WO1998002454A2 - Conjugates of soluble peptidic compounds with membrane-binding agents - Google Patents
Conjugates of soluble peptidic compounds with membrane-binding agents Download PDFInfo
- Publication number
- WO1998002454A2 WO1998002454A2 PCT/EP1997/003715 EP9703715W WO9802454A2 WO 1998002454 A2 WO1998002454 A2 WO 1998002454A2 EP 9703715 W EP9703715 W EP 9703715W WO 9802454 A2 WO9802454 A2 WO 9802454A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- lys
- ser
- gly
- pro
- soluble
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
- C12N9/6456—Plasminogen activators
- C12N9/6462—Plasminogen activators u-Plasminogen activator (3.4.21.73), i.e. urokinase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C323/00—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
- C07C323/23—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton
- C07C323/39—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton at least one of the nitrogen atoms being part of any of the groups, X being a hetero atom, Y being any atom
- C07C323/40—Y being a hydrogen or a carbon atom
- C07C323/41—Y being a hydrogen or an acyclic carbon atom
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C323/00—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
- C07C323/50—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton
- C07C323/51—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton
- C07C323/57—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups
- C07C323/58—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups with amino groups bound to the carbon skeleton
- C07C323/59—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and carboxyl groups bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being further substituted by nitrogen atoms, not being part of nitro or nitroso groups with amino groups bound to the carbon skeleton with acylated amino groups bound to the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
- C07K14/3153—Streptokinase
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21073—Serine endopeptidases (3.4.21) u-Plasminogen activator (3.4.21.73), i.e. urokinase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This invention relates to polypeptide derivatives, their use in therapy and methods and intermediates for their production.
- Soluble, truncated versions of membrane-associated proteins overcome the 0 production difficulties associated with full length proteins.
- truncated molecules lack the membrane binding capability and specificity of the full length proteins which properties may be advantageous or even essential to the desired therapeutic activity.
- phosphatidyl inositol moeities (GPI- anchors). These are generated by a specific biosynthetic pathway which recognises and removes a specific stretch of C- terminal aminoacids and creates a membrane-associating diacyl glycerol unit linked via a hydrophilic carbohydrate spacer to the polypeptide; 6.
- single fatty acid groups such as myristoyl, palmitoyl or prenyl may be attached postranslationally to one or more sites in a protein (usually at N- or C-termini). Again, amino acids (such as the C-terminal CAAX box in Ras proteins) may be removed.
- Artificial membranes are considered to be lipid complexes that mimic the basic properties of the cell membrane, i.e., a lipid vacuole with an aqueous interior and a surface chemistry that resembles the cell membrane.
- the artificial membrane typically contains phospholipids or mimics thereof and may be unilemellar or bilemellar and the outer surface will contain charged groups similar to the choline groups of the most abundant phospholipid.
- the prototype artificial membrane is known as a liposome and the technologies for the construction of liposomes including the incorporation of therapeutically useful agents into them is well known to those in the art. Liposomes have been evaluated in a number of disease states and liposomes containing the anti- fungal Amphotericin are commercially available.
- proteoliposomes have been described.
- the use of immunoliposomes encapsulating amphotericin B has been reported to be of benefit in the treatment of experimental fungal infections in animal models (e.g. Hospenthal, D. et al (1989) J. Med. Microbiol. 30 193-197; Dromer, F. et al (1990) Antimicrob. Agents Chemother. 342055-2060).
- Mimics of natural or artificial membranes are often related in structure and will mimic one or more properties of the membrane.
- One such example is the provision of an artificial surface having pendant groups which mimic the phospholipid zwitterionic groups which are found on the outside of cell surfaces.
- WO92 06719 Biocompatibles Limited discloses natural and synthetic phospholipids which may be coated on an artificial surface, e.g. a device which, in use, will come into contact with protein-containing or biological fluids, to provide improved biocompatibility and haemocompatibility
- WO 94/16749 discloses additional zwitterionic groups that may be used to improve biocompatibility in a similar way.
- the present invention provides a soluble derivative of a soluble polypeptide, said derivative comprising two or more heterologous membrane binding elements with low membrane affinity covalently associated with the polypeptide which elements are capable of interacting, independently and with thermodynamic additivity, with components of cellular or artificial membranes exposed to extracellular fluids.
- 'heterologous' is meant that the elements are not found in the native full length protein from which a soluble protein may be derived.
- soluble polypeptide' is meant a truncated derivative of a full length protein which lacks its natural membrane binding capability, and/or a polypeptide which has a solubility level in aqueous media of > lOO ⁇ g/ml.
- membrane binding element with low membrane affinity is meant that the element has only moderate affinity for membranes, that is a dissociation constant greater than O.l ⁇ M, preferably l ⁇ M-lmM.
- the elements preferably have a size ⁇ 5kDa.
- the derivative should incorporate sufficient elements with low affinities for membrane components to result in a derivative with a high (preferably 0.01 - lOnM dissociation constant) affinity for specific membranes.
- the elements combine so as to create an overall high affinity for the particular target membrane but the combination lacks such high affinity for other proteins for which single elements may be (low- affinity) ligands.
- the elements should be chosen so as to retain useful solubility in pharmaceutial formulation media, preferably >100 ⁇ g/ml.
- at least one element is hydrophilic.
- Pharmacokinetics and dosing frequency Interaction of a derivatised protein with long-lived cell types or serum proteins would be expected to prolong the plasma residence time of the protein and produce a depot effect through deposition on cell surfaces.
- the derivatives of the invention may be used in association with artificial membranes or mimics thereof to allow delivery of the therapeutic protein to sites where it will provide therapeutic benefit
- polypeptides associated with liposomes formed by contacting liposomes with a derivative of the invention may be more stable than the free polypeptide.
- the liposome may incorporate a therapeutic agent, for example an antiflammatory or cytotoxic agent.
- the polypeptide derivative of the invention may thus be used to target the therapeutic agent
- the liposome incorporated therapeutic agent may be used to enhance further the efficacy or tolerability of the therapy.
- association of derivatives of the invention with mimics of cell membranes may be used to concentrate the therapeutic protein at sites where therapeutically useful concentrations of underivatised protein might be difficult to achieve.
- indwelling medical devices coated with mimics of the phospholipid zwitterionic groups which are found on the outside of cell surfaces such as those disclosed in WO9206719 and WO 94/16749, may be additionally treated with derivatives of the invention.
- complement inhibitors derivatised in accordance with the invention could be incorporated into the outer surface of indwelling catheters or hip replacements or heart valves in order to minimise development of inflammation associated with these operations.
- protein therapeutic agents which may be modified according to the invention include but are not restricted to the following:
- CR1 Complement regulatory proteins e.g.: CR1 (CD35); DAF (CD55); MCP (CD46); CD59; Factor H; and C4 binding protein; and hybrids or muteins thereof such as CR1-CD59 (S.G.El Feki and D.T.Fearon Molecular Immunology 33 (supp 1). p 57, 1996), MCP-DAF (P.J.Higgins et al, J.Immunology. 158, 2872-2881,1997) and soluble CR1 polypeptide fragments.
- CR1-CD59 S.G.El Feki and D.T.Fearon Molecular Immunology 33 (supp 1). p 57, 1996), MCP-DAF (P.J.Higgins et al, J.Immunology. 158, 2872-2881,1997) and soluble CR1 polypeptide fragments.
- the derivative preferably comprises two to eight, more preferably two to four membrane binding elements.
- Membrane binding elements are preferably selected from: fatty acid derivatives such as fatty acyl groups; basic amino acid sequences; ligands of known integral membrane proteins; sequences derived from the complementarity-determining region of monoclonal antibodies raised against epitopes of membrane proteins; membrane binding sequences identified through screening of random chemical or peptide libraries.
- Suitable fatty acid derivatives include myristoyl (12 methylene units) which is insufficiently large or hydrophobic to permit high affinity binding to membranes.
- myristoylated peptides eg R.M.Peitzsch & S.McLaughlin, Biochemistry, 32, 10436-10443, 1993
- myristoylated peptides eg R.M.Peitzsch & S.McLaughlin, Biochemistry, 32, 10436-10443, 1993
- myristoylated peptides eg R.M.Peitzsch & S.McLaughlin, Biochemistry, 32, 10436-10443, 1993
- aliphatic acyl groups with about 8 to 18 methylene units, preferably 10-14, are suitable membrane binding elements.
- Suitable fatty acid derivatives include long-chain (8-18, preferably 10-14 methylene) aliphatic amines and thiols, steroid and farnesyl derivatives.
- Membrane binding has been found to be associated with limited (single-site) modification with fatty acyl groups when combined with a cluster of basic aminoacids in the protein sequence which may interact with acidic phospholipid head groups and provide the additional energy to target membrane binding. This combination of effects has been termed the 'myristoyl-electrostatic switch' (S.McLaughlin and A.Aderem, TIBS, 20,272-276, 1994; J.F.Hancock et al, Cell, 63, 133-139,1990).
- suitable membrane binding elements are basic aminoacid sequences such as those found in proteins such as Ras and MARCKS (myristoylated alanine-rich C-kinase substrate, P.J. Blackshear, J. Biol. Chem., 268, 1501-1504, 1993) which mediate the electrostatic 'switch' through reversible phosphorylation of serine residues within the sequence and a concomitant neutralisation of the net positive charge.
- Such sequences include but are not restricted to consecutive sequences of Lysine and Arginine such as (Lys)n where n is from 3 to 10, preferably 4 to 7.
- amino acid sequences comprising basic amino acids include: i) DGPKKKKKKSPSKSSG ii) GSSKSPSKKKKKKPGD iii) SPSNETPKKKKKRFSFKKSG iv) DGPKKKKKKSPSKSSK v) SKDG KKKKKSKTK
- Sequences i) to v) are examples of electrostatic switch sequences.
- amino acid sequences derived from ligands of known integral membrane proteins include RGD-containing peptides such as GRGDSP which are ligands for the ⁇ . integrin of human platelet membranes.
- RGD-containing peptides such as GRGDSP which are ligands for the ⁇ . integrin of human platelet membranes.
- DGPSEILRGDFSS derived from human fibrinogen alpha chain, which binds to the Gp ⁇ b/ ⁇ ia membrane protein in platelets.
- sequences include those known to be involved in interactions between membrane proteins such as receptors and the major histocompatibility complex.
- An example of such a membrane protein ligand is the sequence GNEQSFRVDLRTLLRYA which has been shown to bind to the major histocompatibility complex class 1 protein (MHC-1) with moderate affinity (LOlsson et al, Proc. Natl .Acad.Sci.USA. 91, 9086-909, 1994).
- MHC-1 major histocompatibility complex class 1 protein
- Such sequence employ a membrane insertive address specific for T-cells. Such sequence is derived from the known interaction of the transmembrane helix of the T-cell antigen receptor with CD3 (Nature Medicine 3, 84- 88,1997). Examples are peptides containing the sequence GFRILLLKV such as: SAAPSSGFRILLLKV AAPSVIGFRILLLKVAG
- a ligand for an integral membrane protein is the carbohydrate ligand Sialyl Lewis 1 which has been identified as a ligand for the integral membrane protein ELAM-1 (M.L.Phillips et al, Science, 250, 1130-1132, 1990 & G.Walz et al, 7-7/4 250, 1132-1135,1990). Sequences derived from the complementarity-determining regions of monoclonal antibodies raised against epitopes within membrane proteins (see, for example, J.W.Smith et al, J.Biol.Chem.
- 270, 30486-30490, 1995 are also suitable membrane binding elements, as are binding sequences from random chemical libraries such as those generated in a phage display format and selected by biopanning operations in vitro (G.F.Smith and J.K.Scott, Methods in Enzymology, 217H, 228-257,1993) or in vivo (R.Pasqualini & E.Ruoslahti, Nature, 380, 364-366, 1996).
- conditional dissociation from the membrane may be incorporated into derivatives of the invention using mechanisms such as pH sensitivity (electrostatic switches), regulation through metal ion binding (using endogenous Ca 2 ⁇ Zn 2* and incorporation of ion binding sites in membrane binding elements) and protease cleavage (e.g plasminolysis of lysine-rich membrane binding sequences to release and activate prourokinase)
- pH sensitivity electrostatic switches
- metal ion binding using endogenous Ca 2 ⁇ Zn 2* and incorporation of ion binding sites in membrane binding elements
- protease cleavage e.g plasminolysis of lysine-rich membrane binding sequences to release and activate prourokinase
- Preferred derivatives of this invention have the following structure:
- P is the soluble polypeptide
- each L is independently a flexible linker group
- each is independently a peptidic membrane binding element
- n is an integer of 1 or more and
- X is a peptidic or non-peptidic membrane-binding entity which may be covalently linked to any .
- Peptidic membrane binding elements are preferably 8 to 20 amino acids long and elements W are preferably located sequentially either at the N or C terminus of the soluble polypeptide.
- the amino acid sequences are linked to one another and to the soluble peptide by linker groups which are preferably selected from hydrophilic and/or flexible aminoacid sequences of 4 to 20 aminoacids; linear hydrophilic synthetic polymers; and chemical bridging groups.
- Peptide linkages may be made chemically or biosynthetically by expression of appropriate coding DNA sequences.
- Non peptide linkages may be made chemically or enzymatically by post-translational modification.
- the polypeptide portion of the derivatives of the invention may be prepared by expression in suitable hosts of modified genes encoding the soluble polypeptide of interest plus one or more peptidic membrane binding elements and optional residues such as cysteine to introduce linking groups to facilitate post translational derivatisation with additional membrane binding elements.
- the invention provides a process for preparing a derivative according to the invention which process comprises expressing DNA encoding the polypeptide portion of said derivative in a recombinant host cell and recovering the product and thereafter post translationally modifying the polypeptide to chemically introduce membrane binding elements.
