (en) | 2014-06-04 | 2024-04-16 | Exicure Operating Company | Multivalent delivery of immune modulators by liposomal spherical nucleic acids for prophylactic or therapeutic applications |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004042009A2 (en) * | 2002-10-30 | 2004-05-21 | Genentech, Inc. | Inhibition of il-17 production |
| CN102458437B (zh) | 2009-05-05 | 2015-06-10 | 诺维莫尼公司 | 抗il-17f抗体及其使用方法 |
| CN113136377B (zh) * | 2020-01-19 | 2023-01-17 | 中国科学院天津工业生物技术研究所 | 一种聚糖酶及其在川芎嗪生物合成中的应用 |
Family Cites Families (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2046920B1 (https=) | 1969-06-19 | 1974-05-03 | Citizen Watch Co Ltd | |
| US3940475A (en) | 1970-06-11 | 1976-02-24 | Biological Developments, Inc. | Radioimmune method of assaying quantitatively for a hapten |
| NL154598B (nl) | 1970-11-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van laagmoleculire verbindingen en van eiwitten die deze verbindingen specifiek kunnen binden, alsmede testverpakking. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3939350A (en) | 1974-04-29 | 1976-02-17 | Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing total reflection for activation |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4277437A (en) | 1978-04-05 | 1981-07-07 | Syva Company | Kit for carrying out chemically induced fluorescence immunoassay |
| US4275149A (en) | 1978-11-24 | 1981-06-23 | Syva Company | Macromolecular environment control in specific receptor assays |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US4659678A (en) | 1982-09-29 | 1987-04-21 | Serono Diagnostics Limited | Immunoassay of antigens |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0216846B2 (en) | 1985-04-01 | 1995-04-26 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| US4859609A (en) | 1986-04-30 | 1989-08-22 | Genentech, Inc. | Novel receptors for efficient determination of ligands and their antagonists or agonists |
| GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
| GB8809129D0 (en) | 1988-04-18 | 1988-05-18 | Celltech Ltd | Recombinant dna methods vectors and host cells |
| US6562333B1 (en) * | 1993-06-14 | 2003-05-13 | Schering Corporation | Purified mammalian CTLA-8 antigens and related reagents |
| DE69634726T2 (de) * | 1995-07-19 | 2006-05-04 | Genetics Institute, LLC, Cambridge | Menschliche ctla-8 und verwendung von ctla-8 ähnlichen proteinen |
| JPH10134761A (ja) | 1996-10-30 | 1998-05-22 | Ebara Corp | イオン注入装置及びイオン注入方法 |
| KR20010012111A (ko) * | 1997-04-25 | 2001-02-15 | 리스 데브라 케이. | 포유동물의 사이토킨-유사 인자 7 |
| AU740405B2 (en) * | 1998-05-15 | 2001-11-01 | Genentech Inc. | IL-17 homologous polypeptides and therapeutic uses thereof |
| EP1082433A4 (en) * | 1998-05-29 | 2003-01-02 | Human Genome Sciences Inc | Interleukins 21 and 22 |
| DK1114156T3 (da) * | 1998-09-17 | 2008-03-03 | Zymogenetics Inc | Transformerende vækstfaktor Beta-9 (ZTGFSS9) fra pattedyr |
-
2000
- 2000-01-10 EP EP10180681A patent/EP2341144A1/en not_active Withdrawn
- 2000-01-10 NZ NZ511991A patent/NZ511991A/xx not_active IP Right Cessation
- 2000-01-10 ES ES07014088T patent/ES2374429T3/es not_active Expired - Lifetime
- 2000-01-10 PT PT00905517T patent/PT1141297E/pt unknown
- 2000-01-10 ES ES00905517T patent/ES2333694T3/es not_active Expired - Lifetime
- 2000-01-10 CA CA002361204A patent/CA2361204A1/en not_active Abandoned
- 2000-01-10 JP JP2000593745A patent/JP2002534122A/ja active Pending
- 2000-01-10 AR ARP000100087A patent/AR022236A1/es unknown
- 2000-01-10 KR KR1020017008503A patent/KR20010089764A/ko not_active Withdrawn
- 2000-01-10 AT AT00905517T patent/ATE444365T1/de active
- 2000-01-10 EP EP00905517A patent/EP1141297B1/en not_active Expired - Lifetime
- 2000-01-10 CN CN00802614A patent/CN1357042A/zh active Pending
- 2000-01-10 DE DE60043051T patent/DE60043051D1/de not_active Expired - Lifetime
- 2000-01-10 WO PCT/US2000/000006 patent/WO2000042188A2/en not_active Ceased
- 2000-01-10 EP EP07014088A patent/EP1895006B1/en not_active Expired - Lifetime
- 2000-01-10 AU AU27178/00A patent/AU770807B2/en not_active Ceased
- 2000-01-10 IL IL14360000A patent/IL143600A0/xx unknown
- 2000-01-10 SI SI200031047T patent/SI1141297T1/sl unknown
