WO1999052550A1 - Polymer particle vaccine delivery system - Google Patents
Polymer particle vaccine delivery system Download PDFInfo
- Publication number
- WO1999052550A1 WO1999052550A1 PCT/SE1999/000582 SE9900582W WO9952550A1 WO 1999052550 A1 WO1999052550 A1 WO 1999052550A1 SE 9900582 W SE9900582 W SE 9900582W WO 9952550 A1 WO9952550 A1 WO 9952550A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- poly
- polymer
- emulsion
- delivery system
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/105—Delta proteobacteriales, e.g. Lawsonia; Epsilon proteobacteriales, e.g. campylobacter, helicobacter
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
- A61K9/1605—Excipients; Inactive ingredients
- A61K9/1629—Organic macromolecular compounds
- A61K9/1641—Organic macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, poloxamers
- A61K9/1647—Polyesters, e.g. poly(lactide-co-glycolide)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D11/00—Solvent extraction
- B01D11/04—Solvent extraction of solutions which are liquid
- B01D11/0403—Solvent extraction of solutions which are liquid with a supercritical fluid
- B01D11/0411—Solvent extraction of solutions which are liquid with a supercritical fluid the supercritical fluid acting as solvent for the solvent and as anti-solvent for the solute, e.g. formation of particles from solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
- A61K2039/541—Mucosal route
- A61K2039/542—Mucosal route oral/gastrointestinal
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55566—Emulsions, e.g. Freund's adjuvant, MF59
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10—TECHNICAL SUBJECTS COVERED BY FORMER USPC
- Y10T—TECHNICAL SUBJECTS COVERED BY FORMER US CLASSIFICATION
- Y10T436/00—Chemistry: analytical and immunological testing
- Y10T436/25—Chemistry: analytical and immunological testing including sample preparation
Definitions
- the present invention concerns polymer particle vaccine delivery systems in which a water insoluble protein antigen is incorporated with particles comprising a polymer matrix.
- the present invention also concerns a method for incorporating such a water insoluble protein antigen with a polymer matrix in order to produce a polymer particle vaccine delivery system.
- the invention also provides a vaccine composition comprising the polymer particle delivery system.
- the vaccine can be used to treat and/or reduce the risk of for example Helicobacter infection.
- Polymer particles are well suited as vaccine delivery systems, because they can be produced in a range of sizes (eg, microparticles and nanoparticles) according, for example, to the preferred administration route for the vaccine and can slowly release the antigen inside the patient in order to build up a desirable immune response of the patient without the need for multiple vaccinations.
- the antigen is incorporated with the particles by encapsulation within a matrix of the polymer, with or without adsorption of the antigen onto the surface of the polymer particles
- care must be taken to chose a preparation method for the polymer particles that does not remove the desired immunogenicity of the protein (eg, by denaturation).
- various techniques are known for generally producing polymer particles with an active drug or substance, as explained below not all of these are well suited to use with a protein antigen.
- Hot Melt Microencapsulation (A.J. Schwope et alLife Sci. 1975, 77,1877);
- the matrix polymer is melted by heating while mixed with the active substance to incorporated with the particles.
- This technique is not well suited to use with a proteinaceous active substance, such as protein antigen, since the heating step tends to denature the active substance.
- Interfacial Polymerisation is performed in following manner. A core material and the active substance are dissolved in a water immiscible solvent, together with a highly reactive monomer. This solution is then emulsified in water, where another monomer is dissolved, and a stable O/W emulsion is formed. An initiator is added to the water phase and polymerisation occurs, thereby forming a polymer particle incorporating the active substance.
- the active substance is proteinaceous
- the highly reactive monomer in the water immiscible solvent tends to react undesirably with the active substance as well as the core material, which means that Interfacial Polymerisation is not well suited to the incorporation of a protein antigen with polymer particles.
- W/O water-in-oil
- Examples are the Double Emulsion Solvent Extraction and Evaporation Techniques and the Spray Drying.
- the first step is the formation of a first (W/O) emulsion, in which the protein is dissolved in a first aqueous phase (W) and the oil (O) phase contains the matrix polymer and an organic solvent, the W and O phases being emulsified for example by ultra-sonication.
- this first emulsion is then emulsified in a third phase (X) to form multiple W/O emulsion droplets dispersed in the X phase, which is commonly a second aqueous phase, but may for example be oil (eg sesame oil) instead.
- the organic solvent diffuses out from the droplets into the X phase before evaporating from the X phase.
- the organic solvent moves from the oil phase of the W/O emulsion droplets, to the X phase and then to the air.
- the polymer precipitates, thereby producing polymer particles comprising a matrix of the polymer incorporated with the protein (ie, protein is encapsulated within the matrix with or without surface adsorption onto the outside of the particle).
- the Double Emulsion (W/O/X) Solvent Extraction Technique is similar to the Double Emulsion Solvent Evaporation Technique, but the organic solvent is extracted from the O phase of the W/O emulsion instead of being removed by evaporation.
- a second oil phase is used as the X phase in the double emulsion.
- the second oil phase extracts the organic solvent from the O phase, thereby raising the matrix polymer concentration in the O phase and leading to polymer particle formation in which the protein is incorporated with the particles.
- a W/O emulsion is formed as discussed above.
- the emulsion is sprayed through a nozzle to produce small droplets of the emulsion (dispersed in air) from which the solvent rapidly evaporates, thereby leading to formation of polymer particles incorporated with the protein.
- Microparticles in the 1-10 ⁇ m size range can be prepared (at relatively low cost) with this technique.
- Biodegradable polymer particles are particularly well suited for use as vaccine delivery systems, because the polymer matrix itself is non-immunogenic and the encapsulation of the antigen protects it from degradation in the gastrointestinal tract (eg, by acid and proteases).
- An example of an especially suitable matrix polymer is PLG (poly(lactide-co- glycolide) copolymers - also known as PLGA and PLA).
- PLG particles have excellent tissue biocompatibihty, biodegradability and regulatory approval. PLG particles degrade in vivo to form the non-toxic monomers, lactic- and glycolic acids and the release rate of incorporated active substances can be controlled by varying the molecular weight and copolymer ratio.
- the prior art has therefore only concerned the incorporation of water soluble proteins and peptides with polymer particles using techniques which involve the formation of a W/O emulsion.
- the reason for this is that for the desired protein incorporation to take place, the protein must be solubilised in the W aqueous phase in order eventually to produce droplets of W/O emulsion in which the aqueous phase containing the solubilised protein provides the core of the droplets surrounded by the O phase which contains the matrix polymer in an organic solvent.
- WO 95/11009, WO 95/11010, WO 96/36317, US-A-5075109, US-A-4919929 and US-A- 5529777 disclose the formation of microparticles incorporating water soluble antigens.
- WO 95/11009 and WO 95/11010 disclose the microencapsulation of MN rpgl20 or QS21 into PLGA;
- WO 96/36317 discloses the formation of microparticles comprising a polymer matrix (eg, PLG) and a biological agent, further agents being optionally included in order to maintain the potency of the biological agent over the duration of the biological agent's release from the microparticles and to modify the release rate of the biological agent from the microparticles;
- US-A-5075109 discloses the formation of microparticles incorporating trinitrophenyl keyhole limpet hemocyanin or staphylococcal enterotoxin B as an antigen;
- US-A-5529777 discloses the formation of microparticles by mixing a water soluble antigen with a solution of a water soluble polymer or hydrogel.
- US-A-5622649 discloses W/O and W/O/W emulsions, but there is no disclosure of forming polymer particles. It is essential for the invention disclosed in US-A-5622649 that no hydrophilic surfactant is present in the inner W phase. US-A- 5622649 does not disclose a water insoluble protein antigen in the inner W phase.
- the present invention provides a method for producing polymer particles for use as a vaccine delivery system in which a water insoluble protein antigen is incorporated with particles comprising a polymer matrix, wherein the method comprises:- (a) mixing an aqueous phase (W) with an organic phase(O) that is immiscible with W to produce a W/O emulsion, in which the water insoluble protein is solubilised in the W 7
- step (b) forming droplets of said W/O emulsion by dispersing the emulsion in a fluid medium, and removing said solvent from the O phase of the W/O emulsion droplets to thereby form polymer particles incorporating the water insoluble protein antigen; and wherein in step (a) a stabilising agent is included in the W/O emulsion to promote the incorporation of the water insoluble protein with the polymer particles during step (b) by stabilising the W/O emulsion in the presence of said solubilising agent.
- the present invention provides a vaccine composition comprising such a delivery system.
- Another aspect of the present invention is the use of the delivery system in the manufacture of a vaccine composition, for the treatment of Helicobacter infection in a mammalian host, eg a human.
- the present invention also relates to the use of the delivery system in the manufacture of a vaccine composition, for preventing or reducing the risk of Helicobacter infection in a mammalian host.
- Figure 1 is an SEM image of PLGA particles incorporated with HpaA according to the invention.
- the particles have an average diameter of lO ⁇ m.
- Figure 2 is a particle size graph for PLGA particles produced according to the invention.
- the particles are incorporated with HpaA and have an average diameter of lO ⁇ m.
- Figure 3 is an SEM image of PLGA particles incorporated with HpaA according to the invention. The particles have an average diameter of 300nm.
- Figure 4 is a particle size graph for PLGA particles produced according to the invention.
- the particles are incorporated with HpaA and have an average diameter of 300nm.
- Figure 5 shows the serum IgG2a results after intraduodenal immunisation with (i) HpaA co-administered with Cholera toxin (CT); or (ii) HpaA incorporated with PLG particles according to the invention.
- CT Cholera toxin
- the bars represent the median of a group of six animals.
- Figure 6 shows the mucosal IgA results after intraduodenal immunisation with (i) HpaA co-administered with Cholera toxin (CT); or (ii) HpaA incorporated with PLG particles according to the invention.
- CT Cholera toxin
- the bars represent the median of a group of six animals.
- OD405" refers to the optical density read-out of anti-HpaA ELIS A.
- OD405 Optical density read-out of anti-HpaA ELIS A
- the present invention provides a polymer particle vaccine delivery system and a process for its production, in which a water insoluble protein is incorporated with particles comprising a polymer matrix.