- the recombinant aspect of the process may comprise the steps of: i) preparing a replicable expression vector capable, in a host cell, of expressing a DNA polymer comprising a nucleotide sequence that encodes said polypeptide portion; ii) transforming a host cell with said vector; iii) culturing said transformed host cell under conditions permitting expression of said DNA polymer to produce said polypeptide; and iv) recovering said polypeptide.
- the DNA polymer comprising a nucleotide sequence that encodes the polypeptide portion as well as the polypeptide portion itself and S-derivatives thereof, also form part of the invention.
- the invention provides a polypeptide portion of a derivative of the invention comprising the soluble peptide linked by a peptide bond to one peptidic membrane binding element and/or including a C-terminal cysteine, and DNA polymers encoding the polypeptide portion.
- the recombinant process of the invention may be performed by conventional recombinant techniques such as described in Sambrook et ai, Molecular Cloning : A laboratory manual 2nd Edition. Cold Spring Harbor Laboratory Press (1989) and DNA
- the invention also provides a process for preparing the DNA polymer by the condensation of appropriate mono-, di- or oligomeric nucleotide units.
- the preparation may be carried out chemically, enzymatically, or by a combination of the two methods, in vitro or in vivo as appropriate.
- the DNA polymer may be prepared by the enzymatic ligation of appropriate DNA fragments, by conventional methods such as those described by D. M. Roberts et al, in Biochemistry
- the DNA fragments may be obtained by digestion of DNA containing the required sequences of nucleotides with appropriate restriction enzymes, by chemical synthesis, by enzymatic polymerisation, or by a combination of these methods.
- Digestion with restriction enzymes may be performed in an appropriate buffer at a temperature of 20°-70°C, generally in a volume of 50 ⁇ l or less with 0. l-10 ⁇ g DNA.
- Enzymatic polymerisation of DNA may be carried out in vitro using a DNA polymerase such as DNA polymerase 1 ( lenow fragment) in an appropriate buffer containing the nucleoside triphosphates dATP, dCTP, dGTP and dTTP as required at a temperature of 10°-37°C, generally in a volume of 50 ⁇ l or less.
- Enzymatic ligation of DNA fragments may be carried out using a DNA ligase such as T4 DNA ligase in an appropriate buffer at a temperature of 4°C to 37°C, generally in a volume of 50 ⁇ l or less.
- a DNA ligase such as T4 DNA ligase in an appropriate buffer at a temperature of 4°C to 37°C, generally in a volume of 50 ⁇ l or less.
- the chemical synthesis of the DNA polymer or fragments may be carried out by conventional phosphotriester, phosphite or phosphoramidite chemistry, using solid phase techniques such as those described in 'Chemical and Enzymatic Synthesis of Gene Fragments - A Laboratory Manual' (ed. H.G. Gassen and A. Lang), Verlag Chemie,
- the DNA polymer is preferably prepared by ligating two or more DNA molecules which together comprise a DNA sequence encoding the polypeptide.
- the DNA molecules may be obtained by the digestion with suitable restriction enzymes of vectors carrying the required coding sequences.
- DNA molecules and the way in which they are obtained depends upon the structure of the desired product.
- design of a suitable strategy for the construction of the DNA molecule coding for the polypeptide is a routine matter for the skilled worker in the art.
- codon usage of the particular host cell consideration may be given to the codon usage of the particular host cell.
- the codons may be optimised for high level expression in E. coli using the principles set out in Devereux et al, (1984) Nucl. Acid Res., 12, 387.
- the expression of the DNA polymer encoding the polypeptide in a recombinant host cell may be carried out by means of a replicable expression vector capable, in the host cell, of expressing the DNA polymer. Novel expression vectors also form part of the invention.
- the replicable expression vector may be prepared in accordance with the invention, by cleaving a vector compatible with the host cell to provide a linear DNA segment having an intact replicon, and combining said linear segment with one or more DNA molecules which, together with said linear segment, encode the polypeptide, under ligating conditions.
- the ligation of the linear segment and more than one DNA molecule may be carried out simultaneously or sequentially as desired.
- the DNA polymer may be preformed or formed during the construction of the vector, as desired.
- the choice of vector will be determined in part by the host cell, which may be prokaryotic, such as E. coli, or eukaryotic, such as mouse C127, mouse myeloma, Chinese hamster ovary, fungi e.g. filamentous fungi or unicellular 'yeast' or an insect cell such as Drosophila.
- the host cell may also be in a transgenic animal.
- Suitable vectors include plasmids, bacteriophages, cosmids and recombinant viruses derived from, for example, baculoviruses or vaccinia.
- the DNA polymer may be assembled into vectors designed for isolation of stable transformed mammalian cell lines expressing the fragment e.g. bovine papi ⁇ omavirus vectors in mouse C127 cells, or amplified vectors in Chinese hamster ovary cells (DNA Cloning Vol. II D.M. Glover ed. IRL Press 1985; Kaufman, RJ. et al. Molecular and Cellular Biology 5, 1750-1759, 1985; Pavlakis G.N. and Hamer, D.H. Proceedings of the National Academy of Sciences (USA) 80, 397-401, 1983; Goeddel, D.V. et ⁇ /.,European Patent Application No. 0093619, 1983).
- bovine papi ⁇ omavirus vectors in mouse C127 cells
- amplified vectors in Chinese hamster ovary cells DNA Cloning Vol. II D.M. Glover ed. IRL Press 1985; Kaufman, RJ. et al. Molecular and Cellular Biology 5,
- the preparation of the replicable expression vector may be carried out conventionally with appropriate enzymes for restriction, polymerisation and ligation of the DNA, by procedures described in, for example, Sambrook et al, cited above. Polymerisation and ligation may be performed as described above for the preparation of the DNA polymer. Digestion with restriction enzymes may be performed in an appropriate buffer at a temperature of 20°-70°C, generally in a volume of 50 ⁇ l or less with 0.1-10 ⁇ g DNA.
- the recombinant host cell is prepared, in accordance with the invention, by transforming a host cell with a replicable expression vector of the invention under transforming conditions. Suitable transforming conditions are conventional and are described in, for example, Sambrook et al, cited above, or "DNA Cloning" Vol.
- a bacterial host such as E.coli
- a solution of CaCl2 (Cohen et al.Proc. Nat. Acad. Sci., 1973, £2, 2110) or with a solution comprising a mixture of RbCl, MnCl2, potassium acetate and glycerol, and then with 3-[N-morpholino]-propane- sulphonic acid, RbCl and glycerol or by electroporation as for example described by Bio- Rad Laboratories, Richmond, California, USA, manufacturers of an electroporator.
- Mammalian cells in culture may be transformed by calcium co-precipitation of the vector DNA onto the cells or by using cationic liposomes.
- the invention also extends to a host cell transformed with a replicable expression vector of the invention. Culturing the transformed host cell under conditions permitting expression of the
- DNA polymer is carried out conventionally, as described in, for example, Sambrook et al, and "DNA Cloning" cited above.
- the cell is supplied with nutrient and cultured at a temperature below 45°C.
- the protein product is recovered by conventional methods according to the host cell.
- the host cell is bacterial such as E. coli and the protein is expressed intracellularly, it may be lysed physically, chemically or enzymatically and the protein product isolated from the resulting lysate.
- the product is usually isolated from the nutrient medium.
- the product obtained from the culture may require folding for optimum functional activity. This is most likely if the protein is expressed as inclusion bodies.
- the polypeptide is preferably partially purified before folding, in order to minimise formation of aggregates with contaminating proteins and minimise misfolding of the polypeptide.
- the folding process is carried out in such a way as to minimise aggregation of intermediate-folded states of the polypeptide.
- careful consideration needs to be given to, among others, the salt type and concentration, temperature, protein concentration, redox buffer concentrations and duration of folding. The exact condition for any given polypeptide generally cannot be predicted and must be determined by experiment
- the methods generally involve breaking all the disulphide bonds in the inclusion body, for example with 50mM 2-mercaptoethanol, in the presence of a high concentration of denaturant such as 8M urea or 6M guanidine hydrochloride. The next step is to remove these agents to allow folding of the proteins to occur. Formation of the disulphide bridges requires an oxidising environment and this may be provided in a number of ways, for example by air, or by incorporating a suitable redox system, for example a mixture of reduced and oxidised glutathione.
- the inclusion body is solubilised using 8M urea, in the presence of mercaptoethanol, and protein is folded, after initial removal of contaminating proteins, by addition of cold buffer.
- Suitable buffers may be identified using the techniques described in I.Dodd et al, 'Perspectives in Protein Engineering and Complementary Technologies' , Mayflower Publications, 66-69, 1995.
- a suitable buffer for many of the SCR constructs described herein is 20mM ethanolamine containing ImM reduced glutathione and 0.5mM oxidised glutathione.
- the folding is preferably carried out at a temperature in the range 1 to 5°C over a period of 1 to 4 days.
- the aggregated protein can be removed in a number of ways, for example by centnfugation or by treatment with precipitants such as ammonium sulphate. Where either of these procedures are adopted, monomeric polypeptide is the major soluble product
- the polypeptide portion of the derivative of the invention may include a C- terminal cysteine to facilitate post translational modification.
- a soluble polypeptide including a C-terminal cysteine also forms part of the invention. Expression in a bacterial system is preferred for proteins of moderate size (up to -70kDa) and with ⁇ -8 disulphide bridges. More complex proteins for which a free terminal Cys could cause refolding or stability problems may require stable expression in mammalian cell lines (especially CHO). This will also be needed if a carbohydrate membrane binding element is to be introduced post-translationally.
- insect cells infected with recombinant baculovirus encoding the polypeptide portion is also a useful general method for preparing more complex proteins and will be preferred when it is desired to carry out certain post-translational processes (such as palmitoylation) biosynthetically (see for example, M.J.Page et al J.Biol.Chem. 264, 19147-19154, 1989)
- a preferred method of handling proteins C-terminally derivatised with cysteine is as a mixed disulphide with mercaptoethanol or glutathione or as the 2-nitro, 5- carboxyphenyl thio- derivative as generally described below in Methods.
- Peptide membrane binding elements may be prepared using standard solid state synthesis such as the Merrifield method and this method can be adapted to incorporate required non-peptide membrane binding elements such as N-acyl groups derived from myristic or palmitic acids at the N terminus of the peptide.
- activation of an amino acid residue for subsequent linkage to a protein can be achieved during chemical synthesis of such membrane binding elements. Examples of such activations include formation of the mixed 2-pyridyl disulphide with a cysteine thiol or incorporation of an N-haloacetyl group. Both of these groups are capable of reaction with free thiols, through disulphide interchange and alkylation, respectively.
- Peptides can optionally be prepared as the C-terminal amide and/or with a conventional N-terminal blocking group such as acetyl.
- the invention also provides a peptidic membrane binding element comprising one or more derivatisations selected from: a terminal cysteine residue optionally activated at the thiol group; an N-haloacetyl group (where halo signifies chlorine, bromine or iodine) located at the N-terminus of the the peptide or at an ⁇ -amino group of a lysine residue; an amide group at the C-terminus; an N-terminal blocking group; and a fatty acid N-acyl group at the N-terminus or at an ⁇ -amino group of a lysine residue.
- a terminal cysteine residue optionally activated at the thiol group
- an N-haloacetyl group where halo signifies chlorine, bromine or iodine located at the N-terminus of the the peptide or at an ⁇ -amino group of a lysine residue
- an amide group at the C-terminus
- Chemical bridging groups and reagents suitable for their formation include those described in EP0109653, EP0152736, EP0155388 and EP0284413, incorporated herein by reference.
- the chemical bridging group will take the form -S-S-.
- the bridge is generated by conventional disulphide exchange chemistry, by activating a thiol on one polypeptide and reacting the activated thiol with a free thiol on the other polypeptide.
- Such activation procedures make use of disulphides which form stable thiolate anions upon cleavage of the S-S linkage and include reagents such as 2,2' dithiopyridine and 5,5'-dithio(2-nitrobenzoic acid, DTNB) which form intermediate mixed disulphides capable of further reaction with thiols to give stable disulphide linkages.
- reagents such as 2,2' dithiopyridine and 5,5'-dithio(2-nitrobenzoic acid, DTNB) which form intermediate mixed disulphides capable of further reaction with thiols to give stable disulphide linkages.
- R may include moieties which interact with water to maintain the water solubility of the linkage and suitable moieties include -CO-NH-, -CO-NMe-, -S-S-, -CH(OH)-, -SO2-, -CO2-, -(CH2CH2-O) m - and -CH(COOH)- where m is an integer of 2 or more, or linear hydrophilic polymers such as polyethylene glycol, polypropylene glycol, polyglycine, polyalanine or polysarcosine.
- R examples include -(CH2) r , -(CH2) p -S-S-(CH2)q- and -(CH2)p.CH(OH)-CH(OH)-(CH2)q-, in which r is an integer of at least 2, preferably at least 4 and p and q are independently integers of at least 2
- R may take the form -U-V-W- where U is
- R is (CH2)2CONH(CH2) n NH-(4-phenyl) where n is an integer of 3 to 8.
- the bridging group of formula (I) may be derived from a linking agent of formula (II):
- X-Rj-Y (II) in which Rj is a bond or a linking group and X and Y are functional groups reactable with surface amino acid groups, preferably a lysine or cysteine group, the N- terminal amino group, a catalytic serine hydroxyl or a protein attachment group, and X, K - and Y are chosen so as to generate the required bridging group -A-R-B-.
- Preferred agents are those where X and Y are different, known as heterobifunctional agents. Each end of the agent molecule is reacted in turn with each polypeptide to be linked in separate reactions.
- heterobifunctional agents of formula (II) include: N-succinimidyl 3-(2-pyridyldithio) propionate succinimidyl 4-(N-maleimido) caproate 3-(2-pyridyl) methyl propionimidate hydrochloride 4'-amidinophenyl 4-N-[2-N-(3-[2-pyridyldithio]ethylcarbonyl)aminoethyl] aminobenzoate hydrochloride.