- 2000-01-10 HU HU0200518A patent/HU229122B1/hu not_active IP Right Cessation
- 2000-01-10 DK DK00905517.9T patent/DK1141297T3/da active
- 2000-01-10 AT AT07014088T patent/ATE531801T1/de active
-
2001
- 2001-05-29 ZA ZA200104415A patent/ZA200104415B/en unknown
- 2001-06-06 IL IL143600A patent/IL143600A/en not_active IP Right Cessation
-
2008
- 2008-12-04 IL IL195716A patent/IL195716A0/en unknown
-
2009
- 2009-10-25 IL IL201751A patent/IL201751A/en not_active IP Right Cessation
- 2009-12-18 CY CY20091101319T patent/CY1109653T1/el unknown
-
2010
- 2010-03-29 JP JP2010076413A patent/JP2010213702A/ja active Pending
Cited By (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1443055A3 (en) * | 1998-05-29 | 2005-06-08 | Human Genome Sciences, Inc. | Interleukins-21 and 22 |
| EP1897948A1 (en) | 1998-09-17 | 2008-03-12 | ZymoGenetics, Inc. | Mammalian transforming growth factor beta 9 |
| US6569645B2 (en) * | 1999-05-14 | 2003-05-27 | Genentech, Inc. | IL-17 homologous polypeptides and therapeutic uses thereof |
| EP1897945A3 (en) * | 1999-12-23 | 2008-05-28 | Genentech, Inc. | IL-17 homologous polypeptides and therapeutic uses thereof |
| JP2016047051A (ja) * | 1999-12-23 | 2016-04-07 | ジェネンテック, インコーポレイテッド | Il−17相同的ポリペプチドとその治療上の用途 |
| EP2163625A1 (en) * | 1999-12-23 | 2010-03-17 | Genentech, Inc. | IL-17 and IL-17R homologous polypeptides and therapeutic uses thereof |
| JP2009178160A (ja) * | 1999-12-23 | 2009-08-13 | Genentech Inc | Il−17相同的ポリペプチドとその治療上の用途 |
| JP2008278887A (ja) * | 1999-12-23 | 2008-11-20 | Genentech Inc | Il−17相同的ポリペプチドとその治療上の用途 |
| US7771719B1 (en) | 2000-01-11 | 2010-08-10 | Genentech, Inc. | Pharmaceutical compositions, kits, and therapeutic uses of antagonist antibodies to IL-17E |
| US8034342B2 (en) | 2000-01-11 | 2011-10-11 | Genentech, Inc. | Pharmaceutical compositions, kits, and therapeutic uses of antagonist antibodies to IL-17E |
| US7357924B2 (en) | 2000-04-18 | 2008-04-15 | Schering Corporation | Uses of IL-174 for treating helminth infections |
| EP2020239A1 (en) * | 2000-04-18 | 2009-02-04 | Schering Corporation | Use of IL-174 agonists for treating infectious diseases |
| US6676939B2 (en) | 2000-04-18 | 2004-01-13 | Schering Corporation | Methods of modulating IL-174 response |
| WO2001079288A3 (en) * | 2000-04-18 | 2002-05-10 | Schering Corp | Cytokine uses; compositions; methods |
| EP2389943A1 (en) * | 2000-04-18 | 2011-11-30 | Schering Corporation | Use of IL-174 antagonists for treating Th2-related diseases |
| WO2002008285A3 (en) * | 2000-06-22 | 2002-08-01 | Amgen Inc | Il-17 molecules and uses thereof |
| US7544482B2 (en) | 2000-08-24 | 2009-06-09 | Genentech, Inc. | Nucleic acids encoding receptor for IL-17 homologous polypeptides and uses thereof |
| US7256264B2 (en) | 2000-08-24 | 2007-08-14 | Genentech, Inc. | Receptor for IL-17 homologous polypeptides and uses thereof |
| US8455217B2 (en) | 2000-10-24 | 2013-06-04 | Genentech, Inc. | Nucleic acids encoding IL-17 homologous receptor-like polypeptides and therapeutic uses thereof |
| US8119131B2 (en) | 2004-08-05 | 2012-02-21 | Novartis Ag | IL-17 antagonistic antibodies |
| US8617552B2 (en) | 2004-08-05 | 2013-12-31 | Novarts Ag | IL-17 antibodies |
| US7807155B2 (en) | 2004-08-05 | 2010-10-05 | Novartis Ag | IL-17 antagonistic antibodies |
| US9765140B2 (en) | 2004-08-05 | 2017-09-19 | Novartis Ag | IL-17 antagonistic antibodies |
| US10344084B2 (en) | 2004-08-05 | 2019-07-09 | Novartis Ag | IL-17 antagonistic antibodies |
| US9650437B2 (en) | 2008-05-05 | 2017-05-16 | Novimmune S.A. | Nucleic acid encoding and method of producing anti-IL-17A/IL-17F cross-reactive antibodies |
| US11633503B2 (en) | 2009-01-08 | 2023-04-25 | Northwestern University | Delivery of oligonucleotide-functionalized nanoparticles |
| US11957788B2 (en) | 2014-06-04 | 2024-04-16 | Exicure Operating Company | Multivalent delivery of immune modulators by liposomal spherical nucleic acids for prophylactic or therapeutic applications |
| US11866700B2 (en) | 2016-05-06 | 2024-01-09 | Exicure Operating Company | Liposomal spherical nucleic acid (SNA) constructs presenting antisense oligonucleotides (ASO) for specific knockdown of interleukin 17 receptor mRNA |