- the polymer particles can be in the form of microparticles, such as microspheres.
- protein in “water insoluble protein” is defined as a protein, polypeptide or peptide.
- the present invention contemplates the use of one or more proteins, so that the vaccine carrier system that is produced in some embodiments comprises more than one protein incorporated with the polymer matrix.
- at least one of the proteins is a water insoluble protein antigen; each of the other proteins can be water soluble or insoluble, and may or may not be antigenic (eg it may act as an adjuvant to promote the antigenicity of the water insoluble protein).
- Water insoluble proteins are distinguished from water soluble proteins by their ability to associate with non-ionic detergents to form micelles, whereas water soluble proteins do not associate with such detergents to form micelles (A Practical Guide to Enzymology, C H Suelter, John Wiley & Sons Publishers, ISBN 0-471-86431-5, pp 71-72).
- Water insoluble protein non-ionic detergent micelles can be easily detected, because the electrophoretic mobility of the protein when incorporated in the micelles is different from the protein's electrophoretic mobility in the absence of the non-ionic detergent. Since water soluble proteins do not associate with non-ionic detergents, there is no change in electrophoretic mobility for these proteins when in the presence or absence of a non-ionic detergent.
- the first step is to mix the protein to be tested with a non-ionic detergent, then with an ionic detergent. If micelles are formed (ie the protein is water insoluble), the ionic detergent subsequently added becomes incorporated in the micelles thus changing the electrophoretic mobility of the protein.
- Triton X-l 14 is dispersed in Triton X-l 14 at 0°C. When the temperature of this detergent is raised above 20°C, its cloud point, separation into two phases occurs: an aqueous phase and a detergent phase. Water soluble proteins are recovered in the aqueous phase, whereas water insoluble proteins are found in the detergent phase.
- a W/O emulsion is formed in which the water insoluble protein is solubilised by the solubilising agent in the aqueous W phase, and the matrix polymer is dissolved in the O phase along with the organic solvent.
- Formation of the W/O emulsion can, for example, be effected by mixing the W phase containing the solubilised protein with the O phase containing the dissolved matrix polymer.
- the mixture is then emulsified, eg by ultra-sonication, stirring, extrusion, high shear mixing or high pressure homogenisation, while one or more suitable stabilising agents are included in the mixture.
- one or more stabilising agents can be included in the W phase , but not in the O phase, prior to mixing; or (ii) one or more stabilising agents can be included in each of the W and O phases prior to mixing; or (iii) one or more stabilising agents can be included in the O phase, but not in the W phase, prior to mixing.
- the W phase is mixed with the O phase in a ratio by volume of less than 1 , more preferably 1 : 10,000 to 1:1, even more preferably, 1 : 100 to 1 :1.
- the most preferred range is 1 :4 to 1:1.5 for particularly good protein antigen incorporation.
- the stabilised W/O emulsion is dispersed in a fluid medium (ie, a liquid medium or gaseous medium such as air) to remove the organic solvent.
- a fluid medium ie, a liquid medium or gaseous medium such as air
- the second step can be carried out in various ways.
- the method of the present invention can form part of a Double Emulsion (W/O/X) Solvent Evaporation Technique in which in the second step, the stabilised W/O emulsion is dispersed in a further liquid phase (X) which is immiscible with the O phase to produce a W/O/X double emulsion comprising stabilised W/O droplets from which the solvent is evaporated, 11
- Dispersal of the stabilised W/O emulsion in the X phase can be carried out for example by ultra-sonication.
- the X phase should be immiscible with the O phase or have only low (limited) miscibility with the O phase.
- Suitable examples for the X phase include aqueous phases, triglyceride (eg, sesame oil) and silicone oil.
- the method of the present invention is a Double Emulsion (W/O/X) Solvent Extraction Technique in which in the second step, a W/O/X double emulsion comprising W/O droplets is produced in a similar way to the Double Emulsion Solvent Evaporation Technique.
- the X phase extracts the solvent from the O phase of the droplets, thereby producing the polymer particles incorporating the water insoluble protein antigen.
- suitable X phases for the Extraction Technique should have no or low (limited) miscibility with the O phase, and examples include an aqueous phase, triglyceride (eg, sesame oil) and silicone oil.
- the volume ratio of the X phase to the O phase is, however, considerably larger than with the Evaporation Technique.
- one or more stabilising agents can be included in the X phase.
- the stabilising agents used for stabilising the first (W/O) emulsion can be used for this purpose.
- removal of the solvent can be accelerated by stirring the double emulsion and/or warming (not to a protein antigen denaturing temperature) the double emulsion and/or reducing the pressure inside a vessel containing the double emulsion.
- the method of the present invention is a spray drying technique in which in the second step the stabilised W/O emulsion is dispersed in a gaseous medium (eg air) to form a spray of stabilised W/O emulsion droplets from which the solvent evaporates, thereby producing the polymer particles incorporating the water insoluble protein antigen.
- a gaseous medium eg air
- the W/O emulsion is usually dispersed by pumping it through a nozzle 12
- Spraying into a warmed chamber can be effected in order to promote solvent evaporation.
- a fluid gas technique in the second step for forming the polymer particles.
- These techniques involve supercritical fluid technology.
- a supercritical fluid is a fluid simultaneously at or above its critical pressure and critical temperature.
- An example of a suitable fluid gas technique for the present embodiment is Gas Anti-Solvent Precipitation (GAS).
- GAS Gas Anti-Solvent Precipitation
- a substance of interest is dissolved in a solvent and a supercritical fluid (eg, carbon dioxide) is introduced into (mixed with) the solution, leading to the rapid expansion of the volume of the solution.
- a supercritical fluid eg, carbon dioxide
- the solvating power of the solvent decreases dramatically over a short period of time, thereby triggering the precipitation of particles (Cf. J W Tom and P G Debendetti, J Aerosol.
- the stabilised W/O emulsion is used in place of the solution and a fluid gas is introduced with the solution to lead to a rapid expansion of the stabilised W/O emulsion, and thus formation of polymer particles incorporated the water insoluble protein antigen.
- a modification of the GAS technique is the SEDS (Solution Enhanced Dispersion By Supercritical Fluid) technique (WO 95/01221 and WO 96/00610), and this can be used in the second step of the method of the invention for forming polymer particles.
- SEDS Solution Enhanced Dispersion By Supercritical Fluid
- the supercritical fluid can be, for example, selected from carbon dioxide, nitrous oxide, sulphur hexafiuoride, xenon, ethylene, chlorotrifluoromethane, ethane and trifluoromethane.
- PC A Precipitation with Compressed Anti-Solvents
- SAS Supercritical Anti-Solvent
- None of the prior art discloses the use of a W/O emulsion together with an anti-solvent fluid gas technique like GAS, SEDS, ASES, SAS and PCA, as in the preferred embodiment of the present invention. This avoids the disadvantages of the prior art techniques in which the protein is included directly in an organic phase, while providing an efficient method for producing polymer particles incorporated with a water insoluble protein, for use as a vaccine delivery system.
- an anti-solvent fluid gas technique like GAS, SEDS, ASES, SAS and PCA
- the water insoluble protein must be solubilised in the W phase, and for this a solubilising agent such as a hydrophilic surfactant or chaotropic agent can be used. More than one solubilising agent may optionally be used, ie one or more hydrophilic surfactant, one or more chaotropic agent, or one or more hydrophilic surfactant together with one or more chaotropic agent.
- the solubilising agent is hydrophilic, and by the term “hydrophilic surfactant” is meant a surfactant that solubilises a water insoluble protein antigen and is itself soluble in water (ie in the W phase); surfactants that are soluble in the O phase, but not in the W phase are not included in the term "hydrophilic surfactant”.
- the hydrophilic surfactant has a hydrophile-lipophile balance (HLB) of 10 or more; most preferably 13 or more. It will be readily apparent to the skilled person how to determine HLB values. In addition, reference is made to the following publications, which concern the determination of HLB values: Griffin, W. C, J. Soc. Cosmet. Chem. 1949, 7, 311 ; Griffin, W. C, J. Soc. Cosmet. Chem. 14
- Suitable temperatures at which the W/O emulsion is formed are from 0°C to the boiling point on the O phase, but excluding temperatures that would denature the protein in the emulsion.
- Room temperature is often a suitable working temperature, although it should be mentioned that lower temperatures are preferable to slow down the dynamics of the emulsion.
- Suitable hydrophilic surfactants include one or a mixture of surfactants selected from nonionic, anionic, cationic and zwitterionic surfactants.
- Suitable non-ionic surfactants can be selected from alkyl-glucopyranosides(eg, decyl-, dodecyl-, or octyl-glucopyranoside), alkyl-thioglucopyranosides (eg, octyl- thioglucopyranoside), alkyl-maltosides (eg, dodecyl- or lauryl maltoside), alkoyl-methyl glucamides (eg, heptanoyl-, octanoyl-, nonanoyl-, or decanoyl-N-methyl glucamide), polyoxyethylene alcohols (eg, CjjEg, LuBrol PX or Brij series), polyoxyethylene alkyl phenols (eg, polyoxyethylene octyl phenols such as Nonidet P-40, Triton X-100), emulphogens, polyoxyethylene sorbitol esters (eg
- Suitable anionic surfactants can be selected from cholates (eg, sodium salts of glyco- or taurocholate), alkylsulphonates (eg, the sodium salt of pentyl-, octyl-, decyl-, dodecyl-, or myristylsulphonate), deoxycholates (eg, sodium deoxycholate), alkyl sulphates (eg, the sodium salt of octyl-, decyl-, dodecyl- or myristylsulphate), oligooxyethylene dodecyl ether sulphates and sodium dodecylsarcosinate. 15
- cholates eg, sodium salts of glyco- or taurocholate
- alkylsulphonates eg, the sodium salt of pentyl-, octyl-, decyl-, dodecyl-, or myristylsulphonate
- deoxycholates e
- Suitable cationic surfactants can be selected from alkylpyridinium salts (eg, a bromide or chloride of cetyl-, myristyl-, dodecyl- or decylpyridinium) and alkyltrimethylammonium salts (eg, cetyl-, myristyl-, dodecyl- or decyl-trimethylammonium bromide or chloride).