- Other suitable agents are disclosed in EP0109653, EP0152736, EP0155388 and
- EP0284413 in particular those of formula (II) in EP0155388 and (Til) in EP0284413 incorporated herein by reference.
- Y is capable of reacting with a thiol group on a polypeptide, which may be a native thiol or one introduced as a protein attachment group.
- the protein attachment group is a functionality derived by modification of a polypeptide or protein with a reagent specific for one or more amino acid side chains, and which contains a group capable of reacting with a cleavable section on the other polypeptide.
- An example of a protein attachment group is a thiol group.
- An example of a cleavable section is a disulphide bond.
- the cleavable section may comprise an ⁇ , ⁇ dihydroxy function.
- the introduction of a free thiol function by reaction of a polypeptide with 2-iminothiolane, N-succinimidyl 3-(2-pyridyldithio) propionate (with subsequent reduction) or N.-acetyl homocysteine thiolactone will permit coupling of the protein attachment group with a thiol-reactive Y structure.
- the protein attachment group can contain a thiol-reactive entity such as the 6-maleimidohexyl group or a 2-pyridyl-dithio group which can react with a free thiol in X.
- the protein attachment group is derived from protein modifying agents such as 2-iminothiolane that react with lysine ⁇ -amino groups in proteins.
- X represents a group capable of reacting directly with the amino acid side chain of a protein, it is preferably an N-succinimidyl group.
- X represents a group capable of reacting with a protein attachment group, it is preferably a pyridylthio group.
- X represents a group capable of reacting with a catalytic serine hydroxyl it is preferably an 4-amidinophenyl ester group optionally substituted by one or more electron withdrawing groups which increases the reactivity of the ester, of the kind contained in the compounds of formula (II) in EP0155388 and (III) in EP0284413.
- modification of a polypeptide to introduce a protein attachment group is preferably carried out in aqueous buffered media at a pH between 3.0 and 9.0 depending on the reagent used.
- the pH is preferably 6.5-8.5.
- the concentration of polypeptide is preferably high (> lOmg/ml) and the modifying reagent is used in a moderate (1.1- to 5-fold) molar excess, depending on the reactivity of the reagent
- the temperature and duration of reaction are preferably in the range 0°-40°C and 10 minutes to 7 days.
- the extent of modification of the polypeptide may be determined by assaying for attachment groups introduced.
- Such assays may be standard protein chemical techniques such as titration with 5,5'-dithiobis-(2-nitrobenzoic acid).
- 0.5-3.0 moles of protein attachment group will be introduced on average per mole of polypeptide.
- the modified polypeptide may be separated from excess modifying agents by standard techniques such as dialysis, ultrafiltration, gel filtration and solvent or salt precipitation.
- the intermediate material may be stored in frozen solution or lyophilised.
- the linking agent of formula (II) contains an amidino phenyl ester group X
- the agent is preferably first reacted with a polypeptide enzyme via the group X and the reaction is preferably carried out under the conditions described for the introduction of blocking groups in European Published Patent Application No. 0,009,879.
- the acylated enzyme may then be reacted with the other polypeptide at a ratio of approximately 1:1 in a non-nucleophilic buffer at pH7.0-8.0 and 0°-30°C for up to 6h. However, it is preferable to conduct the coupling below 10°C (preferably 0°-4°C) in order to minimise the hydrolysis of the acylated enzyme.
- a protein attachment group is introduced in this way, the bridging group
- (I) will be formed from a reaction of the linking agent (II) and the protein attachment group.
- the polypeptides to be linked are reacted separately with the linking agent or the reagent for introducing a protein attachment group by typically adding an excess of the reagent to the polypeptide, usually in a neutral or moderately alkaline buffer, and after reaction removing low molecular weight materials by gel filtration or dialysis.
- the precise conditions of pH, temperature, buffer and reaction time will depend on the nature of the reagent used and the polypeptide to be modified.
- the polypeptide linkage reaction is preferably carried out by mixing the modified polypeptides in neutral buffer in an equimolar ratio. Other reaction conditions e.g. time and temperature, should be chosen to obtain the desired degree of linkage. If thiol exchange reactions are involved, the reaction should preferably be carried out under an atmosphere of nitrogen.
- UV-active products are produced (eg from the release of pyridine 2-thione from 2- pyridyl dithio derivatives) so that coupling can be monitored.
- the polypeptide conjugate can be isolated by a number of chromatographic procedures such as gel filtration, ion-exchange chromatography, affinity chromatography or hydrophobic interaction chromatography. These procedures my be either low pressure or high performance variants.
- the conjugate may be characterised by a number of techniques including low pressure or high performance gel filtration, SDS polyacrylamide gel electrophoresis or isoelectric focussing.
- Membrane binding elements which are fatty acid derivatives are attached post translationally to a peptidic membrane binding element, preferably at the terminus of the polypetide chain.
- the recombinant polypeptide portion of the derivative of the invention contains the peptidic membrane binding element, it has a unique cysteine for coupling to the fatty acid derivative.
- the recombinant polypeptide has a cysteine residue
- a thiol-derivative of the fatty acid is added to the refolded recombinant protein at a late stage in purification (but not necessarily the final stage) and at a reagent concentration preferably below the critical micelle concentration.
- the fatty acid derivative is preferably a C io-20 ⁇ att y ⁇ y 1 derivative of an aminoC2-6al ane thiol (optionally C- substituted) such as N-(2-myristoyl ) aminoethanethiol or N-myristoyl L-cysteine and forms part of the invention.
- hydrophilic synthetic polymers include polyethyleneglycol (PEG), preferably ⁇ , ⁇ functionalised derivatives, more preferably ⁇ -amino , o ⁇ ;arboxy- PEG of molecular weight between 400 and 5000 daltons which are linked to the polypeptide for example by solid-phase synthesis methods (amino group derivatisation) or by thiol-interchange chemistry.
- PEG polyethyleneglycol
- ⁇ , ⁇ functionalised derivatives more preferably ⁇ -amino , o ⁇ ;arboxy- PEG of molecular weight between 400 and 5000 daltons
- Membrane binding elements derived from ligands of known integral membrane proteins, either amino acid sequences or carbohydrates, may be generated by post- translational modification using the glycosylation pathways of eukaryotic cells targeted to N-linked glycosylation sites in the peptide sequence.
- Convenient generic final stage purification strategies are hydrophobic interaction chromatography (HIC ) on C2-C8 media and cation exchange chromatography for separation of derivatised and underivatised proteins into which a hydrophobic- electrostatic switch combination has been inserted.
- HIC hydrophobic interaction chromatography
- the derivatives of this invention are preferably administered as pharmaceutical compositions.
- the present invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising a derivative of the invention in combination with a pharmaceutically acceptable carrier.
- compositions according to the invention may be formulated in accordance with routine procedures for administration by any route, such as oral, topical, parenteral, sublingual or transdermal or by inhalation.
- the compositions may be in the form of tablets, capsules, powders, granules, lozenges, creams or liquid preparations, such as oral or sterile parenteral solutions or suspensions or in the form of a spray, aerosol or other conventional method for inhalation.
- topical formulations of the present invention may be presented as, for instance, ointments, creams or lotions, eye ointments and eye or ear drops, impregnated dressings and aerosols, and may contain appropriate conventional additives such as preservatives, solvents to assist drug penetration and emollients in ointments and creams.
- the formulations may also contain compatible conventional carriers, such as cream or ointment bases and ethanol or oleyl alcohol for lotions.
- Such earners may be present as from about 1% up to about 98% of the formulation. More usually they will form up to about 80% of the formulation.
- Tablets and capsules for oral administration may be in unit dose presentation form, and may contain conventional excipients such as binding agents, for example syrup, acacia, gelatin, sorbitol, tragacanth, or polyvinylpyroUidone; fillers, for example lactose, sugar, maize-starch, calcium phosphate, sorbitol or glycine; tabletting lubricants, for example magnesium stearate, talc, polyethylene glycol or silica; disintegrants, for example potato starch; or acceptable wetting agents such as sodium lauryl sulphate. Tablets may also contain agents for the stablisation of polypeptide drugs against proteolysis and absorbtion-enhancmg agents for macromolecules. The tablets may be coated according to methods well known in normal pharmaceutical practice.
- Suppositories will contain conventional suppository bases, e.g. cocoa-butter or other glyceride.
- fluid unit dosage forms are prepared utilizing the compound and a sterile vehicle, water being preferred.
- the compound depending on the vehicle and concentration used, is dissolved in the vehicle.
- the compound can be dissolved in water for injection and filter sterilised before filling into a suitable vial or ampoule and sealing.
- Parenteral formulations may include sustained-release systems such as encapsulation within microspheres of biodegradable polymers such as poly-lactic co- glycolic acid.
- agents such as a local anaesthetic, preservative and buffering agents can be dissolved in the vehicle.
- the composition can be frozen after filling into the vial and the water removed under vacuum.
- the dry lyophilized powder is then sealed in the vial and an accompanying vial of water for injection may be supplied to reconstitute the li uid prior to use.
- a surfactant or wetting agent is included in the composition to facilitate uniform distribution of the compound.
- compositions of this invention may also suitably be presented for administration to the respiratory tract as a snuff or an aerosol or solution for a nebulizer, or as a microfine powder for insufflation, alone or in combination with an inert carrier such as lactose.
- the particles of active compound suitably have diameters of less than 50 microns, preferably less than 10 microns for example diameters in the range of 1-50 microns, 1-10 microns or 1-5 microns.
- small amounts of anti-asthmatics and bronchodilators for example sympathomimetic amines such as isoprenaline, isoetharine, salbutamol, phenylephrine and ephedrine; xanthine derivatives such as theophylline and aminophylline and corticosteroids such as prednisolone and adrenal stimulants such as ACTH may be included.
- sympathomimetic amines such as isoprenaline, isoetharine, salbutamol, phenylephrine and ephedrine
- xanthine derivatives such as theophylline and aminophylline and corticosteroids such as prednisolone and adrenal stimulants such as ACTH
- ACTH adrenal stimulants
- Microfine powder formulations may suitably be administered in an aerosol as a metered dose or by means of a suitable breath-activated device.
- Suitable metered dose aerosol formulations comprise conventional propellents, cosolvents, such as ethanol, surfactants such as oleyl alcohol, lubricants such as oleyl alcohol, desiccants such as calcium sulphate and density modifiers such as sodium chloride.
- Suitable solutions for a nebulizer are isotonic sterilised solutions, optionally buffered, at for example between pH 4-7, containing up to 20mg ml-* of compound but more generally 0.1 to lOmg ml-*, for use with standard nebulisation equipment.
- an effective amount of the polypeptide for the treatment of a disease or disorder is in the dose range of 0.01- lOOmg/kg per day, preferably O.lmg-lOmg kg per day, administered in up to five doses or by infusion.
- the invention also provides a derivative of the invention for use as a medicament.
- the invention further provides a method of treatment of disorders amenable to treatment by a soluble peptide which comprises administering a soluble derivative of said soluble peptide according to the invention, and the use of a derivative of the invention for the preparation of a medicament for treatment of such disorders.
- the present invention relates to derivatives for use in the therapy of disorders involving complement activity and various inflammatory and immune disorders.
- the soluble polypeptide which is derivatised in accordance with the invention is a soluble complement inhibitor such as a soluble CR1 polypeptide fragment.
- the complement system is composed of many different proteins that are important in the immune system's response to foreign antigens.
- the complement system becomes activated when its primary components are cleaved and the products alone or with other proteins, activate additional complement proteins resulting in a proteolytic cascade.
- Activation of the complement system leads to a variety of responses including increased vascular permeability, chemotaxis of phagocytic cells, activation of inflammatory cells, opsonization of foreign particles, direct killing of cells and tissue damage.
- Activation of the complement system may be triggered by antigen-antibody complexes (the classical pathway) or, for example, by lipopolysaccharides present in cell walls of pathogenic bacteria (the alternative pathway).
- Complement receptor type 1 has been shown to be present on the membranes of erythrocytes, monocytes macrophages, granulocytes, B cells, some T cells, splenic follicular dendritic cells, and glomerular podocytes.
- CR1 binds to the complement components C3b and C4b and has also been referred to as the C3b/C4b receptor.
- the structural organisation and primary sequence of one allotype of CR1 is known (Klickstein et al, 1987, J. Exp. Med. 165:1095-1112, Lanestein et al, 1988, J. Exp. Med. 168:1699-1717; Hourcade et ⁇ /., 1988, J. Exp. Med.
- SCR short consensus repeats
- LHRs long homologous repeats
- the CR1 molecule consists of the N-terminal LHR-A, the next two repeats, LHR-B and LHR-C, and the most C- te ⁇ ninal LHR-D followed by 2 additional SCRs, a 25 residue putative transmembrane region and a 43 residue cytoplasmic tail.
- the first four SCR domains of LHR-A are defined herein as consisting of residues 2-58, 63-120, 125-191 and 197-252, respectively, of mature CR1.
- residue 1 the first four SCR domains of LHR-A are defined herein as consisting of residues 2-58, 63-120, 125-191 and 197-252, respectively, of mature CR1.
- Several soluble fragments of CR1 have been generated via recombinant DNA procedures by eliminating the transmembrane region from the DNAs being expressed (WO 89/09220, WO 91/05047).
- the soluble CR1 fragments were functionally active, bound C3b and/or C4b and demonstrated Factor I cofactor activity depending upon the regions they contained.
- Such constructs inhibited in vitro complement-related functions such as neutrophil oxidative burst, complement mediated hemolysis, and C3a and C5a production.
- a particular soluble construct sCRl/pBSCRlc also demonstrated in vivo activity in a reversed passive Arthus reaction (WO 89/09220, WO 91/05047; Yeh et al, 1991, J. Immunol. 146:250), suppressed post-ischemic myocardial inflammation and necrosis (WO 89/09220, WO 91/05047; Weisman et al, Science, 1990, 249:146-1511; Dupe, R. et al.