| US11696954B2 (en) | 2017-04-28 | 2023-07-11 | Exicure Operating Company | Synthesis of spherical nucleic acids using lipophilic moieties |
Also Published As
| Publication number | Publication date |
|---|---|
| EP1895006A1 (en) | 2008-03-05 |
| IL195716A0 (en) | 2011-08-01 |
| IL201751A (en) | 2013-06-27 |
| HK1110096A1 (en) | 2008-07-04 |
| IL143600A (en) | 2010-12-30 |
| CY1109653T1 (el) | 2014-08-13 |
| EP2341144A1 (en) | 2011-07-06 |
| EP1141297B1 (en) | 2009-09-30 |
| JP2010213702A (ja) | 2010-09-30 |
| HUP0200518A3 (en) | 2003-12-29 |
| DK1141297T3 (da) | 2010-01-18 |
| ATE444365T1 (de) | 2009-10-15 |
| WO2000042188A3 (en) | 2000-11-30 |
| AU2717800A (en) | 2000-08-01 |
| CN1357042A (zh) | 2002-07-03 |
| ZA200104415B (en) | 2002-08-29 |
| HUP0200518A2 (en) | 2002-06-29 |
| ES2333694T3 (es) | 2010-02-26 |
| IL143600A0 (en) | 2002-04-21 |
| EP1895006B1 (en) | 2011-11-02 |
| NZ511991A (en) | 2004-03-26 |
| SI1141297T1 (sl) | 2010-01-29 |
| JP2002534122A (ja) | 2002-10-15 |
| PT1141297E (pt) | 2010-01-06 |
| HU229122B1 (en) | 2013-08-28 |
| DE60043051D1 (de) | 2009-11-12 |
| CA2361204A1 (en) | 2000-07-20 |
| ES2374429T3 (es) | 2012-02-16 |
| EP1141297A2 (en) | 2001-10-10 |
| AU770807B2 (en) | 2004-03-04 |
| ATE531801T1 (de) | 2011-11-15 |
| KR20010089764A (ko) | 2001-10-08 |
| AR022236A1 (es) | 2002-09-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7910331B2 (en) | Nucleic acids encoding murine IL-174 | |
| EP0733069B1 (en) | Purified primate ctla-8 antigens and related reagents | |
| US5863796A (en) | Antibodies which specifically bind mammalian receptors for interleukin-10 (IL-10) | |
| AU770807B2 (en) | Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses | |
| CA2287254A1 (en) | Mammalian cytokines; related reagents and methods | |
| WO2000042187A1 (en) | Interleukin-17 related mammalian cytokine (il-171). polynucleotides encoding them. uses | |
| EP0699236B2 (en) | Purified mammalian flt3 ligands and agonists and antagonists thereof | |
| US20100068763A1 (en) | Mammalian chemokines; receptors; reagents; uses | |
| MXPA01007077A (en) | Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses | |
| HK1110096B (en) | Interleukin-17 related mammalian cytokines. polynucleotides encoding them. uses | |
| WO1997029125A1 (en) | Mammalian dendritic cell chemokine reagents |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 00802614.9 Country of ref document: CN |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CZ DE DK DM EE ES FI GB GD GE HR HU ID IL IN IS JP KG KR KZ LC LK LR LT LU LV MA MD MG MK MN MX NO NZ PL PT RO RU SE SG SI SK SL TJ TM TR TT TZ UA UZ VN YU ZA |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CZ DE DK DM EE ES FI GB GD GE HR HU ID IL IN IS JP KG KR KZ LC LK LR LT LU LV MA MD MG MK MN MX NO NZ PL PT RO RU SE SG SI SK SL TJ TM TR TT TZ UA UZ VN YU ZA |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 511991 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2001/04415 Country of ref document: ZA Ref document number: 200104415 Country of ref document: ZA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 143600 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2000905517 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 27178/00 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020017008503 Country of ref document: KR |
|
| ENP | Entry into the national phase |
Ref document number: 2000 593745 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2361204 Country of ref document: CA Ref document number: 2361204 Country of ref document: CA Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2001/007077 Country of ref document: MX |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020017008503 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 2000905517 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 27178/00 Country of ref document: AU |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 1020017008503 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 195716 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201751 Country of ref document: IL |