- alkylpyridinium salts eg, a bromide or chloride of cetyl-, myristyl-, dodecyl- or decylpyridinium
- alkyltrimethylammonium salts eg, cetyl-, myristyl-, dodecyl- or decyl-trimethylammonium bromide or chloride
- Suitable zwitterionic surfactants can be selected from CHAPS (3-[(3-cholamidopropyl dimethylammonio]-l-propanesulphonate), CHAPSO (3-[(3-Cholamidopropyl)- dimethylammonio]-2-hydroxy-l-propanesulphonate), BIGCHAP (N, N-bw[3-D- GluconamidopropylJ-cholamide), deoxy BIGCHAP (N, N-bw[3-D-Gluconamidopropyl]- deoxycholamide), lyso phosphatidylcholine (eg, C16 lyso PC), N-tetradecyl-N,N-dimethyl- 3-ammonia-l -propane sulphonate, alkylbetaines (eg, dodecylbetaine) and sulphobetaines.
- CHAPS 3-[(3-cholamidopropyl dimethylammonio]-l-
- a suitable range for the surfactant is to provide the surfactant in the W phase (in this case, we mean a solution including all of the components of the W phase except the protein(s) to be solubilised) at a concentration of 0.1 to 100 times, preferably 0.1 to 10 times, and more preferably 0.1 to 5 times the Critical Micelle Concentration (CMC) of the surfactant.
- CMC Critical Micelle Concentration
- the surfactant could for example be used at its CMC.
- these ranges relate to the CMC of the mixture.
- Suitable chaotropic agents include one or more of a perchlorate, thiocyanate, guanidine, chlorate, iodide, bromide, nitrate and urea.
- the required hydrophilic character has the undesirable effect of destabilising any W/O emulsion droplets formed, by favouring a phase inversion to an O/W emulsion (ie, the aqueous phase being the outer continuous phase).
- a stabilising agent in the W/O emulsion specifically to counter the undesirable effect of the solubilising agent (while retaining the agent's solubilising capacity) and exert a dominating effect which favours, and therefore stabilises, the W/O emulsion while forming the W/O droplets and forming 16
- the stabilising agent brings about (promotes) the incorporation of the water insoluble protein with the polymer particles.
- the common feature of all stabilising agents is that they adsorb to the W/O interface in the emulsion to prevent or reduce coalescence of the W droplets emulsified in the O phase.
- the stabilising agent may be soluble in the W phase and/or the O phase. More than one stabilising agent may optionally be included in the W/O emulsion.
- Suitable stabilising agents that are soluble in the O phase for example, increase the viscosity of the O phase of the W/O emulsion and/or are surface active agents having a predominantly hydrophobic character (hydrophobic surfactants).
- hydrophobic surfactant is meant a stabilising surfactant that is overall predominantly hydrophobic and is soluble in the O phase, but not in the W phase.
- the stabilising agent is used in a proportion of from 0.01 to 99% by weight of the W/O emulsion , more preferably from 0.02 to 50 or 25% by weight of the W/O emulsion, and most preferably, from 0.05 to 5% by weight of the W/O emulsion.
- a particularly preferred embodiment is the use of 0.3% by weight of the W/O emulsion.
- each agent being selected from polymers, polar lipids, and hydrophobic surfactants.
- a preferred stabilising polymer is selected from poly(vinyl pyrrolidone), poly(vinyl alcohol), polysaccharides, polyethyleneoxide and water soluble proteins (eg, gelatin; bovine serum albumin).
- a preferred polar lipid is selected from cholesterol, phosphatidylcholine, phosphatidylethanolamine, phosphatidylglycerol, glycolipids and phosphatidic acid. 17
- a stabilising agent can be used that is a non-ionic, hydrophobic surfactant selected from a
- TM sorbitan fatty acid ester (SPAN series), hydrophobic polyoxyethylene alkyl ether, sucrose ester, alkyl-glucopyranoside, polyglycerol polyricinoleate and block-copolymers of ethylene oxide with propyleneoxide and/or lactic acid.
- a stabilising agent can be used that is an anionic, hydrophobic surfactant selected from an alkylsulphate salt, dialkylsulphosuccmate salt, alkylbenzene sulphonate salt and a fatty acid salt.
- Particularly preferable examples include sodium 1,4-bis (2-ethylhexyl) sulphosuccinate, calcium dioleate and aluminium or zinc stearate.
- a stabilising agent can be used that is a cationic, hydrophobic surfactant selected from an alkyltrimethylammonium salt and a dialkyldimethylammonium salt (eg, distearyl dimethylammonium bromide).
- a cationic, hydrophobic surfactant selected from an alkyltrimethylammonium salt and a dialkyldimethylammonium salt (eg, distearyl dimethylammonium bromide).
- a suitable stabilising composition is polyoxyethylene sorbitan fatty acid ester mixed with a sorbitan fatty acid ester.
- poly( vinyl pyrrolidone) and sodium 1,4-bis (2-ethylhexyl) sulphosuccinate are used together as stabilising agents.
- the matrix polymer can be used as a stabilising agent by increasing the viscosity of the O phase.
- the matrix polymer can be added to the O phase up to the saturation point of the matrix polymer, with or without the use of another stabilising agent.
- a suitable matrix polymer can be a homo- or co-polymer selected from polyesters, polyanhydrides, polyorthoesters, polycarbonates, polyamides, poly(amino acids), polyacetals, polycyanoacrylates, polyacrylates, biodegradable polyurethanes, non-erodable polyurethanes, polymers of ethylene- vinyl acetate, acyl substituted cellulose acetates, polysaccharides, polystyrenes, polyvinyl chloride, polyvinyl fluoride, poly(vinyl imidazole), chlorosulphonated polyolefins, polyethylene oxide, polyethers and 18
- polyoxalates optionally, mixtures of two or more of these polymers can be used in the O phase as matrix polymers.
- the polymer is an poly(esteramide).
- Preferred matrix polymers are polyester homopolymers, such as polylactic acid, polyglycolic acid, polyhydroxybutyrate, poly(alpha hydroxyacids) and polycaprolactone.
- polyester co-polymers such as poly(lactide-co- glycolide), poly(lactic-co-glycolic acid), poly(hydroxybutyrate-hydroxyvalerate) and poly(lactide-co-caprolactone).
- a particularly preferred matrix polymer is poly(D,L-lactide-co-glycolide).
- one or more organic solvent may be used. Where we make reference to removing the organic solvent from the O phase in the method of the present invention, this should be construed as removing the organic solvent mixture, where more than one solvent is used.
- Suitable organic solvents depend on the particular matrix polymer used, and the skilled person can readily determine which solvent to use in order to dissolve the matrix polymer. Noteable examples of suitable solvents include methylene chloride, chloroform and ethyl acetate.
- the method of the present invention can be used to produce polymer particles with an average diameter ranging from 0.01 to lOOO ⁇ m according to the volume size distribution.
- an average diameter from 0.1 to lOO ⁇ m according to the volume size distribution is preferred.
- an average diameter from 0.05 to 20 ⁇ m according to the volume size distribution is preferred, with a range of 0.1 to lO ⁇ m according to the volume size distribution being the most suitable.
- suitable mammalian mucosa include the buccal, nasal, tonsillar, gastric, intestinal (small and/or large intestine), rectal and 19
- vaginal mucosa a vaginal mucosa.
- Appropriate administration routes for these vaccines include oral, nasal, rectal and vaginal administration, with the oral, nasal and rectal routes being most preferred.
- the delivery system of the present invention When the delivery system of the present invention is provided as part of a vaccine composition, it can optionally be so provided in combination with a suitable adjuvant.
- suitable adjuvants are Cholera toxin (CT), E. coli heat labile toxin, cytokines and chemokines.
- CT Cholera toxin
- E. coli heat labile toxin cytokines
- chemokines chemokines.
- the vaccine compositions can be used to treat and/or prevent a diseased state or infection (depending on the antigen(s) of the delivery system) in a mammalian patient by administering an immunologically effective amount of the composition to the patient.
- immunologically effective amount means an amount which elicits an immune response by the patient to the antigen(s) carried by the delivery system.
- an "immune response” is a response which eradicates, suppresses, prevents and/or reduces the risk of the infection or disease in the patient.
- an appropriate dose of the or each antigen per administration would be approximately lO ⁇ g to lOmg, preferably approximately 50 ⁇ g to 5mg, for oral administration.
- Suitable dosage forms include a frozen dispersion, freeze- dried particles or a liquid dispersion.
- the present invention can be used to provide a polymer particle delivery system that can be included in a vaccine composition for the treatment and/or prophylaxis of Helicobacter (in particular Helicobacter pylori) infection in a mammalian host.
- a vaccine composition for the treatment and/or prophylaxis of Helicobacter (in particular Helicobacter pylori) infection in a mammalian host.
- Helicobacter in particular Helicobacter pylori
- a vaccine can be administered to a patient, eg orally, in order to effect the treatment and/or prophylaxis.
- treatment we mean the eradication or suppression of an existing Helicobacter infection in the host (in this respect, general reference is made to WO 96/40893).
- prophylaxis we mean preventing or reducing the risk of the mammal becoming infected by Helicobacter after the vaccine has been administered.
- Helicobacter pylori is an important human pathogen, involved in several gastroduodenal diseases. Colonisation of gastric epithelium by the bacterium leads to active inflammation and progressive chronic gastritis, with a greatly enhanced risk of progression to peptic ulcer disease.
- H. pylori In order to colonise the gastric mucosa, H. pylori uses a number of virulence factors. Such virulence factors comprise several adhesins, with which the bacterium associates with the mucus and/or binds to epithelial cells; ureases which helps to neutralise the acid environment; and proteolytic enzymes which makes the mucus more fluid.
- the water insoluble protein antigen is a Helicobacter protein or antigenic fragment thereof.
- the protein antigen is a Helicobacter pylori protein or antigenic fragment thereof (eg, a membrane- associated or membrane-bound antigen).
- a Helicobacter protein that is a protein expressed on the outer surface of Helicobacter provides a particularly good antigen for incorporation with the polymer matrix of the vaccine delivery system.