- 1929 of CR1 may be derivatised in accordance with the invention.
- Soluble polypeptides corresponding to part of CR1 have been found to possess functional complement inhibitory, including anti-haemolytic, activity.
- WO94/00571 discloses soluble polypeptides comprising, in sequence, one to four short consensus repeats (SCR) selected from SCR 1 , 2, 3 and 4 of long homologous repeat A (LHR-A) as the only structurally and functionally intact SCR domains of CR1 and including at least SCR3.
- SCR short consensus repeats
- LHR-A long homologous repeat A
- the polypeptide comprises, in sequence, SCR 1, 2, 3 and 4 of LHR-A or SCR 1, 2 and 3 of LHR-A as the only structurally and functionally intact SCR domains of CR1.
- polypeptides may be represented symbolically as follows:
- Wl, ⁇ l and Y represent residues 59- 62, 121-124 and 192-196, respectively, of mature CR1 and V represents residue 1 of mature CR1 optionally linked via its N-terminus to methionine.
- SCR4 represents residues 197-252 of mature CR1 and V 2 , W 2 , X 2 , Y 2 and Z 2 represents bonds or short linking sequences of amino acids, preferably 1 to 5 residues in length and which are preferably derived from native interdomain sequences in CR1.
- W 2 , X 2 , Y 2 and Z 2 represent residues 59-62, 121-124, 192-196, and residues 253 respectively, of mature CR1 and V 2 represents residue 1 of mature CR1 optionally linked via its N-terminus to methionine.
- arginine 235 is replaced by histidine.
- residue 235 is arginine.
- the polypeptide may be represented symbolically as follows:
- X 3 represents amino acids 122-124 of mature CR1 optionally linked to methionine at its N-terminus and Y 4 represents amino acids 192-196 of mature CR1.
- the polypeptide may be represented symbolically as follows:
- X 4 represents amino acids 122-124 of mature CR1 optionally linked to methionine at its N-terminus and Y 4 and Z 4 represent amino acids 192-196 and 253 respectively of mature CR1.
- the soluble CR1 polypeptide is derivatised in accordance with the invention by any convenient strategy from those outlined above.
- the soluble CR1 polypeptide consists of residues 1-196 of CR1 and with an N-terminal methionine and the derivative comprises a myristoyl group and one or more polypeptides sequence selected from
- CDGPKKKKKKSPSKSSK SKDGKKKKKKSKTKC CSAAPSSGFRILLLKV AAPSVIGFRILLLKVAGC and
- the soluble complement inhibitor such as a soluble CR1 polypeptide, derivative of this invention is useful in the treatment of many complement-mediated or complement-related diseases and disorders including, but not limited to, those listed below.
- Disease and Disorders Involving Complement Neurological Disorders multiple sclerosis stroke Guillain Barr ⁇ Syndrome traumatic brain injury
- the present invention is also directed to a pharmaceutical composition for treating a disease or disorder associated with inflammation or inappropriate complement activation comprising a therapeutically effective amount of a soluble complement inhibitor, such as a soluble CRl polypeptide, derivative of this invention, and a pharmaceutically acceptable carrier or excipient.
- a soluble complement inhibitor such as a soluble CRl polypeptide, derivative of this invention
- the present invention also provides a method of treating a disease or disorder associated with inflammation or inappropriate complement activation comprising administering to a subject in need of such treatment a therapeutically effective amount of a soluble complement inhibitor, such as a soluble CRl polypeptide, derivative of this invention.
- a soluble complement inhibitor such as a soluble CRl polypeptide, derivative of this invention.
- the subject is preferably a human.
- a soluble complement inhibitor such as a soluble
- CRl polypeptide, derivative of this invention in the manufacture of a medicament for the treatment of a disease or disorder associated with inflammation or inappropriate complement activation.
- compositions which further comprise a therapeutically active amount of a thrombolytic agent.
- An effective amount of a thrombolytic agent is in the dose range of 0.01-lOmg/kg; preferably 0.1-5mg/kg.
- Preferred thrombolytic agents include, but are not limited to, streptokinase, human tissue type plasminogen activator and urokinase molecules and derivatives, fragments or conjugates thereof.
- the thrombolytic agents may comprise one or more chains that may be fused or reversibly linked to other agents to form hybrid molecules (EP-A-0297882 and EP 155387), such as, for example, urokinase linked to plasmin (EP-A-0152736), a fibrinolytic enzyme linked to a water-soluble polymer (EP-A-0183503).
- the thrombolytic agents may also comprise muteins of plasminogen activators (EP-A- 0207589).
- the thrombolytic agent may comprise a reversibly blocked in vitro fibrinolytic enzyme as described in U.S. Patent No. 4,285,932.
- a most preferred enzyme is the p-anisoyl plasminogen-streptokinase activator complex, anistreplase as described in U.S. Patent No. 4,808,405 (Monk et al, 1987, Drugs 34:25- 49).
- Routes of administration for the individual or combined therapeutic compositions of the present invention include standard routes, such as, for example, intravenous infusion or bolus injection. Active complement inhibitors and thrombolytic agents may be administered together or sequentially, in any order.
- the present invention also provides a method for treating a thrombotic condition, in particular acute myocardial infarction, in a human or non-human animal.
- This method comprises administering to a human or animal in need of this treatment an effective amount of a soluble complement inhibitor, such as a soluble CRl polypeptide, derivative according to this invention and an effective amount of a thrombolytic agent.
- a soluble complement inhibitor such as a soluble CRl polypeptide, derivative of this invention and a thrombolytic agent in the manufacture of a medicament for the treatment of a thrombotic condition in a human or animal.
- a soluble complement inhibitor such as a soluble CRl polypeptide, derivative of this invention and a thrombolytic agent in the manufacture of a medicament for the treatment of a thrombotic condition in a human or animal.
- This invention further provides a method for treating adult respiratory distress syndrome (ARDS) in a human or non-human animal.
- This method comprises administering to the patient an effective amount of a soluble complement inhibitor, such as a soluble CRl polypeptide, derivative according to this invention.
- a soluble complement inhibitor such as a soluble CRl polypeptide, derivative according to this invention.
- the invention also provides a method of delaying hyperacute allograft or hyperacute xenograft rejection in a human or non-human animal which receives a transplant by administering an effective amount of a soluble complement inhibitor, such as a soluble CRl polypeptide, derivative according to this invention.
- Such administration may be to the patient or by application to the transplant prior to implantation.
- the invention yet further provides a method of treating wounds in a human or non-human animal by administering by either topical or parenteral e.g. intravenous routes, an effective amount of a soluble complement inhibitor, such as a soluble CRl polypeptide derivative according to this invention.
- a soluble complement inhibitor such as a soluble CRl polypeptide derivative according to this invention.
- the soluble polypeptide is a thrombolytic agent such as prourokinase, streptokinase, tissue-type plasminogen activator or reteplase and the derivative of the invention is useful in the treatment of thrombotic disorders such as acute myocardial infarction.
- the invention thus provides a pharmaceutical composition for treating thrombotic disorders comprising a therapeutically effective amount of a derivative of a thrombolytic agent according to the invention, and a pharmaceutically acceptable carrier or excipient.
- the invention further provides a method of treatment of thrombotic disorders by administering an effective amount of a derivative of a thrombolytic agent according to the invention, and the use of such derivative in the preparation of a medicament for the treatment of thrombotic disorders.
- Cleavage of DNA by restriction endonucleases was carried out according to the manufacturer's instructions using supplied buffers. Double digests were carried out simultaneously if the buffer conditions were suitable for both enzymes. Otherwise double digests were carried out sequentially where the enzyme requiring the lowest salt condition was added first to the digest. Once the digest was complete the salt concentration was altered and the second enzyme added.
- Plasmid isolation was carried out by the alkaline lysis method described in Sambrook et al, (1989) Molecular Cloning: A Laboratory Manual 2nd Edition. Cold Spring Harbour Laboratory Press or by one of two commercially available kits: the Promega Wizard ⁇ M p ⁇ us Minipreps or Qiagen Plasmid Maxi kit according to the manufacturer's instructions.
- DNA fragments were excised from agarose gels and DNA extracted using one of three commercially available kits: the QIAEX gel extraction kit or Qiaquick gel extraction kit (QIAGEN Inc., USA), or GeneClean (Bio 101 Inc, USA) according to the manufacturer's instructions.
- Plasmid DNA was sequenced on a Vistra DNA Labstation 625.
- the sequencing chemistry was performed using Amersham International's Thermo Sequenase fluorescent dye-terminator cycle sequencing kit" (RPN 2435), in conjunction with their “FMP fluorescent dye-terminator precipitation kit' (RPN 2433) according to the manufacturer's instructions.
- Oligonucleotides were purchased from Cruachem.
- the plasmid pT7-7 [Tabor, S (1990), Current Protocols in Molecular Biology, F. A. Ausubel, Brent, R. E. Kingston, D. D. Moore, J. G. Seidman, J. A. Smith, and K. Struhl,eds.] pp.l 6.2.1 -16.2.11, Greene Publishing and Wiley-Interscience,New York.] contains DNA corresponding to nucleotides 2065-4362 of pBR322 and like pBR322 can be mobilized by a conjugative plasmid in the presence of a third plasmid ColK.
- a mobility protein encoded by ColK acts on the nic site at nucleotide 2254 of pBR322 initiating mobilization from this point.
- pT7-7 was digested with Lspl and BglR and the protruding 5' ends filled in with the Klenow fragment of DNA Polymerasel.
- the plasmid DNA fragment was purified by agarose gel electrophoresis, the blunt ends ligated together and transformed into E. coli DH1 by electroporation using a Bio-Rad Gene Pulser and following the manufacturers recommended conditions.
- the resultant plasmid pBROC413 was identified by restriction enzyme analysis of plasmid DNA.
- SDS PAGE Sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS PAGE) SDS PAGE was carried out generally using the Novex system (British Biotechnology) according to the manufacturer's instructions. Prepacked gels of 4 - 20% acrylamide were used. Samples for electrophoresis, including protein molecular weight standards (for example LMW Kit, Pharmacia or Novex Mark 12) were usually diluted in l%(w/v)SDS - containing buffer (with or without 5%(v/v) 2-mercaptoethanol), and left at room temperature for about 10 to 30 min before application to the gel.
- protein molecular weight standards for example LMW Kit, Pharmacia or Novex Mark 12
- DTT dithiothreitol
- TCEP Tris (2-carboxyethyl) phosphine.HCl
- DTNB EUmans reagent
- reaction conditions eg. duration, temperature, molar ratios of reactants have to be carefully controlled so that reduction of disulphide bridges within the natural architecture of the protein is minimised. All the reagents are commercially available eg. from Sigma or Pierce.
- the following general examples illustrate the type of conditions that may be used and that are useful for the generation of free thiols and their optional modification.
- the specific reaction conditions to achieve optimal thiol reduction and/or modification are ideally determined for each protein batch.
- TCEP may be prepared as a 20mM solution in 50mM Hepes (approx. pH 4.5) and may be stored at -40 degrees C.
- DTT may be prepared at lOmM in sodium phosphate pH 7.0 and may be stored at -40 degrees C.
- DTNB may be prepared at lOmM in sodium phosphate pH 7.0 and may be stored at -40 degrees C. All of the above reagents are typically used at molar equivalence or molar excess over protein concentration, the precise concentrations ideally identified experimentally. The duration and the temperature of the reaction are similarly determined experimentally. Generally the duration would be in the range 1 to 24 hours and the temperature would be in the range 2 to 30 degrees C. Excess reagent may be conveniently removed by buffer exchange, for example using Sephadex G25 or Sephadex G50. A suitable buffer is 0. IM sodium phosphate pH7.0 or the solution may be left untreated.
- Myristoyl chloride (1.0 mmol) was added with vigorous stirring to ice-cooled dry pyridine (1.0ml), and followed immediately by N-hydroxysuccinimide (1.5 mmol). The mixture was stirred for 4h at ambient termperature ( ⁇ 23°C). 2-aminoethanethiol free base (1.1 mmol) was added as solid to the mixture and allowed to react for 6h at ambient temperature, followed by 3 days at 4°C. The product was treated with water (5ml), stirred for lh at ambient and filtered, washing with cold water. The white solid was dissolved in dimethylsulphoxide and reprecipitated with water and then vacuum dried over phosphorous pentoxide. The final yield was 0.21g (-70%). Thiol titration using Ellman's reagent indicated that the product contained ⁇ 45% free thiol.
- MSWP-1 Myristoyl/Electrostatic Switch Peptide Reagent 1 (MSWP-1) (SEQ ID NO: 27) N-(MyristoyI) -Gly-Ser-Ser-Lys-Ser-Pr -Ser-Lys-Lys-Lys-Lys-Lys-Pro-Gly.Asp-(S-2- Thiopyrldyl)Cys-NH 2
- the peptide: Gly-Ser-Ser-Lys-Ser-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Pro-Gly-Asp-Cys-NH2 (SEQ ID NO: 5) was prepared using solid phase synthesis via the general Fmoc/tBu strategy developed by Sheppard and Atherton (E.Atherton and R.C.Sheppard, Solid Phase Synthesis, IRL Press, Oxford, 1989). Kieselguhr-supported polydimethylacrylamide resin (Macrosorb 100) was used as the solid support and was derivatised with ethylene diamine.
- Reactions to assemble the peptide chain were carried out by repeated cycles of coupling and deprotection including the attachment of the modified Rink linkage reagent (p-[(R,S)- ⁇ -[l-(9H-fluoreny-9-yl-methoxyformamido ] 2,4 dimethoxybenzyl]- phenoxyacetic acid) designed to yield a C-terminal amide on final cleavage.
- the side chain functionalities of the individual amino-acids were protected as follows: Ser (tButyl), Lys (Boc), Asp (O-tButyl), Cys (Trityl).
- the myristoyl group was attached to the amino group of the N terminal glycine by direct coupling of myristic acid by the same activation procedure.
- This modified peptide was then cleaved from the resin and the side-chain protecting groups removed at the same time by treatment with trifluoracetic acid containing 2.5% water and 2.5% triisopropyl silane.
- the crude product was treated with 2,2' dithiopyridine in 0.0 IM ammonium acetate solution at pH 8-9 for approx. 2h, then acidified with acetic acid and purified by preparative high performance liquid chromatography (HPLC) in 0.1 % trifluoracetic acid (TFA) /water and 0.1% TFA/acetonitrile as gradient component After lyophilisation, the peptide was a white amorphous powder, soluble to at least lOmg/ml in dimethylsulphoxide.
- the peptide: Cys-Asp-Gly-Pro-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Ser-Pro-Ser-Lys-Ser-Ser-Lys-NH 2 was prepared by solid-phase synthesis using the general method described in Example 2 and with the following variations: a. The C-terminal lysine was protected by alkylation with the 4-methyl trityl (MTT) group; all other lysines were N- ⁇ protected with the t-Boc group b. MTT was removed with 1% v/v trifluoracetic acid in dichloromethane and the resulting unique free amino group derivatised with myristic acid prior to deprotection of the other lysines (as described in Example 2)
- Amino-acid analysis indicated a net peptide content by weight of 68.7%.
- the 2-pyridyl disulphide content was appoximately 60% by weight using the method of Example 2.
- the peptide: Ser-Lys-Asp-Gly-Lys-Lys-Lys-Lys-Lys-Lys-Ser -Lys-Thr-Lys-Cys (SEQ ID NO: 19) was prepared using the general solid-phase synthesis protocol of Example 2. Myristoylation, C-terminal amidation and derivatisation of die Cys residue were performed as described in Example 2. After purification, mass spectrometry gave the major peak at 2040.5, corresponding to a monoprotonated form (Theory: 2039.5)
- the peptide content was about 56% by weight
- T-Cell Targeting Peptide Reagent 1 (TCTP-1) (SEQ ID NO: 30) N-acetyK2-thiopyridyl)Cys Ser-Ala-A -Pro-Ser-Ser-Gly-Phe-Arg-Ik-Leu-Leu-Leu-Lys-Val- CONH(CH 2 )9CH3
- the C-terminus was derivatised using n- decylamine in place of the Rink reagent Mass spectrometry of the purified peptide gave a major peak at 1952.3 corresponding to a monoprotonated molecular ion (Theory: 1951.1.) An ion at 1843.3 was also observed , this is believed to correspond to loss of the thiopyridyl group in the spectrophotometer.
- the peptide content by weight was 53%
- the plasmid coding for SCR 1-3 of LHR-A of CRl, pDB1013-5 (patent application WO 94/00571) was digested witii restriction endonucleases Ec ⁇ Rl and HindlH and the 2.2 kB plasmid band was isolated from an agarose gel using a Qiagen Qiaex DNA extraction kit according to the manufacturer's instructions. This is fragment 1.
- a second batch of pDB1013-5 was digested with Ba ⁇ l and £c ⁇ RI and the 196 bp band was extracted from agarose as above. This is fragment 2.
- oligonucleotides SEQ ID No.l and SEQ ID No.2, were annealed to give a final DNA concentration of 100 pmoles/ul.
- the annealed oligo has a BariUEcoRI overhang and duphcates the sequence at the 3' end of pDB1013-5 but in addition contains a codon coding for cysteine just before the stop codon. This is fragment 3.
- Fragments 1,2 and 3 were ligated with T4 DNA ligase in a single reaction to give pDB1030 .
- the ligated plasmid was transformed into competent E. coli JM109 purchased from Promega. Resulting colonies were analysed by restriction endonuclease digestion and DNA sequencing confirmed that the encoded amino acid sequence of SCRO-3) (SEQ ID No.27 of WO 94/00571) had been altered by a single C-terminal cysteine residue to give SEQ ID No.6.
- the frozen cell pellet of E. coli BL21(DE3) (pDB1030) was resuspended in 50 mM Tris/50 mM NaCl/1 mM EDTA/0.1 mM PMSF pH 8.0 at a ratio of 33 ml for each litre of culture pellet.
- the disrupted pellet was then frozen and stored at -80°C. Approx. 2 weeks later the sonicate was thawed and centrifuged at approx. 8000g for 20 min.
- SP-Sepharose FF (approx. 30g wet weight) that had been water washed and suction-dried. The mixture was swirled vigorously and left static for l-2h at room temperature. The supernatant was decanted, sampled and discarded. The remaining slurry was resuspended to a uniform suspension and poured into a glass jacket and allowed to settle into a packed bed. The column was equilibrated with 0.02M Tris/8M urea/0.05M 2-mercaptoeti ⁇ anol/O.OOl M EDTA pH 8.5.at 4°C.
- the buffer was changed to equilibration buffer additionally containing IM NaCl.
- a single A28O peak was eluted by the IM NaCl-containing buffer; the volume was approx. 50ml.
- the protein concentration of the solution was estimated by A280 determination, using a molar
- the solution was then ultrafiltered using a Y 10 membrane to a final retentate volume of about 35 ml; die retentate was slightly cloudy and had die appearance of a translucent solution. It was stored for 12 days at 4° C. It was then spun at 30 OOOg for 15 mins and the supernatant mixed wi ⁇ 9 vol. 0.1M NaH2PO /lM (NH4)2S04 pH 7.0 (Buffer A) at room temperature and immediately centrifuged at 3000 rpm for 15 min. The supernatant was ultrafiltered (YM10) to about 4ml and then buffer-exchanged into 0.1M sodium phosphate pH 7.0 (5.0ml); this solution had a protein concentration of 1.7mg/ml by A280 analysis.
- the method was similar to that described above, except that it more closely followed the procedures described in Dodd et al (op cit). Notably, the ultrafiltered retentate post refolding was immediately treated with ammonium sulphate followed by clarification by centrifugation and Butyl Toyopearl chromatography. The resulting A280-absorbing fractions that eluted at about 0.2 to 0.4M ammonium sulphate were pooled and regarded as Product B. Starting with a nominal lOOmg of fully reduced SCRl-3/cys, Product B contained 17mg. The product contained one major species by non-reduced SDS PAGE with an estimated purity of >90% and an apparent molecular weight of 21 000.
- Fragment 1 and fragment 2 of pDB 1013-5 were the same as Example 6 above.
- Two oligonucleotides, SEQ ID No.3 and SEQ ID No. 4, prepared by Cruachera were annealed to give a final DNA concentration of 100 pmoles/ul.
- the annealed oligo has an Ba UEcoKl overhang and duplicates die sequence at the 3' end of pDB 1013-5 but in addition contains 17 additional codons coding for DGPKKKKKKSPSKSSGC just before the stop codon. This is fragment 4.
- Fragments 1, 2 and 4 were ligated with T4 DNA ligase in a single reaction to give pDB 1031.
- the ligated plasmid was transfomed into competent E. coli J 109. Resulting colonies were analysed by restriction endonuclease digestion and DNA sequencing confirmed that the encoded amino acid sequence of SCR 1-3 (SEQ ID 27 of WO 94/00571) had been altered by C terminal addition of amino acids DGPKKKKKKSPSKSSGC to give SEQ ID NO: 7.
- the frozen cell pellet of E. coli BL21(DE3) ( ⁇ DB1031) was tiiawed and resuspended in 50 mM Tris 50 mM NaCl/1 mM EDTA/0.1 mM PMSF pH 8.0 at a ratio of 33 ml for each litre of culture pellet.
- the disrupted pellet was then frozen and stored at -80°C. Approx. Id later the sonicate was thawed and centrifuged at approx. 8000g for 20 min.
- SP-Sepharose FF (approx. 30g wet weight) that had been water washed and suction dried. The mixture was swirled vigorously and left static for approx. 2h at room temperature. The supernatant was decanted, sampled and discarded. The remaining slurry was resuspended to a uniform suspension and poured into a glass jacket and allowed to settle into a packed bed. The column was equilibrated with 0.02M Tris/8M urea/0.05M 2-mercaptoethanol/0.001 M EDTA pH 8.5.at 4°C. When the A28O of die eluate had stabilised at baseline, die buffer was changed to equilibration buffer additionally containing IM NaCl.
- a single A28O P- 3 ⁇ was eluted by die IM NaCl-containing buffer; the volume was approx. 50ml.
- the protein concentration of the solution was estimated by A28O determination, using a molar extinction coefficient of 25000 cm '1 , of a sample that had been buffer-exchanged (Sephadex G25) into 50 mM formic acid. This showed the product had a protein concentration of 2.8mg/ml. Analysis by SDS PAGE/stain showed a major band (approx 80%) at about 23 OOODa.
- the solution was stored at -40°C. iii) Folding and further processing
- the method was similar to that described in (c) above, except that following the ultrafiltration step after refolding it more closely followed die procedures described in Dodd et al (op cit.). Notably, the ultrafiltered retentate post refolding was immediately treated with ammonium sulphate followed by clarification by centrifugation and Butyl Sepharose chromatography. The resulting A280-absorbing fractions that eluted at about 0.2 to 0.4M ammonium sulphate were pooled and regarded as initial product. Additional treatment with TCEP essentially as above, followed by DTNB yielded a final product at lOuM final protein concentration. The final product contained one major species by non-reduced SDS PAGE witii an estimated purity of >90% and an apparent molecular weight of 23 000 and contained about 2 moles TNB per mole of protein.
- the mixture was held for 2h on ice and then gel filtered as before but using 2 PD10 columns (1.6 ml applied, 3.2ml eluted). The final eluate was not cloudy and was stored frozen at - 70°C in aliquots of 0.4ml.
- the fraction was aliquoted and aliquots stored at - 40 degrees C or lyophilised.
- Amino acid analysis of die pre-lyophilisation solution indicated a protein concentration of 0.42mg/ml.
- A280 (1cm path length) was 0.44.
- C8 reverse phase HPLC and SDS PAGE botii indicated a purity of approx 80%
- the latter technique showed the major band had an apparent molecular weight of 23 000, clearly shifted from me original parent molecular weight of 21 000; on reduction the 23 000 band shifted to two bands with molecular weights of approx 21 000 and approx 5 000.
- the lyophilisate was easily soluble in 50mM formic acid or in PBS 'A' (Dulbecco) at a protein concentration of 6mg/ml.
- Example 7 prepared as in Example 7(d).
- the TNB-activated SCRl-3/switch is mixed witii a molar excess of MAET (Example 1), which might be typically made up at 2.0mg/ml in DMSO, equivalent to about 3mM free thiol.
- Typical reaction conditions would be 1 to 4 hours at room temperature or overnight at 4 degrees C using a protein concentration of 1 to 100 uM.
- the reaction may be monitored by checking the generation of yellow colour, which is caused by the release of free TNB ion. Once the reaction is complete the solution may be buffer exchanged into a suitable buffer, for example 0.1M sodium phosphate pH 7.0, and stored at - 40 degrees C until required.
- a suitable buffer for example 0.1M sodium phosphate pH 7.0
- MSWP-1 (Example 2, lOmM in 0.1M sodium phosphate pH 7.0) was mixed with 0.005ml of TCEP (20mM in 50mM Hepes) and left for 10 min at room temperature.
- the resultant solution was Solution A containing the myristoylated peptide of SEQ ID NO: 5.
- TNB-activated SCRl-3/switch (SEQ ID NO: 7) prepared in a similar way to mat described in Example 7(c) (0.3ml; 15uM in 0.1M sodium phosphate pH 7.0) was mixed with 0.0056ml of Solution A to give a theoretical MSWP-SH molar excess of five- fold over protein.
- TNB-activated SCRl-3/switch product (SEQ ID NO: 7) (lOuM; 0.43ml) prepared in a similar way to that described in Example 7(d) was mixed with TCEP (5mM; 0.0026ml) and incubated for 17h at room temperature to yield the free fusion protein SEQ ID NO: 7.
- MSWP-1 (lOmM; 0.0086ml) was added and incubation was continued for a further 4h. Small particles or crystals were present in the solution, but it was otherwise clear. The particulate solution was buffer-exchanged into 50mM formic acid (1.0ml), aliquoted and frozen.
- Human complement receptor 1 (CR 1 , CD35) is a known regulator of complement activation which has been produced in a recombinant soluble form containing all of the extracellular SCR domains of a major natural allotype (Fearon et al, WO 89/09220, WO 91/05047). This form (sCRl) has been expressed as an active protein in Chinese Hamster Ovary (CHO) cells. Mutagenesis of the DNA sequence immediately downstream of the codon for Cys-1924 is performed to generate a new C-terminal cysteine residue.
- a suitable example of a modified terminus of the cDNA sequence of sCRl is as follows:
- the codon Asp- 1930 in CRl is replaced by that for a Cysteine (followed by a stop codon to generate a soluble protein) through ligation of a modified oUgonucleotide to the unique Bal I restriction endonuclease site at position 5914 (numbering from Fearon et al, 1989,1991).
- Expression of this modified cDNA in CHO cells and isolation of the product by standard chromatographic procedures generates a modified sCRl protein which can be treated as in Example 8(a), (b) or (c) to couple it to MSWP-1 (Example 2) to yield the title compound.
- [SCR 1 -3]-Cys protein (SEQ ID NO: 6) prepared in a similar way to that described in Example 6(d) (46uM protein; 0.20ml) was mixed with TCEP (5mM; 0.0054ml) and incubated at room temperature for approx. 20h. 0.05ml of this solution was mixed witii 0.025ml of 0. IM ethanolamine and 0.003ml of MSWP-2 (see Example 3; 5mM in DMSO; ); the solution was incubated for a further 3h at room temperature. SDS PAGE analysis showed die major band in the preparation had an apparent molecular weight of 23 000, clearly shifted from the original parent molecular weight of 21 000. The purity of the target protein was estimated from the SDS PAGE gel to be approx 80%.