- H. pylori cell transforms from a bacillary to a coccoid form.
- the H. pylori cell is much less sensitive to antibiotics and other anti-bacterial agents. Circumstantial evidence indicate the H. pylori might be transmitted between individuals in this form, possibly via water or direct contact.
- An efficient vaccine composition should therefore elicit an immune response towards both the coccoid and the bacillary form of H. pylori.
- Preferred water insoluble Helicobacter proteins for the vaccine delivery system are therefore such proteins that are exposed on the surface of both the dividing (bacillary) and resting (coccoid) forms of Helicobacter.
- WO 96/38475 discloses an antigen that is a putative adhesin and is exposed on the surface of both the dividing (bacillary) and resting (coccoid) forms of Helicobacter pylori.
- the disclosure of WO 96/38475 is hereby incorporated by reference, and in particular the expression methods disclosed therein are expressly incorporated by reference and the skilled person is directed to these specific disclosures for further guidance.
- the Hpa A protein is expressed by all H. pylori strains tested , and antibodies created towards this protein do not cross-react with common endogenous human bacteria of other species or with selected human tissues including the gastric mucosa. Thus being a well conserved putative adhesin with immunogenic properties, the HpaA protein is useful both for the detection of H. pylori infections as well as for the manufacture of vaccine compositions.
- Table 1 shows a comparison of HpaA amino acid sequences derived from 4 different strains of H. Pylori. It can be seen from the table that the sequence is highly conserved amongst different strains.
- TMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFASIMQEMDKKLT GTC (J99) TMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFASIMQE DKKLT Trust (17874) TMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFGSIMQEIDKKLT Penn (11637) TMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFANIMQEIDKKLT TIGR (26695) TMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSNDAIKSALNKIFANIMQEIDKKLT
- "*" at a certain position denotes an identical amino acid in all sequences ".” at a certain position denotes conserved amino acids (eg, amino acids of the same charge type such as lysine or arginine at a certain position).
- strain names are indicated in brackets, strain 8826 being obtained from SWTSS-PROT accession Q48264. 25
- sequence listing shows a nucleic acid sequence (SEQ ID NO. 1) comprising the hpaA gene and the amino acid sequence (SEQ ID NO. 2) of a HpaA protein that is predicted to be 29 kDa, which includes a signal sequence and is encoded by the hpaA gene.
- amino acid 222 is serine; this position can alternatively be arginine (see SEQ ID NO's. 3 and 4).
- the predicted 29 kDa protein is shown as formula I.
- Protein I is processed by the enzyme prolipoprotein glyceryltransferase to give a product II, followed by the addition of two lipid chains to give product III.
- the latter step is catalysed by at least one transacylase.
- the signal sequence of the lipidated product III is then cleaved off by prolipoprotein signal peptidase to give a product IV (it is believed that the signal sequence corresponds to positions 1 to 27 in SEQ ID NO's. 2 and 4).
- a third lipid chain is then added to this protein by phospholipid diglyceride lipoproteintransacylase to give a "fully lipidated” protein product (V).
- a lipidated form of HpaA can be used as the water insoluble protein.
- a fully lipidated form of HpaA is used (ie, one with at least 3 lipid chains, eg three C16 chains as in protein V).
- the protein part (referred to here as the "protein core") of product V therefore, corresponds to the full length protein (I) minus the signal sequence.
- the protein core (or even antigenic fragments thereof) can be synthesised in vitro and lipidated (not necessarily in the same pattern as product V), and this lipidated HpaA protein can be used as a water insoluble protein antigen in the present invention.
- the protein part of the antigen has an amino acid sequence that is identical or substantially similar to positions 28 to 260 of the amino acid sequence set out in SEQ ID NO.2 or 4, but of course retaining antigenic activity suitable for use in a vaccine for prophylaxis and/or treatment of Helicobacter infection in a mammalian host (including the ability of the antigen to elicit a mucosal as well as a systemic immune response against Helicobacter in a mammalian host).
- the protein part includes an amino acid sequence at least 60%, 70%, 80%, 90%, 95%, 98% or 99% homologous to positions 28 to 260 of the amino acid sequence set out in SEQ ID NO.2 or 4; the protein part includes at least 5, 10, 20, 50, 100, 150 or 200 contiguous amino acid residues of positions 28 to 260 of the amino acid sequence set out in SEQ ID NO.
- antigenic activity ie at least one immunogenic epitope, with or without fusion to an inert or immunologically active carrier polypeptide
- the protein part of the antigen includes an amino acid sequence differing in amino acid sequence by 1, 2, 3, 5, or 10 residues from positions 28 to 260 of the amino acid sequence set out in SEQ ID NO. 2 or 4, but retaining antigenic activity suitable for use in a vaccine for prophylaxis and/or treatment of Helicobacter infection in a mammalian host.
- the protein antigen used in the invention may be prepared from Helicobacter cells and/or produced by recombinant techniques.
- each lipid chain can be a C12 to C20 lipid chain.
- C16 and C18 lipid chains are preferred, and most preferably, the HpaA antigen has at least one C16 chain and at least one C18 chain. It is known that lipid modification can determine immuno logical properties of bacterial lipoproteins (see Weis, J J et al (1994) Infection and 29
- the protein has three C16 lipid chains (protein V above), the protein has a predicted weight of 27 kDa.
- the weight of HpaA protein may, however, vary depending on the lipidation pattern of the protein.
- HpaA with either PLGA particles or PHB (poly(3-hydroxybutyrate)) particles.
- the particle size, form and morphology were studied with scanning electron microscopy. Degree of agglomeration and particle size distribution were analysed with an Aerosizer (Aerosizer®, Amherst Process Instruments, Hadley, MA, USA). This measurement technique is based on the determination of the aerodynamic time-of- flight for the particles. The density of the particles assumed to be equal to the polymers density, 1.25 g/cm 3 for PHB.
- Particle sizes were also determined by means of laser diffraction, using a Coulter LSI 30 (Coulter Corp, Hialeah, Florida, USA).
- SDS-laemmli 400 ⁇ l was then added and the protein was extracted from the organic phase to the water phase. The samples were shaken at 60°C for 30 min. The water phase was heated to 95°C for 15 min and the protein content analysed by polyacrylamide gel electrophoresis (SDS-PAGE).
- SDS Laemmli reagent solution used in the protein analysis consisted of 1.25 ml TRIS HCI 2 M (pH 6.8) buffer solution, 5.05 g glycerol (99%), 0.8 g sodium dodecylsulphate (SDS), 1 ml 2-mercaptoethanol, 1 ⁇ l bromophenol blue and 10 ml water.
- Particles (3-10 mg) were dissolved in 1 ml acetone.
- the protein precipitate was centrifuged for 15 minutes at 17 530xg, and about 2/3 of the supernatant was removed with a Hamilton syringe. Pure acetone was added in order to wash the sample twice. The remaining acetone was evaporated by vacuum centrifugation. SDS-Laemmli (200 ⁇ l) was added and the sample was heated to 95°C for 15 minutes. The analysis of the protein content was performed by SDS-PAGE.
- HpaA 27kDa lipidated form of HpaA (ie protein V above) was used.
- the HpaA polypeptide antigen was obtained in-house.
- PLGA particles incorporated with the HpaA protein were produced to an average diameter of approximately lO ⁇ m according to the volume size distribution , which is well suited to gastric mucosal delivery.
- RESOMER 502 Boehringer Ingelheim
- DCM dichloromethane
- PVA poly(vinyl alcohol), Mw 13-23 000, Aldrich
- PVP poly(vinyl pyrrolidone), Mw 10 000, Aldrich
- acetone NOG (n-Octyl-glucopyranoside, SIGMA), TRIS buffer salts and Laemmli sample buffer
- the water was of ELGA quality (18.2 M ⁇ ).
- the volume average diameter of the particles was determined to 9.4 ⁇ m by laser diffraction measurements.
- the degree of protein antigen incorporation with the PLGA particles was determined by SDS-PAGE to be 49 % of the protein that was initially added.
- the antigen concentration in the suspension was adjusted to 0.33 g/1.
- Figure 1 shows an SEM image for particles of Example 1.
- Figure 2 shows the particle size distribution of particles of Example 1.
- PLGA particles incorporated with the HpaA protein were produced to an average diameter of approximately 300nm according to the volume size distribution, which is well suited to gastric mucosal delivery.
- TM RESOMER 502 Boehringer Ingelheim
- DCM dichloromethane
- PVA poly(vinyl alcohol), Mw 13-23000, Aldrich
- PVP poly(vinyl pyrrolidone), Mw 10 000, Aldrich
- AOT sodium 1,4-bis (2-ethylhexyl) sulphosuccinate, SIGMA), acetone, NOG (n-Octyl- glucopyranoside, SIGMA), TRIS buffer salts and Laemmli sample buffer were used as purchased.
- the water was of ELGA quality (18.2 M ⁇ ).
- the volume average size diameter of the particles was determined to 0.35 ⁇ m/1.7 ⁇ m (bimodal distribution) by laser diffraction measurements.
- the HpaA content (% of dry particles) was calculated to 0.3% (w/w).
- Figure 3 shows an SEM image for particles of Example 2.
- Figure 4 shows the particle size distribution of particles of Example 2.
- PLGA particles incorporated with the HpaA protein were produced to an average diameter of approximately 300nm according to the volume size distribution, which is well suited to gastric mucosal delivery.
- the volume average size of the particles was determined to 0.35 ⁇ m/1.7 ⁇ m (bimodal distribution, 10 % (w/w) PVA) and 0.29 ⁇ m (2% (w/w) PVA) by laser diffraction measurements.
- PLGA particles inco ⁇ orated with the HpaA protein were produced to an average diameter of 6 ⁇ m according to the volume size distribution, which is well suited to gastric mucosal delivery.
- the volume average size of the particles was determined to 6 ⁇ m by laser diffraction measurements.
- PLGA particles inco ⁇ orated with the HpaA protein were produced to an average diameter of approximately 6 ⁇ m according to the volume size distribution, which is well suited to gastric mucosal delivery.