- [SCRl-3]-Cys protein (SEQ ID NO: 6) prepared in a similar way to that described in Example 6(d) (46uM protein; 0.10ml) was mixed with TCEP (5mM; 0.0037ml) and incubated at room temperature for approx. 18h. 0.01ml of 0.5M ethanolamine was added. 0.03ml of this 0.11ml solution was mixed with 0.0032ml of MSWP-3 (see Example 4; 2mM in 0.1M sodium phosphate pH 7.0); the solution was incubated for a further 3h at room temperature. SDS PAGE analysis showed die major band in the preparation had an apparent molecular weight of 23000, clearly shifted from the original parent molecular weight of 21 000. The purity of the target protein was estimated from the SDS PAGE gel to be approx 80%.
- [SCRl-3]-Cys protein prepared in a similar way to that described in Example 6(d) (46uM protein; 0.08ml) was mixed witii TCEP (5mM; 0.0029ml) and incubated at room temperature for approx. 18h. 0.008ml of 0.5M ethanolamine was added. 0.04ml of tiiis 0.088ml solution was mixed with 0.0029ml of TCPT-1 (see Example 5; 2.9mM in DMSO). The TCPT- 1 was added in 6 aliquots over a 2h period to minimise aggregation. The solution was incubated for a further 2h at room temperature.
- the final appearance of the mixture was one of a colloidal suspension and centnfugation at 2000g for 1 min showed mat the target protein was compartmentalised in the precipitate.
- SDS PAGE analysis showed the major band in the preparation had an apparent molecular weight of about 23 000, clearly shifted from the original parent molecular weight of 21 000.
- the purity of the target protein was estimated from me SDS PAGE gel to be approx 80%.
- RAEM rabbit polyclonal anti(human erythrocyte membrane)
- the product was purified by gel permeation chromatography on a small disposable column of Sephadex G-25m (PD-10, Pharmacia, Sweden.Sweden) at 4°C. 2.5ml of the product (total volume 3.0ml, theoretical protein concentration -6.1 uM) was treated with MSWP-1 (Example 2, 0.125 ml of 5mM solution in dimethyl sulphoxide, final cone -240uM) and incubated at 25°C for 30 min. The product was gel-filtered on a PD10 column as above to give 3.0ml of a solution ⁇ 5uM in protein. This was stored frozen at -70°C.
- Streptokinase (SK) stock solution (Behringwerke, Marburg, Germany, 12.8 mg ml, 271 uM, 2.5ml) was gel filtered using a PD10 column into 3.2 ml of PBS buffer (see Example 15) containing 0.01%w/v Tween 80 [PST buffer].
- the stock thiolated SK solution (2 x 0.5ml) was processed by modifying one aliquot with MSWP-1 (32ul of 5mM stock in DMSO), incubated lh at 25°C and gel filtered (PD10 column) into 3.0ml PST at 4°C. A control aliquot was processed in parallel without exposure to MSWP-1. Both products contained - 0.8 mg/ml protein based on an extinction coefficient of 0.76 (mg/ml) * at 280nm for SK and were stored at -75°C.
- the thiol-reactive acyl-enzyme 4-N-[2-N-(3-[2-pyridyldithio]- ethylcarbonyl)aminoethyl]aminobenzoyl - [Ser-478] human tissue-type plasminogen activator [PDAEB->tPA] was prepared by die method of Smith and Cassels (Fibrinolysis, 2, 189-195, 1988).
- Tissue plasminogen activator Actilyse, Boehringer Ingelheim .Germany, approx 2mg was dissolved in the PST buffer of Example 16 (1.0ml) and treated with 25ul of a 20mM solution of 4'-amidinophenyl 4-N-[2-N-(3-[2- pyridyldithio]-ethylcarbonyI)aminoethyl]aminobenzoate hydrochloride (S.B.Kalindjian & R.A.G.Smith, Biochem. J. 248, 409-413,1987) in dimethylsulphoxide. The mixture was incubated for lh at 25°C and stored frozen at -80°C.
- MSWP-1 (Example 2, lOOul of a 5mM solution in dimethylsulphoxide) and incubated for 90 min on ice. The product was buffer-exchanged as above into 3.2ml PST and stored in aliquots at -196°C.
- Example 18 Expression and purification of [SCRl-3]-Cys (SEQ ID 6) from a fermentation run.
- a frozen stock of E. coli harbouring the plasmid pDB 1030 was initially prepared by plating the culture out onto LB agar plus ampicillin at lOO ⁇ g/ml. 1ml ahquots were preserved in a 10% glycerol / PBS cryopreservative and stored under liquid nitrogen. A lml vial was thawed and was used to inoculate 100ml LB"" * " 00 primary seed medium (Difco Bactotryptone.lOgl 1 ; Difco yeast extract, 5gl " '; sodium chloride, 5gl '; pH pre- sterilisation 7.4) in a 500ml flask.
- the primary seed stage was incubated at 37°C for 3 hours before transfer to die second seed stage, also 100ml LB An,p,0C per 500ml flask using a 1% inoculum. Following incubation as above for a further 4 hours a 1% inoculum was transferred to the tertiary seed stage, lOlitres LB *TM* " 00 in a 151itre Biolafitte fermenter. The 10 litres tertiary seed medium was sterilised insitu for 45 minutes at 121°C before inoculation. Following incubation for 14.5 hours, the tertiary seed was transferred to the final stage fermenter as a 6% inoculum.
- Incubation conditions for the seed stage were as follows: airflow at lOlmin ' (l.Ovvm), temperature 37°C, agitation at 400rpm (1.9ms 1 ) and overpressure 0.2bar. 300 litres Tryptone phosphate medium Ao,p,00 (Difco Bactotryptone, 20gl '; Difco yeast extract, 15gl ' '; sodium chloride, 8gl '; disodium hydrogen orthophosphate, 2gl '; potassium dihydrogen orthophosphate, lgl '; Dow Corning 1520 antifoam, 0.
- lgl '; pH pre-sterilisation 7.4 was sterilised in situ for 30 minutes at 121°C in a 450L Bioengineering fermenter.
- the fermenter was inoculated with 20 litre inoculum from the tertiary seed stage and incubated under the following conditions : airflow 450L min '1 (1.5wm), temperature 37°C, agitation 230rpm (1.5ms 1 ) and overpressure 0.5bar. After an OD J5C ⁇ t ⁇ of 3.5 was obtained, ImM IPTG was added. Harvest followed after continued incubation for 2 hours. A cell slurry was recovered after primary centrifugation through a Westfalia CSA19 (two discharges). The cells were further spun at 4700rpm (7000g) for 30 minutes in a Sorvall RC3B centrifuge. The total cell yield (wet weight) was 2.98Kg and was stored at -80 degrees C in approx. 600g lots.
- Inclusion bodies from 100 g (wet weight) cell pellet were isolated and solubilised essentially as described in Example 6.
- the purification of target protein from resolubilised inclusion bodies was also as described in Example 6 with some modifications. The major ones were :
- Refolding of a lOOmg sample of the partially purified protein was carried out by diluting the fully denatured protein (2mg/ml) 100-fold in cold 60mM edianolamine/lmM EDTA, followed by addition of the glutathione redox couple.
- Example 2 The product of the above process was capable of being modified with MSWP-1 (Example 2) in a way similar to that described in Example 8.
- Plasmid pBC04-29 was constructed from plasmid pDB1013-5 encoding SCR1-3 of LHR-A of CR 1 (patent application WO 94/00571 ) by QuickChange site directed mutagenesis (Stratagene) according to the manufacturers protocols. Two complementary oligonucleotides ( SEQ ID No 15 and SEQ ID No 16 were used to generate a novel restriction site (silent) at G186 P187 and a C terminal cysteine. In the event the reaction produced a frame-shift mutation at position N195. In the resulting sequence the C terminal amino acids N195 and K196 are replaced with a 14 amino acid peptide TNANKSLSSISCQT. Fortuitously, this sequence contains an internal cysteine close to the C terminus, preceeded by a spacer sequence of 11 amino acids.
- the methods are essentially those detailed in Dodd I. et al (1995) Protein Expression and Purification 6 727-736, subsequently modified as described in Example 18. Briefly, the cell pellet from IL of culture from (b) was resuspended in buffer, sonicated and the inclusion bodies isolated by centnfugation. The inclusion bodies were resolubihsed in 100 ml of fully reducing buffer and target protein purified on Macroprep High S (30g wet weight).
- SDS PAGE under non-reducing conditions followed by protein staining revealed a major polypeptide witii an apparent molecular weight of 22000, believed to be the target protein.
- One of the contaminating polypeptides had an apparent molecular weight of about 40000, which was identified as the dimer of the monomeric form of the target by comparison with adjacent markers of [SCRl-3]-Cys.
- the product had an estimated protein concentration of 30uM.
- Plasmid pBC04-31 was constructed using plasmid pBC04-29 (described in Example 19) and a synthetic oligonucleotide pair (SEQ ID No.25 and SEQ ID No. 26).
- pBC04-29 was digested with the restriction enzymes HindHI and Apal and die large fragment (2170bp) isolated. The two oligonucleotides were annealed by warming to >90oC and slowly cooling to room temperature and ligated witii the DNA fragment The ligated DNA was transformed into competent E. coli XLI-Blue.
- Colonies were analysed for plasmids in which the oligonucleotides had been inserted by looking for d e presence of a novel Aval site at position 2733. On digestion with Aval pBC04-31 yielded fragments of 2311 and 495bp. DNA from positive clones was used to transform the expression strains. The oligonucleotides inserted added die peptide sequence DGPSEILRGDFSSC to the C terminus of SCRl-3 and also repaired the frame-shift error seen in pBC04-29.
- Example 23 Preparation of [SCRl-3] AAPSVIGFRILLLKyAGC (SEQ ID No.33)
- Plasmid pBC04-34 was constructed using plasmid pBC04-29 (described in Example 19) and a synthetic oligonucleotide pair (SEQ ID No. 34 and SEQ ID No. 35).
- pBC04-29 was digested widi the restriction enzymes HindHI and Apal and the large fragment (2170bp) isolated.
- the two oligonucleotides were annealed by warming to >90°C and slowly cooling to room temperature and were ligated with the DNA fragment
- the ligated DNA was transformed into competent E. coli XLI-Blue. Colonies were analysed for plasmids in which the oligonucleotides had been inserted by looking for an increase in size of the Ndel/HindHI fragment by 59 base pairs. The presence of the cysteine codon was determined by die presence of a Ddel site at position 2781.
- pBC04- 34 digested with Ddel yielded diagnostic bands of 481 and 109bp DNA from positive clones was used to transform the expression strains (see next section).
- the oligonucleotides inserted added the peptide sequence AAPSVIGFRILLLKVAGC to the C terminus of SCRl-3 and also repaired die frame-shift error seen in pBC04-29.
- the serum fraction was split into small aliquots and stored at - 196°C or -80°C. Aliquots were thawed as required and diluted in the Hepes buffer immediately before use. Inhibition of complement-mediated lysis of sensitised sheep erythrocytes was measured using a standard haemolytic assay using a v-bottom microtitre plate format as follows:
- Otiier IH50 values generated for similar batches include:
- [SCRl-3]-Cys-S-S-[MSWP-l] was examined in the classical pathway haemolytic assay using the sera of pig, guinea pig, rat or marmoset.
- the methodology was essentially as described in (I) with minor modifications, for example small changes to the concentration of serum used.
- [SCRl-3]-Cys-S-S-[MSWP- 1] was prepared essentially as described in Example 8c.
- the IH50 values for the different sera were: pig, 0.2nM; guinea pig, 0.3nM; rat, 0.4nM; marmoset, 0.2nM.
- Guinea pig erythrocytes were prepared from guinea pig whole blood collected into EDTA-coated tubes as follows. The blood was spun at 1600 rpm for 5 min and die erytiirocyte pellet washed 3 times with 0.1 M Hepes/ 0.15 M NaCl / 0.1% gelatin pH 7.4 until the supernatant of the spin was essentially colourless.
- the erythrocytes were finally resuspended to the original volume of blood used and were stored at + 4 degrees C. They were used within 2 weeks. 50 ⁇ l of a range of concentrations of inhibitor diluted in buffer A in a v-bottom microtitre plate were mixed with, first, 100 ⁇ l of serum that had been diluted 1:3 and second, 50 ⁇ l of guinea pig erythrocytes (diluted 1:49 in buffer A) and incubated for 1 hour at 37°C. The plate was spun at 1600 rpm for 3 minutes before transferring 150 ⁇ l of each supernatant to a flat bottom microtitre plate and determining the absorption at 405 nm, which reflects the amount of lysis in each test solution.
- SK-related molecules from Example 16 were assayed using a plasminogen activation assay.
- a solution of purified human Lys 77 -Plasminogen (luM in PST buffer containing 25%v/v glycerol [PSTG buffer], 0.5ml) was incubated with thiolated SK (final concentration 0.1 to 1.07 nM) for lh at 25°C.
- An aliquot of this mixture (lOul) was incubated with LOmM of the plasmin substrate S-2251 (H-D-Val-Leu-Lys-p- nitroanilide, KabiVitrum, Sweden) in 0.1M Triethanolamine HC1 pH 8.0 (0.5ml) at 25°C.
- SU substrate unit
- plasmin activity is defined as the amount of enzyme giving an increase in optical density at 405nm of 0.001 min .
- thiolated SK (InM) generated plasmin at a nearly linear of 4225 SU/ml.
- SK-MSWP-1 conjugate was diluted 1:100 in PSTG buffer and 5-50ul ahquots tested in the plasminogen activation assay. The stock preparation was found to contain approximately 2.9uM functional SK.