- the volume average size of the particles was determined to 5.8 ⁇ m by laser diffraction measurements.
- PLGA particles inco ⁇ orated with the HpaA protein were produced to an average diameter of 4 ⁇ m according to the volume size distribution, which is well suited to gastric mucosal delivery.
- Span 85/Tween 80 (ratio: 80/20 by weight), by probe sonication at 65 W output for 5 min.
- the formed W,/O emulsion was further dispersed in 56 g 10 % (w/w) PVA (aq) by homogenization at 5 000 ⁇ m for 5 min.
- the formation of double emulsion droplets was confirmed by light microscopy.
- the (W ⁇ /O)/W2 double emulsion was stirred overnight to allow the DCM to evaporate.
- the volume average size of the particles was determined to 4 ⁇ m by laser diffraction measurements.
- PLGA particles inco ⁇ orated with the HpaA protein were produced to an average diameter of 150nm according to the volume size distribution, which is well suited to gastric mucosal delivery.
- TM TM alcohol Mw 13-23 000, Aldrich
- Tween 80 Merck
- Span 85 Specificality Chemicals
- Laemmli sample buffer was used as purchased.
- the water was of ELGA quality (18.2 M ⁇ ).
- Span 85/Tween 80 (ratio: 80/20 by weight), by probe sonication at 65 W output for 10 min.
- the formed W,/O emulsion was further dispersed in 10ml 10 % (w/w) PVA (aq) by sonication at 65 w for 10 min.
- the formation of double emulsion droplets was confirmed by light microscopy.
- the (W ⁇ /O)/W2 double emulsion was stirred overnight to allow the DCM to evaporate. The particles were collected by centrifugation and washed with water to remove the PVA.
- the volume average size of the particles was determined to 130 nm/480 nm by laser diffraction measurements.
- the degree of protein antigen inco ⁇ oration with the PLGA particles was determined by SDS-PAGE to be 44 % of the protein that was initially added.
- PLGA particles inco ⁇ orated with the HpaA protein were produced to an average diameter of approximately 13 ⁇ m according to the volume size distribution, which is well suited to gastric mucosal delivery.
- PL(D,L)GA poly D,L-lactic-co-glycolic acid, 50:50, Mw 14400, RESOMERTM 502, Boehringer Ingelheim
- DCM diichloromethane
- PGPR polyglycerol polyricinoleate, Danisco
- PVA poly(vinyl alcohol), Mw 13-23000, Aldrich
- NOG n- Octyl-glucopyranoside, SIGMA
- TRIS buffer salts and Laemmli sample buffer were used as purchased.
- the water was of ELGA quality (18.2 M ⁇ ).
- the average diameter of the particles was determined to 12.6 ⁇ m by laser diffraction measurements.
- the protein antigen content in the dry PLGA particles was determined by SDS-PAGE to be 0.2 % (w/w), which corresponds to an encapsulation degree of 44 % of the protein that was initially added.
- PLGA particles inco ⁇ orated with the HpaA protein were produced to an average diameter
- the volume average diameter of the particles was determined to 9.3 ⁇ m by laser diffraction
- the protein antigen content in the dry PLGA particles was determined by
- the volume average diameter of the particles was determined to 3.2 ⁇ m by laser diffraction
- the protein antigen content in the PHB particle suspension was determined
- PHB particles inco ⁇ orated with the HpaA protein were produced.
- Particles were prepared in a SEDS apparatus (Bradford Particle Design, Bradford, UK) from a stabilised W/O emulsion containing the water insoluble protein antigen.
- the emulsion and the anti-solvent (CO 2 ) were introduced in a coaxial nozzle, which is located inside a pressure vessel which is was located in an oven. Under controlled pressure and temperature conditions, the anti-solvent extracts the organic solvent from O phase of the formed emulsion droplets. The concentration of the matrix polymer in the droplets is thereby increased, leading to rapid particle formation. The particles were collected in a vessel, while the anti-solvent and the extracted organic solvent emerged through a back pressure regulator.
- the nozzle used was a three component nozzle connected, either in a sandwich mode or in a two-solutions mode, with an opening of 0.2 mm in diameter.
- sandwich mode the supercritical fluid passes through the innermost and the outermost passage, while the emulsion passes through the intermediate passage.
- the emulsion 42 In the two solution mode, the emulsion 42
- the fluid gas passes through the outer passage, the modifier through the intermediate passage and the emulsion through the inner passage.
- PHB was dissolved in methylene chloride at 2 bar, 90°C. Equal volumes of 2% (w/w) PVP (aq) and HpaA stock solution [1.11 mg/ml HpaA in TRIS-HC1 buffer (10 mM, pH 8) and 2% (w/w) NOG], were mixed. This mixture (3.8 ml) was injected (during homogenisation at 20000 ⁇ m) to 15.2 ml methylene chloride containing 1% (w/w) PHB and 0.4% (w/w) AOT in a 25 ml Kinematica dispersion vessel. The total homogenisation time was 3 minutes. The homogemser used was a Polytron PT3100, Rotor PT-DA 3012/2 (Kinematica AG, Switzerland). All procedures were performed under ambient conditions.
- the particle size was 1-3 ⁇ m for both trials (MPP63 and MPP64).
- Theoretical composition of particles should be 55.8% (w/w) PHB, 43.5% (w/w) surfactants and 0.6% (w/w) HpaA.
- the analysis of the amount of HpaA gave a result of 0.4% HpaA of the total weight of the particles for both MPP63 and MPP64.
- An in vivo rat model was used for screening of antibody levels in response to duodenally administered antigen delivery systems according to the preferred embodiment of the invention.
- This model is based on the use of Spraque-Dawley rats equipped with a chronic duodenal fistula for adrninistration of delivery systems. IgG2a and IgA levels are investigated in blood and mucus samples respectively.
- a fistula made of Plexiglas 1 is inserted into the duodenum to enable administration of drugs intraduodenaly.
- Ketamin (Ketalar ® 50 mg ml) + Xylazin (Rompun ® 20 mg/ml) mixed 8+1. There was given 0,2 ml/kg body weight ip.
- Procedure Shave and disinfect the abdomen. Make a 2-3 cm long midline incision. Make a pouch-suture with a non absorbable material (e.g. Ticron 5-0 or 4-0) about 0.5-1 cm from the pylorus in the duodenum. Make a hole in the duodenum with a 18Gxl" cannula and widen it with a small pair of tweezers. Put the cannula in the hole and tighten the suture so that it fits in with the narrow part of the fistula. Flush the fistula with physiological saline to make sure that it does not leak and to clear the fistula from blood.
- a non absorbable material e.g. Ticron 5-0 or 4-0
- the rats are put into Bollman-cages (a procedure for which rats are trained during a week following operation and prior to administration).
- the cap from the fistula is unscrewed and replaced with a catheter.
- a delivery system is administered with a syringe and a blunt cannula which exactly fits with the catheter. Close the catheter with forceps, withdraw the first syringe and put a new syringe with physiological saline onto the catheter, open the forceps and flush the rest content of the drug into the duodenum. Close the catheter with the forceps again and withdraw the syringe. Leave the catheter closed for about 5 minutes before the catheter is removed and the cap is put on the fistula. 45
- Measurements of antibody production were made following duodenal administration of antigen, delivery system including antigen, antigen + adjuvant or delivery system (including antigen) + adjuvant.
- the rats are administered once weekly and are terminated 10 weeks after the last immunisation. Upon termination samples are taken and evaluated. Every two weeks after the last immunisation blood-samples are collected and evaluated.
- Microtiter plates are coated with the antigen (2 ⁇ g/ml in PBS) over night at 4°C. After
- TM washing three times with PBS-0.5%Tween 20 the wells are blocked with 2.5% non-fat dry milk in PBS for 1 hour at room temperature.
- Triplicate wells are incubated with serial sample dilutions for 1 h at room temperature.
- IgG2a quantification a standard serum is applied in serial dilutions to each plate.
- the wells are incubated with biotinylated mouse-anti rat IgG2a (serum) or IgA (mucus), diluted 1:1000 respectively for 1 h at room temperature. This is followed by lh incubation at room temperature with avidin-alkaline phosphatase, diluted 1 :500.
- the plates are developed by using alkaline phosphatase substrate (pNPP) and colour development is recorded at 405 nm after 20 minutes.
- pNPP alkaline phosphatase substrate
- Rats were immunised with either (i) lOO ⁇ g HpaA + 25 ⁇ g Cholera toxin(CT) (sample size: 4 rats); or (ii) the polymer particle delivery system of Example 1 (HpaA/PLG) containing lOO ⁇ g HpaA (sample size: 6 rats). Three immunisations were carried out for each rat (one per week), 46
- the combination of protein (HpaA) + the mucosal adjuvant CT was used as a positive control.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Processes Of Treating Macromolecular Substances (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP99924075A EP1071457B1 (en) | 1998-04-14 | 1999-04-09 | Polymer particle vaccine delivery system |
| JP2000543160A JP4759134B2 (ja) | 1998-04-14 | 1999-04-09 | ポリマー粒子ワクチンデリバリーシステム |
| AU40662/99A AU765118B2 (en) | 1998-04-14 | 1999-04-09 | Polymer particle vaccine delivery system |
| AT99924075T ATE545432T1 (de) | 1998-04-14 | 1999-04-09 | Abgabevorrichtung für impfstoff auf basis von polymerpartikeln |
| US09/308,435 US6838089B1 (en) | 1998-04-14 | 1999-04-09 | Antigen delivery system and method of production |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SE9801288A SE9801288D0 (sv) | 1998-04-14 | 1998-04-14 | Vaccine delivery system and metod of production |
| SE9801288-3 | 1998-04-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO1999052550A1 true WO1999052550A1 (en) | 1999-10-21 |
Family
ID=20410947
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/SE1999/000582 Ceased WO1999052550A1 (en) | 1998-04-14 | 1999-04-09 | Polymer particle vaccine delivery system |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US6838089B1 (https=) |
| EP (1) | EP1071457B1 (https=) |
| JP (2) | JP4759134B2 (https=) |
| AT (1) | ATE545432T1 (https=) |
| AU (1) | AU765118B2 (https=) |
| SE (1) | SE9801288D0 (https=) |
| WO (1) | WO1999052550A1 (https=) |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001083533A1 (en) * | 2000-04-29 | 2001-11-08 | Astrazeneca Ab | Helicobacter pylori antigens: fusion of hpaa and hpa44 |
| EP1105101B1 (en) * | 1998-08-18 | 2004-11-17 | Southern Research Institute | Compositions and methods for treating intracellular infections |
| WO2005060989A1 (en) * | 2003-12-23 | 2005-07-07 | Lek Pharmaceuticals D.D. | A pharmaceutical composition comprising an active principle and sulphobetaine |
| EP1834651A1 (en) * | 2006-03-15 | 2007-09-19 | Universiteit Gent | Compositions and methods for veterinary vaccination |
| US7354601B2 (en) | 2003-05-08 | 2008-04-08 | Walker Stephen E | Particulate materials |
| US7582284B2 (en) | 2002-04-17 | 2009-09-01 | Nektar Therapeutics | Particulate materials |
| EP2241309A3 (en) * | 2001-07-10 | 2012-12-26 | Corixa Corporation | Methods for encapsulation of proteins and adjuants in microspheres |
| EP2612703A2 (en) | 2002-04-17 | 2013-07-10 | Nektar Therapeutics | Particulate materials |
| EP2747777A4 (en) * | 2011-08-25 | 2015-04-29 | Brian Pulliam | ROTAVIRUS PREPARATIONS WITH EXCESSIVE CALCIUMIONES AND HIGH VISCOSITY TO ENSURE VACCINITY OF THE VACCINE AT HIGH TEMPERATURES |
| US9120031B2 (en) | 2000-11-09 | 2015-09-01 | Nektar Therapeutics | Compositions of particulate coformulation |
| US9539217B2 (en) | 2013-04-03 | 2017-01-10 | Allertein Therapeutics, Llc | Nanoparticle compositions |
| US9597385B2 (en) | 2012-04-23 | 2017-03-21 | Allertein Therapeutics, Llc | Nanoparticles for treatment of allergy |
| US9808030B2 (en) | 2011-02-11 | 2017-11-07 | Grain Processing Corporation | Salt composition |
| US9833451B2 (en) | 2007-02-11 | 2017-12-05 | Map Pharmaceuticals, Inc. | Method of therapeutic administration of DHE to enable rapid relief of migraine while minimizing side effect profile |
| US10265407B2 (en) | 2007-02-15 | 2019-04-23 | Yale University | Modular nanodevices for smart adaptable vaccines |
Families Citing this family (86)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU7247000A (en) * | 2000-01-11 | 2001-07-19 | Givaudan Sa | Composite materials |
| US20060263350A1 (en) * | 2003-09-26 | 2006-11-23 | Fairfield Clinical Trials Llc | Combination antihistamine medication |
| WO2006080951A2 (en) * | 2004-07-01 | 2006-08-03 | Yale University | Targeted and high density drug loaded polymeric materials |
| WO2006068421A1 (en) * | 2004-12-22 | 2006-06-29 | Kyungpook National University Industry-Academic Cooperation Foundation | Nanofiber mesh for cell culture |
| US20070009564A1 (en) * | 2005-06-22 | 2007-01-11 | Mcclain James B | Drug/polymer composite materials and methods of making the same |
| WO2007011708A2 (en) * | 2005-07-15 | 2007-01-25 | Micell Technologies, Inc. | Stent with polymer coating containing amorphous rapamycin |
| WO2007011707A2 (en) | 2005-07-15 | 2007-01-25 | Micell Technologies, Inc. | Polymer coatings containing drug powder of controlled morphology |
| GB0602637D0 (en) * | 2006-02-09 | 2006-03-22 | Glaxo Group Ltd | Novel process |
| WO2007127799A2 (en) * | 2006-04-25 | 2007-11-08 | Research Foundation Of The City University Of New York | Polymer submicron particle preparation by surfactant- mediated precipitation |
| ES2540059T3 (es) | 2006-04-26 | 2015-07-08 | Micell Technologies, Inc. | Recubrimientos que contienen múltiples fármacos |
| WO2008042909A2 (en) | 2006-10-02 | 2008-04-10 | Micell Technologies Inc. | Surgical sutures having increased strength |
| EP1913955A1 (en) | 2006-10-19 | 2008-04-23 | Gerhard, Markus | Novel method for treating H.pylori infections |
| CA2667228C (en) * | 2006-10-23 | 2015-07-14 | Micell Technologies, Inc. | Holder for electrically charging a substrate during coating |
| US11426494B2 (en) | 2007-01-08 | 2022-08-30 | MT Acquisition Holdings LLC | Stents having biodegradable layers |
| CA2679712C (en) | 2007-01-08 | 2016-11-15 | Micell Technologies, Inc. | Stents having biodegradable layers |
| BRPI0810370A2 (pt) * | 2007-04-17 | 2014-10-29 | Micell Technologies Inc | Stent revestido, e, método para preparar um stent |
| AU2008256684B2 (en) * | 2007-05-25 | 2012-06-14 | Micell Technologies, Inc. | Polymer films for medical device coating |
| US20100172845A1 (en) * | 2007-05-29 | 2010-07-08 | Board Of Regents Of The University Of Texas System | Compositions and methods for treating mycobacterial infections |
| CN106310293A (zh) | 2007-09-27 | 2017-01-11 | 免疫疫苗技术有限公司 | 在包括连续疏水相的载体中的脂质体在体内输送多核苷酸中的应用 |
| US20100209452A1 (en) * | 2007-10-03 | 2010-08-19 | Immunovaccine Technologies, Inc | Compositions comprising an antigen, an amphipathic compound and a hydrophobic carrier, and uses thereof |
| US20100298928A1 (en) * | 2007-10-19 | 2010-11-25 | Micell Technologies, Inc. | Drug Coated Stents |
| CN102083397B (zh) * | 2008-04-17 | 2013-12-25 | 米歇尔技术公司 | 具有生物可吸收层的支架 |
| WO2009146523A1 (en) * | 2008-06-05 | 2009-12-10 | Immunovaccine Technologies Inc. | Compositions comprising liposomes, an antigen, a polynucleotide and a carrier comprising a continuous phase of a hydrophobic substance |
| JP2011528275A (ja) | 2008-07-17 | 2011-11-17 | ミセル テクノロジーズ,インク. | 薬物送達医療デバイス |
| US20100111836A1 (en) * | 2008-10-31 | 2010-05-06 | Searete Llc, A Limited Liability Corporation Of The State Of Delaware | Compositions and methods for therapeutic delivery with frozen particles |
| US8721583B2 (en) * | 2008-10-31 | 2014-05-13 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US20100111857A1 (en) * | 2008-10-31 | 2010-05-06 | Boyden Edward S | Compositions and methods for surface abrasion with frozen particles |
| US8603494B2 (en) * | 2008-10-31 | 2013-12-10 | The Invention Science Fund I, Llc | Compositions and methods for administering compartmentalized frozen particles |
| US8793075B2 (en) * | 2008-10-31 | 2014-07-29 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US8545857B2 (en) * | 2008-10-31 | 2013-10-01 | The Invention Science Fund I, Llc | Compositions and methods for administering compartmentalized frozen particles |
| US8731841B2 (en) | 2008-10-31 | 2014-05-20 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US8603495B2 (en) * | 2008-10-31 | 2013-12-10 | The Invention Science Fund I, Llc | Compositions and methods for biological remodeling with frozen particle compositions |
| US8409376B2 (en) | 2008-10-31 | 2013-04-02 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US20100111834A1 (en) * | 2008-10-31 | 2010-05-06 | Searete Llc, A Limited Liability Corporation Of The State Of Delaware | Compositions and methods for therapeutic delivery with frozen particles |
| US9050317B2 (en) * | 2008-10-31 | 2015-06-09 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US8731840B2 (en) | 2008-10-31 | 2014-05-20 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US8551505B2 (en) * | 2008-10-31 | 2013-10-08 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US8788211B2 (en) * | 2008-10-31 | 2014-07-22 | The Invention Science Fund I, Llc | Method and system for comparing tissue ablation or abrasion data to data related to administration of a frozen particle composition |
| US8762067B2 (en) | 2008-10-31 | 2014-06-24 | The Invention Science Fund I, Llc | Methods and systems for ablation or abrasion with frozen particles and comparing tissue surface ablation or abrasion data to clinical outcome data |