- Human pooled erythrocytes (Ortho A2, Raritan, New Jersey, 3% v/v, 50ul) were added to microtitre plates wells and either unmodified rabbit anti-(human erythrocyte membrane) antibody [RAEM] or RAEM-MSWP1 conjugate from Example 15 added at concentrations expressed relative to undiluted stock RAEM.
- Cells were agitated at -lOOrpm for 40min at 25°C. 5ul was removed from each well and examined by light microscopy at x 20 magnification. A visual scoring scale was used as follows: - No clumping, cells moving freely relative to each other.
- MSWPl allowed a higher effective concentration of bridging antibody on the membrane surface.
- [SCRl-3]-Cys-S-S-[MSWP-l] (2mg/ml in PBS; 0.25ml) was mixed with 0.5mCi of 125-Iodine (Amersham) in the presence of 9nmoles potassium iodide following the Iodogen procedure and reagents (Pierce and Warriner (UK) Ltd.).
- the labelling was allowed to proceed for 20 min at room temperature, the reaction was quenched with 0.1ml of IM potassium iodide and die solution buffer-exchanged into PBS 0.1% albumin. Citrated blood collected from a healthy volunteer was used as a source of human erythrocytes.
- [SCRl-3]-cys (prepared in a similar way to that described in Example 18) (45uM,1.0mg/ml in 0.1M sodium phosphate, approx. 0.2M ammonium sulphate pH 7.0 ) was partially reduced by incubation at 25°C for 18h by the addition of a 4-molar excess of Tris(2-carboxyethyl)phosphine (TCEP; Pierce & Warriner (UK) Ltd.). The solution was buffer exchanged into 50mM Hepes pH7.0; post buffer exchange the protein concentration was 22uM.
- TCEP Tris(2-carboxyethyl)phosphine
- Example 2 to give a five-fold molar excess over fluorescein labelled protein and was incubated for 4h at 25°C. The solution was buffered exchanged into PBS and this solution was used for the microscopy studies.
- Citrated blood was collected from a healtiiy volunteer and the erythrocytes isolated, washed in PBS and diluted 250-fold compared to the original blood volume.
- 0.05ml of erythrocytes were incubated with 2uM fluorescein-[SCRl-3]-cys-S-S-[MSWP- 1] or 2uM fluorescein-[SCRl-3] and incubated for 30min at 37°C.
- An eight microlitre sample of each incubation was mounted on a slide and viewed on an inverted confocal microscope (Biorad).
- a stabilised preparation of human erythrocytes (trypsinised, glutaraldehyde- treated, Sigma, Gillingham.UK, 4% v/v, 0.4ml) was pelleted by centrifugation ( ⁇ 2000g/2min) and resuspended in 0.4ml PST buffer with either 0.1 uM thiolated SK or 0. luM SK-MSWP- 1 from Example 16.
- MSWP-1 conjugate produced 6184 SU/ml.
- the latter activity corresponds to around 2100 thiolated SK molecules/cell.
- SEQ ID NO : 2 AGCTTTTATTAGC ATTTGTTCGGGATGATGCACTGCG
- SEQ ID NO:8 linear, 2 polypeptide chains disulphide linked
- SEQ ID NO: linear, 2 polypeptide chains disulphide linked Met Gin Cys Asn Ala Pro Glu Trp Leu Pro Phe Ala Arg Pro Thr Asn
- SEQ ID NO 10 linear, 2 polypeptide chains disulphide linked
- Residue 478 Single chain form of the 527 amino acid residue intact t-PA molecule.
- Residue 478 (serine) has been modified as shown below [SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFN GGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS AESGAECTNW NSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACS EGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYC RNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQA AIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRWPGEE EQKFEVEKYIVHK
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Enzymes And Modification Thereof (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK97933665T DK0912730T3 (da) | 1996-07-15 | 1997-07-08 | Konjugater af opl selige peptidforbindelser med membranbindende stoffer |
| DE69739186T DE69739186D1 (de) | 1996-07-15 | 1997-07-08 | Konjugate von löslichen peptidischen verbindungen mit membranbindenden wirkstoffen |
| IL12803497A IL128034A0 (en) | 1996-07-15 | 1997-07-08 | Conjugates of soluble peptidic compounds with membrane-binding agents |
| NZ333722A NZ333722A (en) | 1996-07-15 | 1997-07-08 | Soluble fatty acid derived peptide each with binding element more than 5kD as medicaments for disorders associated with inflammation or inappropriate complement activation |
| AU36939/97A AU732725B2 (en) | 1996-07-15 | 1997-07-08 | Conjugates of soluble peptidic compounds with membrane-binding agents |
| JP50560898A JP4177457B2 (ja) | 1996-07-15 | 1997-07-08 | 膜結合剤と可溶性ペプヂド性化合物の結合体 |
| CA002260288A CA2260288A1 (en) | 1996-07-15 | 1997-07-08 | Conjugates of soluble peptidic compounds with membrane-binding agents |
| EP97933665A EP0912730B1 (en) | 1996-07-15 | 1997-07-08 | Conjugates of soluble peptidic compounds with membrane-binding agents |
| IL128034A IL128034A (en) | 1996-07-15 | 1999-01-13 | Conjugates of soluble peptidic compounds with membrane-binding agents |
| US10/742,887 US7655617B2 (en) | 1996-07-15 | 2003-12-23 | Conjugates of soluble peptidic compounds with membrane-binding agents |
| IL16605104A IL166051A0 (en) | 1996-07-15 | 2004-12-30 | Membrane localization reagent |
| US12/192,560 US20100286367A1 (en) | 1996-07-15 | 2008-08-15 | Conjugates of soluble peptidic compounds with membrane-binding agents |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9614871.3A GB9614871D0 (en) | 1996-07-15 | 1996-07-15 | Compounds |
| GB9614871.3 | 1996-07-15 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US09214913 A-371-Of-International | 1999-03-16 | ||
| US09/612,314 Continuation-In-Part US6713606B1 (en) | 1996-07-15 | 2000-07-07 | Conjugates of soluble peptidic compounds with membrane-binding agents |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO1998002454A2 true WO1998002454A2 (en) | 1998-01-22 |
| WO1998002454A3 WO1998002454A3 (en) | 1998-04-02 |
Family
ID=10796956
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP1997/003715 Ceased WO1998002454A2 (en) | 1996-07-15 | 1997-07-08 | Conjugates of soluble peptidic compounds with membrane-binding agents |
Country Status (17)
| Country | Link |
|---|---|
| US (3) | US6713606B1 (https=) |
| EP (1) | EP0912730B1 (https=) |
| JP (1) | JP4177457B2 (https=) |
| AR (1) | AR007737A1 (https=) |
| AT (1) | ATE419345T1 (https=) |
| AU (1) | AU732725B2 (https=) |
| CA (1) | CA2260288A1 (https=) |
| CO (1) | CO4750673A1 (https=) |
| DE (1) | DE69739186D1 (https=) |
| DK (1) | DK0912730T3 (https=) |
| ES (1) | ES2321245T3 (https=) |
| GB (1) | GB9614871D0 (https=) |
| IL (3) | IL128034A0 (https=) |
| NZ (1) | NZ333722A (https=) |
| TW (1) | TW538048B (https=) |
| WO (1) | WO1998002454A2 (https=) |
| ZA (1) | ZA976216B (https=) |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998039433A1 (en) * | 1997-03-05 | 1998-09-11 | Adprotech Plc | Complement receptor type 1 (cr1)-like sequences |
| WO2000004052A3 (en) * | 1998-07-16 | 2000-04-20 | Adprotech Plc | Soluble derivatives of anti-angiogenic peptides |
| WO2000053007A1 (en) * | 1999-03-10 | 2000-09-14 | Adprotech Limited | Organ transplant solutions containing conjugates of soluble peptidic compounds with membrane-binding |
| US6210707B1 (en) | 1996-11-12 | 2001-04-03 | The Regents Of The University Of California | Methods of forming protein-linked lipidic microparticles, and compositions thereof |
| WO2002004638A1 (en) * | 2000-07-07 | 2002-01-17 | Adprotech Limited | Compounds targeted to cellular locations |
| US6468978B1 (en) | 1998-04-30 | 2002-10-22 | Curis, Inc. | Active hedgehog protein conjugate |
| WO2003006433A1 (en) * | 2001-07-13 | 2003-01-23 | Adprotech Limited | Protein modification reagents |
| WO2003027137A3 (en) * | 2001-09-27 | 2003-12-11 | Adprotech Ltd | Trimeric conjugates of peptidic derivative |
| WO2004022101A1 (en) * | 2002-09-05 | 2004-03-18 | Adprotech Limited | Modified therapeutic agents |
| US6994990B1 (en) | 1997-11-28 | 2006-02-07 | Curis, Inc. | Active modified hedgehog proteins |
| US7078380B2 (en) | 2000-11-03 | 2006-07-18 | Cambridge University Technical Services Limited | Antibacterial agents comprising conjugates of glycopeptides and peptidic membrane associating elements |
| US7655617B2 (en) | 1996-07-15 | 2010-02-02 | Adprotech Limited | Conjugates of soluble peptidic compounds with membrane-binding agents |
| US7795223B2 (en) | 2004-05-27 | 2010-09-14 | Novozymes Biopharma Au Ltd. | Treatment of inflammatory airway disease |
| WO2010118878A1 (en) * | 2009-04-16 | 2010-10-21 | Universitätsklinikum Heidelberg | Muscle function enhancing peptide |
| WO2011027175A1 (en) | 2009-09-04 | 2011-03-10 | King's College London | Antithrombotic compounds |
| EP2134373A4 (en) * | 2007-02-28 | 2014-04-02 | Yeda Res & Dev | CORE TARGETING SEQUENCES |
| US9695402B2 (en) | 2013-09-17 | 2017-07-04 | Yeda Research And Development Co. Ltd. | ERK-derived peptides and uses thereof |
| US10233235B2 (en) | 2008-09-22 | 2019-03-19 | The Regents Of The University Of Colorado, A Body Corporate | Modulating the alternative complement pathway |
| US10947271B2 (en) | 2014-02-10 | 2021-03-16 | The University Of Queensland | Antibacterial agents |
| WO2021058973A1 (en) | 2019-09-25 | 2021-04-01 | Prostate cancer research centre | Il-15 fusion peptides used to treat cancer |
| US11053305B2 (en) | 2018-12-11 | 2021-07-06 | Q32 Bio Inc. | Fusion protein constructs comprising anti-C3d antibody and CR1 polypeptide |
| WO2024201004A1 (en) | 2023-03-24 | 2024-10-03 | Prostate Cancer Research | Combinatorial il-15 therapy |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2854897B1 (fr) * | 2003-05-12 | 2007-05-04 | Sederma Sa | Compositions cosmetiques ou dermopharmaceutiques pour reduire les signes du vieillissement cutane. |
| US7858108B2 (en) * | 2003-10-21 | 2010-12-28 | Richard Nagler | Elutable surface coating |
| US8454963B2 (en) * | 2003-11-13 | 2013-06-04 | Musc Foundation For Research Development | Tissue targeted complement modulators |
| US8124097B2 (en) * | 2004-01-21 | 2012-02-28 | Case Western Reserve University | Hybrid and chimeric polypeptides that regulate activation of complement |
| EP1945658A4 (en) * | 2005-09-22 | 2012-05-30 | Yeda Res & Dev | DIASTEREOMERS PEPTIDES FOR MODULATING T-CELL IMMUNITY |
| WO2007103548A2 (en) | 2006-03-09 | 2007-09-13 | Inflazyme Pharmaceuticals Ltd. | Novel antibiotic compositions |
| CA2666843C (en) | 2006-10-20 | 2015-06-16 | Celldex Therapeutics, Inc. | Treatment of age-related macular degeneration and other diseases of the eye |
| MX2011008775A (es) | 2009-02-20 | 2011-10-24 | Ipsen Pharma Sas | Analogos de neuropeptidos y con substitucion de prolina en la posicion 34. |
| WO2011050334A1 (en) * | 2009-10-22 | 2011-04-28 | Yong Zhu | Compositions and methods for re-programming cells without genetic modification for treatment of obesity and related diseases |
| US9295713B2 (en) | 2010-09-15 | 2016-03-29 | Celldex Therapeutics, Inc. | Treatment of chronic nephropathies using soluble complement receptor type I (sCR1) |
| WO2012058479A2 (en) | 2010-10-27 | 2012-05-03 | Celldex Therapeutics, Inc. | Method of improving transplant function using soluble complement receptor type i (scr1) |
| BR112014013205A2 (pt) | 2011-12-01 | 2020-10-27 | Protevobio, Inc. | proteína de fusão, seu uso e seu método de produção, composição farmacêutica, ácido nucleico, e kit |
| US9987235B2 (en) | 2013-08-01 | 2018-06-05 | Nicholas L. Abbott | Methods and compositions for modifying mucous membranes |
| CN110240656A (zh) * | 2019-04-24 | 2019-09-17 | 中山大学附属第三医院 | 一种融合蛋白及其制备方法与应用 |
| CN110551177A (zh) * | 2019-08-29 | 2019-12-10 | 安徽瑞达健康产业有限公司 | 多肽、多肽衍生物、多肽-抗体复合物及制备、应用 |
| WO2024092160A2 (en) * | 2022-10-26 | 2024-05-02 | Flagship Pioneering Innovations Vii, Llc | Bifunctional proteases and uses thereof |
Family Cites Families (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4536391A (en) | 1982-11-17 | 1985-08-20 | Otsuka Pharmaceutical Co. | Process for preparing urokinase complex |