| US9072688B2 (en) | 2008-10-31 | 2015-07-07 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US9060926B2 (en) * | 2008-10-31 | 2015-06-23 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with frozen particles |
| US8725420B2 (en) * | 2008-10-31 | 2014-05-13 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US20100111841A1 (en) * | 2008-10-31 | 2010-05-06 | Searete Llc | Compositions and methods for surface abrasion with frozen particles |
| US20100111831A1 (en) * | 2008-10-31 | 2010-05-06 | Searete Llc, A Limited Liability Corporation Of The State Of Delaware | Compositions and methods for surface abrasion with frozen particles |
| US20100111835A1 (en) * | 2008-10-31 | 2010-05-06 | Searete Llc, A Limited Liability Corporation Of The State Of Delaware | Compositions and methods for therapeutic delivery with frozen particles |
| US9072799B2 (en) * | 2008-10-31 | 2015-07-07 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US9050070B2 (en) * | 2008-10-31 | 2015-06-09 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US9050251B2 (en) * | 2008-10-31 | 2015-06-09 | The Invention Science Fund I, Llc | Compositions and methods for delivery of frozen particle adhesives |
| US8414356B2 (en) * | 2008-10-31 | 2013-04-09 | The Invention Science Fund I, Llc | Systems, devices, and methods for making or administering frozen particles |
| US9060934B2 (en) * | 2008-10-31 | 2015-06-23 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US8613937B2 (en) | 2008-10-31 | 2013-12-24 | The Invention Science Fund I, Llc | Compositions and methods for biological remodeling with frozen particle compositions |
| US8545855B2 (en) * | 2008-10-31 | 2013-10-01 | The Invention Science Fund I, Llc | Compositions and methods for surface abrasion with frozen particles |
| US9060931B2 (en) * | 2008-10-31 | 2015-06-23 | The Invention Science Fund I, Llc | Compositions and methods for delivery of frozen particle adhesives |
| US8858912B2 (en) * | 2008-10-31 | 2014-10-14 | The Invention Science Fund I, Llc | Frozen compositions and methods for piercing a substrate |
| US8834913B2 (en) * | 2008-12-26 | 2014-09-16 | Battelle Memorial Institute | Medical implants and methods of making medical implants |
| CA2756386C (en) * | 2009-03-23 | 2019-01-15 | Micell Technologies, Inc. | Drug delivery medical device |
| US20100241220A1 (en) * | 2009-03-23 | 2010-09-23 | Mcclain James B | Peripheral Stents Having Layers |
| EP2411440B1 (en) * | 2009-03-23 | 2018-01-17 | Micell Technologies, Inc. | Improved biodegradable polymers |
| JP5464573B2 (ja) * | 2009-03-31 | 2014-04-09 | 独立行政法人産業技術総合研究所 | 中空粒子の製造方法 |
| WO2010120552A2 (en) | 2009-04-01 | 2010-10-21 | Micell Technologies, Inc. | Coated stents |
| EP3366326A1 (en) | 2009-04-17 | 2018-08-29 | Micell Technologies, Inc. | Stents having controlled elution |
| EP2453834A4 (en) | 2009-07-16 | 2014-04-16 | Micell Technologies Inc | MEDICAL DEVICE DISPENSING MEDICINE |
| US9803060B2 (en) * | 2009-09-10 | 2017-10-31 | Bridgestone Corporation | Compositions and method for making hollow nanoparticles from metal soaps |
| EP2531140B1 (en) | 2010-02-02 | 2017-11-01 | Micell Technologies, Inc. | Stent and stent delivery system with improved deliverability |
| US8795762B2 (en) | 2010-03-26 | 2014-08-05 | Battelle Memorial Institute | System and method for enhanced electrostatic deposition and surface coatings |
| JP2011207988A (ja) * | 2010-03-29 | 2011-10-20 | Sumitomo Chemical Co Ltd | 樹脂用の加工安定化剤、該加工安定化剤を含む樹脂組成物、および樹脂の加工安定性を向上させる方法 |
| EP2560576B1 (en) | 2010-04-22 | 2018-07-18 | Micell Technologies, Inc. | Stents and other devices having extracellular matrix coating |
| WO2012009684A2 (en) | 2010-07-16 | 2012-01-19 | Micell Technologies, Inc. | Drug delivery medical device |
| US9821051B1 (en) | 2010-10-28 | 2017-11-21 | Seqirus UK Limited | Reducing hospitalization in elderly influenza vaccine recipients |
| MX374963B (es) | 2011-04-29 | 2025-03-06 | Selecta Biosciences Inc | Nanoportadores sintéticos tolerogénicos para reducir las respuestas de anticuerpos. |
| WO2012166819A1 (en) | 2011-05-31 | 2012-12-06 | Micell Technologies, Inc. | System and process for formation of a time-released, drug-eluting transferable coating |
| CA2841360A1 (en) | 2011-07-15 | 2013-01-24 | Micell Technologies, Inc. | Drug delivery medical device |
| CN113876945A (zh) | 2011-10-06 | 2022-01-04 | 免疫疫苗技术有限公司 | 包括激活或增加tlr2活性的佐剂的脂质体组合物及其应用 |
| US10188772B2 (en) | 2011-10-18 | 2019-01-29 | Micell Technologies, Inc. | Drug delivery medical device |
| US8852648B2 (en) * | 2012-11-06 | 2014-10-07 | Rochal Industries, Llp | Delivery of biologically-active agents using volatile, hydrophobic solvents |
| KR20150143476A (ko) | 2013-03-12 | 2015-12-23 | 미셀 테크놀로지즈, 인코포레이티드 | 생흡수성 생체의학적 임플란트 |
| BR122020023215B1 (pt) | 2013-05-03 | 2022-11-22 | Selecta Biosciences, Inc | Composição e kit de nanocarreadores sintéticos tolerogênicos para reduzir ou prevenir anafilaxia em resposta a um antígeno não alergênico |
| HK1222313A1 (zh) | 2013-05-15 | 2017-06-30 | Micell Technologies, Inc. | 可生物吸收的生物医学植入物 |
| JP7242180B2 (ja) | 2014-09-07 | 2023-03-20 | セレクタ バイオサイエンシーズ インコーポレーテッド | 抗ウイルス導入ベクター免疫応答を減弱化するための方法および組成物 |
| EP3320019B1 (en) * | 2015-07-09 | 2020-08-12 | Evonik Operations GmbH | Process for preparing poly(glycolide-co-lactide) copolymer microparticles |
| US10828358B2 (en) | 2015-12-14 | 2020-11-10 | Technische Universität München | Helicobacter pylori vaccines |
| EP3272354A1 (en) | 2016-07-20 | 2018-01-24 | Technische Universität München | Agents and methods for the prevention or treatment of h. pylori infections |
| WO2018039465A1 (en) * | 2016-08-25 | 2018-03-01 | Selecta Biosciences, Inc. | Polyester polymer matrices for the delivery of allergens |
| ES3036482T3 (en) | 2017-03-11 | 2025-09-19 | Cartesian Therapeutics Inc | Methods and compositions related to combined treatment with anti-inflammatories and synthetic nanocarriers comprising an immunosuppressant |
| KR102170146B1 (ko) * | 2019-03-05 | 2020-10-26 | 서울대학교산학협력단 | Pca 공정을 이용한 배양액의 결정화 장치 및 방법 |
| AU2020287627A1 (en) | 2019-06-04 | 2021-11-18 | Selecta Biosciences, Inc. | Formulations and doses of PEGylated uricase |
Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4919929A (en) | 1984-02-01 | 1990-04-24 | Stolle Research & Development Corporation | Mammal immunization |
| US5075109A (en) | 1986-10-24 | 1991-12-24 | Southern Research Institute | Method of potentiating an immune response |
| WO1995011009A1 (en) | 1993-10-22 | 1995-04-27 | Genentech, Inc. | Method for preparing microspheres comprising a fluidized bed drying step |
| WO1995011010A1 (en) | 1993-10-22 | 1995-04-27 | Genentech, Inc. | Methods and compositions for microencapsulation of antigens for use as vaccines |
| US5417986A (en) * | 1984-03-16 | 1995-05-23 | The United States Of America As Represented By The Secretary Of The Army | Vaccines against diseases caused by enteropathogenic organisms using antigens encapsulated within biodegradable-biocompatible microspheres |
| US5529777A (en) | 1993-07-12 | 1996-06-25 | Virus Research Institute | Hydrogel microencapsulated vaccines |
| US5538729A (en) * | 1992-04-13 | 1996-07-23 | Oravax, Inc. | Oral treatment of helicobacter infection |
| WO1996036317A1 (en) | 1995-05-18 | 1996-11-21 | Alkermes Controlled Therapeutics, Inc. | Production scale method of forming microparticles |
| US5591433A (en) * | 1991-06-21 | 1997-01-07 | University Of Cincinnati | Oral administration of immunologically active biomolecules and other therapeutic proteins |
| EP0766967A1 (en) * | 1989-09-01 | 1997-04-09 | Mallinckrodt Veterinary Limited | Adjuvant complexes |
| US5622649A (en) | 1991-06-27 | 1997-04-22 | Emory University | Multiple emulsions and methods of preparation |
| WO1998028357A1 (en) * | 1996-12-20 | 1998-07-02 | Connaught Laboratories Limited | Biodegradable targetable microparticle delivery system |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4038139A (en) * | 1976-07-16 | 1977-07-26 | G. D. Searle & Co., Limited | Cell culture medium |
| JPS60100516A (ja) | 1983-11-04 | 1985-06-04 | Takeda Chem Ind Ltd | 徐放型マイクロカプセルの製造法 |
| DE3678308D1 (de) | 1985-02-07 | 1991-05-02 | Takeda Chemical Industries Ltd | Verfahren zur herstellung von mikrokapseln. |
| ATE165749T1 (de) | 1991-06-27 | 1998-05-15 | Univ Emory | Mehrkomponentemulsionen und verfahren zur deren herstellung |
| CH683149A5 (fr) * | 1991-07-22 | 1994-01-31 | Debio Rech Pharma Sa | Procédé pour la préparation de microsphères en matériau polymère biodégradable. |
| AR003125A1 (es) * | 1995-06-01 | 1998-07-08 | Astra Ab | Antigenos bacterianos para el diagnostico de infecciones con helicobacter pylori, una molecula de adn que lo codifica, un vector, una celula huesped,procedimiento para producir el polipeptido, composiciones para vacunas adecuadas para uso terapeutico y profilactico, el uso del polipeptido en la |
| GB9514285D0 (en) * | 1995-07-13 | 1995-09-13 | Univ Nottingham | Polymeric lamellar substrate particles for drug delivery |
| KR0180334B1 (ko) * | 1995-09-21 | 1999-03-20 | 김윤 | 블럭 공중합체 미셀을 이용한 약물전달체 및 이에 약물을 봉입하는 방법 |
| US6322810B1 (en) * | 1997-07-14 | 2001-11-27 | Hayat Alkan-Onyuksel | Materials and methods for making improved micelle compositions |
| HU226076B1 (en) * | 1999-10-26 | 2008-04-28 | Bayer Cropscience Ag | Herbicidal agents comprising phenylsulfonyl derivatives and vegetable oils |
| US6521736B2 (en) * | 2000-09-15 | 2003-02-18 | University Of Massachusetts | Amphiphilic polymeric materials |
-
1998
- 1998-04-14 SE SE9801288A patent/SE9801288D0/xx unknown
-
1999
- 1999-04-09 AU AU40662/99A patent/AU765118B2/en not_active Ceased
- 1999-04-09 JP JP2000543160A patent/JP4759134B2/ja not_active Expired - Fee Related
- 1999-04-09 US US09/308,435 patent/US6838089B1/en not_active Expired - Fee Related
- 1999-04-09 WO PCT/SE1999/000582 patent/WO1999052550A1/en not_active Ceased
- 1999-04-09 AT AT99924075T patent/ATE545432T1/de active
- 1999-04-09 EP EP99924075A patent/EP1071457B1/en not_active Expired - Lifetime
-
2011
- 2011-01-07 JP JP2011001576A patent/JP2011140491A/ja not_active Abandoned
Patent Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4919929A (en) | 1984-02-01 | 1990-04-24 | Stolle Research & Development Corporation | Mammal immunization |
| US5417986A (en) * | 1984-03-16 | 1995-05-23 | The United States Of America As Represented By The Secretary Of The Army | Vaccines against diseases caused by enteropathogenic organisms using antigens encapsulated within biodegradable-biocompatible microspheres |
| US5075109A (en) | 1986-10-24 | 1991-12-24 | Southern Research Institute | Method of potentiating an immune response |
| EP0766967A1 (en) * | 1989-09-01 | 1997-04-09 | Mallinckrodt Veterinary Limited | Adjuvant complexes |
| US5591433A (en) * | 1991-06-21 | 1997-01-07 | University Of Cincinnati | Oral administration of immunologically active biomolecules and other therapeutic proteins |
| US5622649A (en) | 1991-06-27 | 1997-04-22 | Emory University | Multiple emulsions and methods of preparation |
| US5538729A (en) * | 1992-04-13 | 1996-07-23 | Oravax, Inc. | Oral treatment of helicobacter infection |
| US5529777A (en) | 1993-07-12 | 1996-06-25 | Virus Research Institute | Hydrogel microencapsulated vaccines |
| WO1995011009A1 (en) | 1993-10-22 | 1995-04-27 | Genentech, Inc. | Method for preparing microspheres comprising a fluidized bed drying step |
| WO1995011010A1 (en) | 1993-10-22 | 1995-04-27 | Genentech, Inc. | Methods and compositions for microencapsulation of antigens for use as vaccines |
| WO1996036317A1 (en) | 1995-05-18 | 1996-11-21 | Alkermes Controlled Therapeutics, Inc. | Production scale method of forming microparticles |
| WO1998028357A1 (en) * | 1996-12-20 | 1998-07-02 | Connaught Laboratories Limited | Biodegradable targetable microparticle delivery system |
Non-Patent Citations (5)
| Title |
|---|
| ADVANCED DRUG DILIVERY REVIEWS, Volume 32, 1998, DEREK T. O'HAGAN et al., "Poly(lactide-co-glycolide) Microparticles for the Development of Single-Dose Controlled-Release Vaccines", pages 225-246. * |
| CHEMICAL ABSTRACTS, Volume 124, No. 6, 5 February 1996, (Columbus, Ohio, USA), GREENWAY TERRENCE E. et al., "Enhancement of Protective Immune Responses to Venezuelan Equine Encephalitis (VEE) Virus with Microencapsulated Vaccine", page 1, Abstract No. 66330; & VACCINE, 1995, 13(15), 1411-1420. * |
| DEV. BIOL. STAND., Volume 92, 1998, R.K. GUPTA et al., "Biodegradable Polymer Microspheres as Vaccine Adjuvants and Delivery Systems", pages 63-78. * |
| DIALOG INFORMATION SERVICES, File Medline, Dialog Accession No. 07045834, Medline Accession No. 92210497, DOIG P. et al., "Production of a Conserved Adhesin by the Human Gastroduodenal Pathogen Helicobacter Pylori"; & J. BACTERIOL., (UNITED STATES), Apr. 1992, 174(8), pages 2539-2547. * |
| RESEARCH IN IMMUNOLOGY, Volume 149, 1998, J.L. CLELAND, "Development of Stable Formulations for PLGA/PLA Microsphere Vaccines", pages 45-47. * |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1105101B1 (en) * | 1998-08-18 | 2004-11-17 | Southern Research Institute | Compositions and methods for treating intracellular infections |
| WO2001083533A1 (en) * | 2000-04-29 | 2001-11-08 | Astrazeneca Ab | Helicobacter pylori antigens: fusion of hpaa and hpa44 |
| US9120031B2 (en) | 2000-11-09 | 2015-09-01 | Nektar Therapeutics | Compositions of particulate coformulation |
| US10798955B2 (en) | 2000-11-09 | 2020-10-13 | Nektar Therapeutics | Compositions of particulate coformulation |
| EP2241309A3 (en) * | 2001-07-10 | 2012-12-26 | Corixa Corporation | Methods for encapsulation of proteins and adjuants in microspheres |
| US10251881B2 (en) | 2002-04-17 | 2019-04-09 | Nektar Therapeutics | Particulate materials |
| US9616060B2 (en) | 2002-04-17 | 2017-04-11 | Nektar Therapeutics | Particulate materials |
| US7582284B2 (en) | 2002-04-17 | 2009-09-01 | Nektar Therapeutics | Particulate materials |
| EP2612703A2 (en) | 2002-04-17 | 2013-07-10 | Nektar Therapeutics | Particulate materials |
| US7354601B2 (en) | 2003-05-08 | 2008-04-08 | Walker Stephen E | Particulate materials |
| WO2005060989A1 (en) * | 2003-12-23 | 2005-07-07 | Lek Pharmaceuticals D.D. | A pharmaceutical composition comprising an active principle and sulphobetaine |
| WO2007104562A1 (en) * | 2006-03-15 | 2007-09-20 | Universiteit Gent | Dry powder compositions and systems for poultry vaccination |
| EP1834651A1 (en) * | 2006-03-15 | 2007-09-19 | Universiteit Gent | Compositions and methods for veterinary vaccination |
| US9833451B2 (en) | 2007-02-11 | 2017-12-05 | Map Pharmaceuticals, Inc. | Method of therapeutic administration of DHE to enable rapid relief of migraine while minimizing side effect profile |
| US10172853B2 (en) | 2007-02-11 | 2019-01-08 | Map Pharmaceuticals, Inc. | Method of therapeutic administration of DHE to enable rapid relief of migraine while minimizing side effect profile |
| US10265407B2 (en) | 2007-02-15 | 2019-04-23 | Yale University | Modular nanodevices for smart adaptable vaccines |
| US9808030B2 (en) | 2011-02-11 | 2017-11-07 | Grain Processing Corporation | Salt composition |
| EP2747777A4 (en) * | 2011-08-25 | 2015-04-29 | Brian Pulliam | ROTAVIRUS PREPARATIONS WITH EXCESSIVE CALCIUMIONES AND HIGH VISCOSITY TO ENSURE VACCINITY OF THE VACCINE AT HIGH TEMPERATURES |
| US9597385B2 (en) | 2012-04-23 | 2017-03-21 | Allertein Therapeutics, Llc | Nanoparticles for treatment of allergy |
| US11071776B2 (en) | 2012-04-23 | 2021-07-27 | N-Fold Llc | Nanoparticles for treatment of allergy |
| US9539217B2 (en) | 2013-04-03 | 2017-01-10 | Allertein Therapeutics, Llc | Nanoparticle compositions |
| US9999600B2 (en) | 2013-04-03 | 2018-06-19 | N-Fold Llc | Nanoparticle compositions |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2002516822A (ja) | 2002-06-11 |
| EP1071457B1 (en) | 2012-02-15 |
| JP4759134B2 (ja) | 2011-08-31 |
| ATE545432T1 (de) | 2012-03-15 |
| SE9801288D0 (sv) | 1998-04-14 |
| JP2011140491A (ja) | 2011-07-21 |
| AU4066299A (en) | 1999-11-01 |
| US6838089B1 (en) | 2005-01-04 |
| EP1071457A1 (en) | 2001-01-31 |
| AU765118B2 (en) | 2003-09-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US6838089B1 (en) | Antigen delivery system and method of production | |
| CA2327522C (en) | Incorporation of active substances in carrier matrixes | |
| EP0762875B1 (en) | Microparticle delivery system | |
| KR100353496B1 (ko) | 하이드로겔마이크로캡슐화백신 | |
| US6309669B1 (en) | Therapeutic treatment and prevention of infections with a bioactive materials encapsulated within a biodegradable-biocompatible polymeric matrix | |
| JP3990303B2 (ja) | 生分解性及び生体適合性を有するポリマーの製法 | |
| EP0724432B1 (en) | Methods and compositions for microencapsulation of antigens for use as vaccines | |
| US5716637A (en) | Solid fat nanoemulsions as vaccine delivery vehicles | |
| CN1213736C (zh) | 一次注射疫苗的配制品 | |
| MXPA04007935A (es) | Sistema de liberacion de un inmunogen estabilizado sintetico. | |
| WO1995011008A2 (en) | Methods and compositions for microencapsulation of adjuvants | |
| JP2000501084A (ja) | 均一な形態を有するマイクロカプセルの製造方法、並びにこの方法により製造されたマイクロカプセル | |
| Prieto et al. | Characterization of V3 BRU peptide-loaded small PLGA microspheres prepared by a (w1/o) w2 emulsion solvent evaporation method | |
| Snook et al. | Peptide nanofiber–CaCO 3 composite microparticles as adjuvant-free oral vaccine delivery vehicles | |
| San Román et al. | Co-encapsulation of an antigen and CpG oligonucleotides into PLGA microparticles by TROMS technology | |
| CN111565706A (zh) | 药物组合物、包括脂质囊泡颗粒尺寸设定的制备方法及其用途 | |
| AU5437599A (en) | Microparticulate composition | |
| Stivaktakis et al. | PLA and PLGA microspheres of β‐galactosidase: Effect of formulation factors on protein antigenicity and immunogenicity | |
| EP1265598A1 (en) | Pharmaceutical composition for application to mucosal surfaces | |
| MXPA00009914A (en) | Incorporation of active substances in carrier matrixes | |
| EP0681478A1 (en) | Vaccines against diseases caused by enteropathogenic organisms using antigens encapsulated within biodegradable-biocompatible microspheres | |
| JP2003527413A (ja) | 粘膜表面へ投与するための医薬組成物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 09308435 Country of ref document: US |
|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SL SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 40662/99 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1999924075 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1999924075 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 40662/99 Country of ref document: AU |