| DE3485094D1 (de) * | 1983-01-25 | 1991-10-31 | Ciba Geigy Ag | Neue peptidderivate. |
| GB8334498D0 (en) | 1983-12-24 | 1984-02-01 | Beecham Group Plc | Compounds |
| GB8400653D0 (en) | 1984-01-11 | 1984-02-15 | Beecham Group Plc | Conjugates |
| PT82326B (pt) | 1985-04-04 | 1988-10-14 | Beecham Group Plc | Processo para a preparacao de activador de plasminogenio de tipo tissular fibrinoliticamente activo |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| JP2573007B2 (ja) * | 1987-12-28 | 1997-01-16 | 株式会社成和化成 | 修飾された動物毛粉末 |
| US5256642A (en) | 1988-04-01 | 1993-10-26 | The Johns Hopkins University | Compositions of soluble complement receptor 1 (CR1) and a thrombolytic agent, and the methods of use thereof |
| US5582968A (en) * | 1990-02-16 | 1996-12-10 | United Biomedical, Inc. | Branched hybrid and cluster peptides effective in diagnosing and detecting non-A, non-B hepatitis |
| US6458360B1 (en) | 1990-04-25 | 2002-10-01 | The Johns Hopkins University | Soluble complement regulatory molecules |
| US5326700A (en) | 1990-11-06 | 1994-07-05 | Eli Lilly And Company | DNA sequences encoding t-PA derivatives with cleavable sites |
| US5580563A (en) * | 1992-05-01 | 1996-12-03 | Tam; James P. | Multiple antigen peptide system having adjuvant properties, vaccines prepared therefrom and methods of use thereof |
| US5833989A (en) * | 1992-06-24 | 1998-11-10 | Adprotech Plc | Soluble CR1 derivatives |
| US5456909A (en) | 1992-08-07 | 1995-10-10 | T Cell Sciences, Inc. | Glycoform fractions of recombinant soluble complement receptor 1 (sCR1) having extended half-lives in vivo |
| US5856300A (en) * | 1994-05-12 | 1999-01-05 | T Cell Sciences, Inc. | Compositions comprising complement related proteins and carbohydrates, and methods for producing and using said compositions |
| WO1994026786A1 (en) * | 1993-05-17 | 1994-11-24 | T Cell Sciences, Inc. | Compositions comprising complement related proteins and carbohydrates, and methods for producing and using said compositions |
| WO1995023512A1 (en) * | 1994-03-03 | 1995-09-08 | Alexion Pharmaceuticals, Inc. | Terminal complement inhibitor fusion genes and proteins |
| GB9614871D0 (en) * | 1996-07-15 | 1996-09-04 | Smithkline Beecham Plc | Compounds |
| US5776689A (en) | 1996-07-19 | 1998-07-07 | The Regents Of The University Of California | Protein recruitment system |
| WO2000020867A1 (en) | 1998-10-01 | 2000-04-13 | Alexey Vladimirovich Titievsky | A novel ret-independent signaling pathway for gdnf |
| GB0220936D0 (en) * | 2002-09-05 | 2002-10-23 | Adprotech Ltd | Modified therapeutic agents |
-
1996
- 1996-07-15 GB GBGB9614871.3A patent/GB9614871D0/en active Pending
-
1997
- 1997-07-08 JP JP50560898A patent/JP4177457B2/ja not_active Expired - Fee Related
- 1997-07-08 DK DK97933665T patent/DK0912730T3/da active
- 1997-07-08 WO PCT/EP1997/003715 patent/WO1998002454A2/en not_active Ceased
- 1997-07-08 ES ES97933665T patent/ES2321245T3/es not_active Expired - Lifetime
- 1997-07-08 CA CA002260288A patent/CA2260288A1/en not_active Abandoned
- 1997-07-08 AU AU36939/97A patent/AU732725B2/en not_active Ceased
- 1997-07-08 IL IL12803497A patent/IL128034A0/xx active IP Right Grant
- 1997-07-08 EP EP97933665A patent/EP0912730B1/en not_active Expired - Lifetime
- 1997-07-08 NZ NZ333722A patent/NZ333722A/xx unknown
- 1997-07-08 DE DE69739186T patent/DE69739186D1/de not_active Expired - Lifetime
- 1997-07-08 AT AT97933665T patent/ATE419345T1/de not_active IP Right Cessation
- 1997-07-14 AR ARP970103142A patent/AR007737A1/es unknown
- 1997-07-14 ZA ZA976216A patent/ZA976216B/xx unknown
- 1997-07-15 CO CO97039907A patent/CO4750673A1/es unknown
- 1997-07-18 TW TW086110188A patent/TW538048B/zh not_active IP Right Cessation
-
1999
- 1999-01-13 IL IL128034A patent/IL128034A/en not_active IP Right Cessation
-
2000
- 2000-07-07 US US09/612,314 patent/US6713606B1/en not_active Expired - Fee Related
-
2003
- 2003-12-23 US US10/742,887 patent/US7655617B2/en not_active Expired - Fee Related
-
2004
- 2004-12-30 IL IL16605104A patent/IL166051A0/xx unknown
-
2008
- 2008-08-15 US US12/192,560 patent/US20100286367A1/en not_active Abandoned
Cited By (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7655617B2 (en) | 1996-07-15 | 2010-02-02 | Adprotech Limited | Conjugates of soluble peptidic compounds with membrane-binding agents |
| US6803053B2 (en) | 1996-11-12 | 2004-10-12 | The Regents Of The University Of California | Lipidic microparticles linked to multiple proteins |
| US6210707B1 (en) | 1996-11-12 | 2001-04-03 | The Regents Of The University Of California | Methods of forming protein-linked lipidic microparticles, and compositions thereof |
| US7022336B2 (en) | 1996-11-12 | 2006-04-04 | The Regents Of The University Of California | Methods for attaching proteins to lipidic microparticles with high efficiency |
| WO1998039433A1 (en) * | 1997-03-05 | 1998-09-11 | Adprotech Plc | Complement receptor type 1 (cr1)-like sequences |
| US6833437B2 (en) | 1997-03-05 | 2004-12-21 | Adprotech Limited | Complement receptor type 1 (CR1)-like sequences |
| US6994990B1 (en) | 1997-11-28 | 2006-02-07 | Curis, Inc. | Active modified hedgehog proteins |
| US6468978B1 (en) | 1998-04-30 | 2002-10-22 | Curis, Inc. | Active hedgehog protein conjugate |
| US6818623B2 (en) | 1998-04-30 | 2004-11-16 | Curis, Inc. | Active hedgehog protein conjugate |
| US7153836B2 (en) | 1998-04-30 | 2006-12-26 | Curis, Inc. | Active hedgehog protein conjugate |
| WO2000004052A3 (en) * | 1998-07-16 | 2000-04-20 | Adprotech Plc | Soluble derivatives of anti-angiogenic peptides |
| AU773516B2 (en) * | 1999-03-10 | 2004-05-27 | Adprotech Limited | Organ transplant solutions containing conjugates of soluble peptidic compounds with membrane-binding |
| US7888318B1 (en) | 1999-03-10 | 2011-02-15 | Adprotech Limited | Method of preparing an organ by perfusion |
| WO2000053007A1 (en) * | 1999-03-10 | 2000-09-14 | Adprotech Limited | Organ transplant solutions containing conjugates of soluble peptidic compounds with membrane-binding |
| WO2002004638A1 (en) * | 2000-07-07 | 2002-01-17 | Adprotech Limited | Compounds targeted to cellular locations |
| US7078380B2 (en) | 2000-11-03 | 2006-07-18 | Cambridge University Technical Services Limited | Antibacterial agents comprising conjugates of glycopeptides and peptidic membrane associating elements |
| WO2003006433A1 (en) * | 2001-07-13 | 2003-01-23 | Adprotech Limited | Protein modification reagents |
| WO2003027137A3 (en) * | 2001-09-27 | 2003-12-11 | Adprotech Ltd | Trimeric conjugates of peptidic derivative |
| WO2004022101A1 (en) * | 2002-09-05 | 2004-03-18 | Adprotech Limited | Modified therapeutic agents |
| US8455447B2 (en) | 2002-09-05 | 2013-06-04 | Adprotech Limited | Modified therapeutic agents |
| US7795223B2 (en) | 2004-05-27 | 2010-09-14 | Novozymes Biopharma Au Ltd. | Treatment of inflammatory airway disease |
| US9315547B2 (en) | 2007-02-28 | 2016-04-19 | Yeda Research And Development Co. Ltd. | Nuclear targeting sequences |
| US10000771B2 (en) | 2007-02-28 | 2018-06-19 | Yeda Research And Development Co. Ltd. | Nuclear targeting sequences |
| EP2134373A4 (en) * | 2007-02-28 | 2014-04-02 | Yeda Res & Dev | CORE TARGETING SEQUENCES |
| US10233235B2 (en) | 2008-09-22 | 2019-03-19 | The Regents Of The University Of Colorado, A Body Corporate | Modulating the alternative complement pathway |
| US11407820B2 (en) | 2008-09-22 | 2022-08-09 | The Regents Of The University Of Colorado | Modulating the alternative complement pathway |
| US9428564B2 (en) | 2009-04-16 | 2016-08-30 | Universitatsklinikum Heidelberg | Muscle function enhancing peptide |
| WO2010118878A1 (en) * | 2009-04-16 | 2010-10-21 | Universitätsklinikum Heidelberg | Muscle function enhancing peptide |
| WO2011027175A1 (en) | 2009-09-04 | 2011-03-10 | King's College London | Antithrombotic compounds |
| US9255263B2 (en) | 2009-09-04 | 2016-02-09 | King's College London | Antithrombotic compounds |
| US9695402B2 (en) | 2013-09-17 | 2017-07-04 | Yeda Research And Development Co. Ltd. | ERK-derived peptides and uses thereof |
| US10240133B2 (en) | 2013-09-17 | 2019-03-26 | Yeda Research And Development Co. Ltd. | ERK-derived peptides and uses thereof |
| US10947271B2 (en) | 2014-02-10 | 2021-03-16 | The University Of Queensland | Antibacterial agents |
| US11053305B2 (en) | 2018-12-11 | 2021-07-06 | Q32 Bio Inc. | Fusion protein constructs comprising anti-C3d antibody and CR1 polypeptide |
| US11053306B2 (en) | 2018-12-11 | 2021-07-06 | Q32 Bio Inc. | Fusion protein constructs comprising anti-C3d antibody and factor H |
| US11879008B2 (en) | 2018-12-11 | 2024-01-23 | Q32 Bio Inc. | Methods of treating complement mediated diseases with fusion protein constructs comprising anti-C3d antibody and a complement modulator |
| WO2021058973A1 (en) | 2019-09-25 | 2021-04-01 | Prostate cancer research centre | Il-15 fusion peptides used to treat cancer |
| WO2024201004A1 (en) | 2023-03-24 | 2024-10-03 | Prostate Cancer Research | Combinatorial il-15 therapy |
Also Published As
| Publication number | Publication date |
|---|---|
| DK0912730T3 (da) | 2009-04-27 |
| GB9614871D0 (en) | 1996-09-04 |
| US7655617B2 (en) | 2010-02-02 |
| US20100286367A1 (en) | 2010-11-11 |
| IL128034A0 (en) | 1999-11-30 |
| JP2000515370A (ja) | 2000-11-21 |
| ATE419345T1 (de) | 2009-01-15 |
| AU3693997A (en) | 1998-02-09 |
| AR007737A1 (es) | 1999-11-10 |
| WO1998002454A3 (en) | 1998-04-02 |
| EP0912730B1 (en) | 2008-12-31 |
| NZ333722A (en) | 2000-09-29 |
| CA2260288A1 (en) | 1998-01-22 |
| US6713606B1 (en) | 2004-03-30 |
| AU732725B2 (en) | 2001-04-26 |
| TW538048B (en) | 2003-06-21 |
| IL166051A0 (en) | 2006-01-15 |
| CO4750673A1 (es) | 1999-03-31 |
| US20040266684A1 (en) | 2004-12-30 |
| JP4177457B2 (ja) | 2008-11-05 |
| DE69739186D1 (de) | 2009-02-12 |
| ES2321245T3 (es) | 2009-06-03 |
| IL128034A (en) | 2007-03-08 |
| ZA976216B (en) | 1999-04-14 |
| EP0912730A2 (en) | 1999-05-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU732725B2 (en) | Conjugates of soluble peptidic compounds with membrane-binding agents | |
| JP2001500365A (ja) | P53とmdm2の間の相互作用の阻害剤 | |
| JP2008231107A (ja) | 抗血管新生性ポリペプチド及び血管新生を抑制するための方法 | |
| US5849297A (en) | Modified human C3 proteins | |
| US5833989A (en) | Soluble CR1 derivatives | |
| CA2067224C (en) | Hirudin/polyalkylene glycol conjugates | |
| CA2333929A1 (en) | Soluble derivatives of anti-angiogenic peptides | |
| US5801037A (en) | Expression of signal-peptide-free staphylokinases | |
| CA2199719A1 (en) | Process for manufacture of a modified collagen-induced platelet aggregation inhibitor pallidipin | |
| US6833437B2 (en) | Complement receptor type 1 (CR1)-like sequences | |
| JP2002500042A (ja) | 非同一遺伝子ならびに改良された分子アジュバントにおけるそれらの適用 | |
| KR19990087571A (ko) | 하향 조절 내성 c3 컨버타제 | |
| AU724548B2 (en) | Fragments of CR1 and their use | |
| JPH01165379A (ja) | 新規化合物、その製法及びそれを含む医薬組成物 | |
| MXPA97001783A (es) | Proteinas c3 humanas modificadas |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE GH HU IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZW AM AZ BY KG KZ MD RU TJ TM |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH KE LS MW SD SZ UG ZW AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL |
|
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| ENP | Entry into the national phase |
Ref document number: 2260288 Country of ref document: CA Ref country code: CA Ref document number: 2260288 Kind code of ref document: A Format of ref document f/p: F |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 333722 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1997933665 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 09214913 Country of ref document: US |
|
| WWP | Wipo information: published in national office |
Ref document number: 1997933665 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |