US20210095001A1 - Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells - Google Patents

Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells Download PDF

Info

Publication number
US20210095001A1
US20210095001A1 US17/051,248 US201917051248A US2021095001A1 US 20210095001 A1 US20210095001 A1 US 20210095001A1 US 201917051248 A US201917051248 A US 201917051248A US 2021095001 A1 US2021095001 A1 US 2021095001A1
Authority
US
United States
Prior art keywords
domain
seq
caar
cell
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US17/051,248
Other languages
English (en)
Inventor
Saar Gill
Jonathan Hogan
Aimee S. Payne
Baomei Wang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Pennsylvania Penn
Original Assignee
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Pennsylvania Penn filed Critical University of Pennsylvania Penn
Priority to US17/051,248 priority Critical patent/US20210095001A1/en
Publication of US20210095001A1 publication Critical patent/US20210095001A1/en
Assigned to THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA reassignment THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: GILL, Saar, PAYNE, Aimee, HOGAN, Jonathan, WANG, Baomei
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0008Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/7056Lectin superfamily, e.g. CD23, CD72
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • Membranous nephropathy is among the most common primary causes of nephrotic syndrome in adults (up to one-third of cases). About 15-25% of membranous nephropathy cases are secondary membranous nephropathy, caused by drugs, infections, tumors, or immune diseases. The remaining 75-85% of membranous nephropathy cases are idiopathic, also called primary membranous nephropathy. MN is caused by immune complex formation in the glomerulus. The immune complexes are formed by binding of antibodies to antigens on the podocyte. The immune complex serves as an activator that triggers complement-mediated lysis of glomerular epithelial cells and the release of proteases and oxidants damaging capillary walls. Up to 40% of patients with primary membranous nephropathy who do not receive immunosuppressive treatment develop end-stage renal disease requiring dialysis or kidney transplantation.
  • the M-type phospholipase A2 receptor (PLA2R) has been described as a major autoantigen in primary membranous nephropathy.
  • Autoantibodies to PLA2R are present in 70-80% of cases of primary membranous nephropathy, and can be used for the diagnosis and monitoring of treatment of primary membranous nephropathy both in the native kidneys and after kidney transplant.
  • the invention includes a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the CAAR comprises a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
  • CAAR chimeric autoantibody receptor
  • PLA2R phospholipase A2 receptor
  • the invention includes a vector comprising any one of the polynucleotides disclosed herein.
  • the invention includes a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof.
  • CAAR chimeric autoantibody receptor
  • PHA2R phospholipase A2 receptor
  • the invention includes a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
  • CAAR chimeric autoantibody receptor
  • Another aspect of the invention includes a genetically modified cell comprising any one of the CAARs disclosed herein.
  • Yet another aspect of the invention includes genetically modified cell comprising: (a) a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) DAP12.
  • CAAR chimeric autoantibody receptor
  • PLA2R phospholipase A2 receptor
  • KIR killer immunoglobulin-like receptor
  • Still another aspect of the invention includes a pharmaceutical composition comprising any one of the polynucleotides disclosed herein, any one of the CAARs disclosed herein or any one of the cells disclosed herein, and a pharmaceutically acceptable excipient.
  • the invention includes a method for treating an autoantibody-mediated kidney disease in a subject.
  • the method comprises administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby treating the autoantibody mediated kidney disease in the subject.
  • CAAR chimeric autoantibody receptor
  • the invention includes a method for preventing or reducing glomerulus damage in a subject at risk of or suffering from an autoantibody-mediated kidney disease, the method comprising: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby preventing or reducing glomerulus damage in the subject.
  • CAAR chimeric autoantibody receptor
  • the invention includes a method for treating an autoantibody-mediated kidney disease in a subject.
  • the method comprises administering to the subject an effective amount of a genetically modified T cell comprising: (a) a polynucleotide encoding a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) a polynucleotide encoding DAP12, thereby treating the autoantibody-mediated kidney disease in the subject.
  • CAAR chimeric autoantibody receptor
  • PDA2R phospholipase A2 receptor
  • KIR killer immunoglobulin-like receptor
  • the invention includes a method for preventing or reducing glomerulus damage in a subject at risk of or suffering from an autoantibody-mediated kidney disease
  • the method comprises administering to the subject an effective amount of a genetically modified T cell comprising: (a) a polynucleotide encoding a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) a polynucleotide encoding DAP12, thereby preventing or reducing glomerulus damage in the subject.
  • CAAR chimeric autoantibody receptor
  • PDA2R phospholipase A2 receptor
  • KIR killer immunoglobulin-like receptor
  • the PLA2R autoantigen or fragment thereof is selected from the group consisting of: (a) an extracellular domain comprising a CysR or ricin B type lectin domain, a fibronectin type II domain, a C-type lectin domain 1 and a C-type lectin domain 2; and (b) an extracellular domain comprising a CysR or ricin B type lectin domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2 and a C-type lectin domain 3.
  • the PLA2R autoantigen or fragment thereof is selected from the group consisting of: (a) an extracellular domain comprising a cysteine rich domain, (b) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, and a C-type lectin domain 1, (c) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3, (d) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, and a C-type lectin domain 7, (e) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 7, or (e) an extra
  • the PLA2R extracellular domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 8 or SEQ ID NO: 15 or SEQ ID NO: 47 or SEQ ID NO: 60 or SEQ ID NO: 50 or SEQ ID NO: 62 or SEQ ID NO: 52 or SEQ ID NO: 54 or SEQ ID NO: 56 or SEQ ID NO: 58.
  • the transmembrane domain comprises a CD8 alpha chain transmembrane domain.
  • the CD8 alpha chain transmembrane domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 20.
  • the CD8 alpha chain transmembrane domain comprises the amino acid sequence of SEQ ID NO: 19.
  • the CAAR further comprises a hinge domain.
  • the hinge domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 10 or SEQ ID NO: 42 or SEQ ID NO: 64.
  • the hinge domain comprises the amino acid sequence of SEQ ID NO: SEQ ID NO: 43 or SEQ ID NO: 44.
  • the CAAR further comprises a GS linker.
  • the GS linker is encoded by a nucleic acid sequence comprising SEQ ID NO: 68. In certain embodiments, the GS linker comprises SEQ ID NO: 69.
  • the intracellular domain of a costimulatory molecule comprises 4-1BB.
  • the 4-1BB intracellular domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 22 or SEQ ID NO: 66.
  • the 4-1BB intracellular domain comprises the amino acid sequence of SEQ ID NO: 21.
  • the signaling domain comprises a CD3 zeta signaling domain.
  • the CD3 zeta signaling domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 24 or SEQ ID NO: 72.
  • the CD3 zeta signaling domain comprises an amino acid sequence of SEQ ID NO: 23 or SEQ ID NO: 45.
  • the CAAR is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 25, 27, 29, 31, 33, 35, 37, and 39. In certain embodiments, the CAAR comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 26, 28, 30, 32, 34, 36, 38, and 40.
  • the CAAR comprises a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain.
  • PHA2R phospholipase A2 receptor
  • KIR killer immunoglobulin-like receptor
  • the vector is a lentiviral vector. In certain embodiments, the vector is a RNA vector.
  • the cell expresses the CAAR and has high affinity to autoantibody-based BCRs on B cells. In certain embodiments, the cell expresses the CAAR and induces killing of B cells expressing autoantibodies. In certain embodiments, the cell expresses the CAAR and has limited toxicity toward healthy cells.
  • the cell is selected from the group consisting of a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, gamma delta T cell, a natural killer cell, a cytokine induced killer cell, a cell line thereof, a T memory stem cell, a T cell derived from a pluripotent stem and other effector cell.
  • the autoantibody mediated kidney disease is selected from the group consisting of a glomerular disease and a primary membranous nephropathy.
  • the subject is a human.
  • the modified T cell targets B cells.
  • the KIR is KIRS2 or KIR2DS2.
  • the vector comprises an inducible promoter operably linked to the polynucleotide encoding the CAAR.
  • the cell comprises a polynucleotide encoding the CAAR operably linked to an inducible promoter.
  • FIG. 1 is an illustration showing a schematic of the native PLA2R molecule.
  • the N terminal cysteine-rich (CysR) domain (Ricin B type lectin domain) is the immunodominant epitope that is recognized by patient serum antibodies. In non-reducing conditions, serum antibody recognition has been reported to be dependent on the first 3 C-type lectin domains (CTLD). In addition to the cysteine-rich domain, serum antibody immunoreactivity to the C-type lectin domains 1 and 7 has also been reported.
  • C-type lectin domains 1 and 7 has also been reported.
  • a commercial Novus monoclonal antibody (mAb) and polyclonal Sigma antibody bind to the CTLD2 domain.
  • FIGS. 2A-2G are a series of schematic diagrams illustrating the various PLA2R CAAR constructs described in this invention.
  • ECD extracellular domain
  • TMD transmembrane domain
  • BBZ cytoplasmic tandem 41BB (CD137) and CD3-zeta signaling domain
  • CysR cysteine rich domain
  • FNII fibronectin type II domain
  • CTLD C-type lectin domain.
  • All constructs use a CD8 transmembrane domain and BBZ cytoplasmic domain and differ in their extracellular composition as follows:
  • FIG. 2A depicts construct 4025.C (or construct C), whose extracellular domain consists of the PLA2R CysR domain, followed by a CD8 hinge domain.
  • FIG. 2B depicts construct 4026.CF1 (or construct CF1), consisting of the CysR, FNII, and CTLD1 domains followed by a CD8 hinge domain.
  • FIG. 2C depicts construct 4027.CF12, consisting of the CysR, FNII, CTLD1, and CTLD2 domains, followed by a CD8 hinge domain.
  • FIG. 2D depicts construct 4028.CF123 (or construct CF123), consisting of the CysR, FNII, CTLD1, CTLD2, and CTLD3 domains, followed by either a CD8 hinge (4028.CF123) or GS linker (CF123).
  • FIG. 1 depicts construct 4026.CF1 (or construct CF1), consisting of the CysR, FNII, and CTLD1 domains followed by a CD8 hinge domain.
  • FIG. 2C depicts construct 4027.CF12, consisting of the CysR, FNII, CTLD1, and CTLD2 domains, followed by a CD8 hinge domain
  • FIG. 2E depicts construct CF1237, consisting of the CysR, FNII, CTLD1, CTLD2, CTLD3, and CTLD7 domains followed by a GS linker.
  • FIG. 2F depicts construct CF17, consisting of the CysR, FNII, CTLD1, and CTLD7 domains, followed by a GS linker.
  • FIG. 2G depicts construct C17, consisting of the CysR, CTLD1, and CTLD7 domains, followed by a GS linker.
  • FIG. 3A is an illustration showing a portion of the plasmid map comprising the 4028.CF123 CAAR.
  • FIG. 3B is a table distinguishing the compositions of the CAAR constructs described in this invention.
  • FIG. 4 is a series of flow cytometry plots demonstrating surface expression of a subset of PLA2R CAARs (4027.CF12 and 4028.CF123) on Jurkat NFAT-GFP cells.
  • the expression of PLA2R CAAR by Jurkat NFAT-GFP cells transduced with different PLA2R lentiviral constructs was measured (MOI 5:1, 48 h) using a commercial Novus monoclonal antibody (mAb) specific for the PLA2R CTLD2 domain.
  • FIG. 5 is a series of flow cytometry plots showing the negative and positive controls for PLA2R CAAR T cell activation using an isotype control (top, negative control) or PMA+ionomycin (bottom, positive control).
  • FIG. 6 is a series of flow cytometry plots showing the activation of 4027.CF12 and 4028.CF123 PLA2R CAAR T cells by plate-bound monoclonal or polyclonal antibodies specific for the PLA2R CTLD2 domain, measured as GFP expression by Jurkat NFAT-GFP cells (6 h activation). No evidence of T cell activation is seen in construct 4025.C, as expected as this construct does not contain the CTLD2 domain, and untransduced cells upon exposure to the anti-PLA2R monoclonal antibody (mAb) or the polyclonal anti-PLA2R antibody (Ab). Specific T cell activation in response to cross-linking of the PLA2R CAAR by the monoclonal anti-PLA2R mAb but not the polyclonal anti-PLA2R Ab is observed.
  • mAb monoclonal antibody
  • Ab polyclonal anti-PLA2R antibody
  • FIGS. 7A-7B are a series of plots illustrating that PLA2R MN patient IgG detects PLA2R CAAR expression on transduced Jurkat NFAT-GFP and primary human T cells.
  • Flow cytometry plots demonstrate robust PLA2R CAAR surface expression on Jurkat NFAT-GFP cells ( FIG. 7A ) and primary human T cells ( FIG. 7B ) for all constructs evaluated (4025.C, 4026.CF1, 4027.CF12, 4028.CF123, C, CF1, CF123, CF1237, CF17, C17).
  • PLA2R CAAR The expression of PLA2R CAAR by Jurkat NFAT-GFP and primary human T cells transduced with different PLA2R lentiviral constructs (72 h) was detected by incubation with MN patient IgG followed by APC-conjugated anti-human IgG.
  • FIG. 8 is a series of plots illustrating that plate-bound MN patient IgG activates PLA2R CAAR transduced Jurkat-NFAT-GFP cells.
  • Flow cytometry plots show the activation of PLA2R CAAR T cells by MN patient IgG measured as GFP expression by Jurkat NFAT-GFP cells (6 h activation). All evaluated PLA2R CAAR T cells (4025.C, 4026.CF1, 4027.CF12, 4028.CF123, C, CF1, CF123, CF1237, CF17, C17) transduced signal after cross-linking by plate-bound anti-PLA2R IgG.
  • FIG. 9 is a set of graphs illustrating that plate-bound MN patient IgG stimulates IFN- ⁇ secretion from PLA2R CAAR-transduced primary human T cells.
  • 5 ⁇ 10 4 primary human T cells were cultured for 24 h in a 96-well plate coated with 10 ⁇ g/ml of either MN patient IgG or control human IgG. Culture supernatants were then harvested for detection of IFN- ⁇ by ELISA. IFN ⁇ production was detectable in all culture supernatants and was elevated relative to untransduced T cells, or PLA2R CAAR T cells stimulated with control (Ctrl) human IgG.
  • the invention includes a chimeric autoantibody receptor (CAAR) specific for anti-phospholipase A2 receptor (PLA2R) B cell receptor (BCR), compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
  • CAAR chimeric autoantibody receptor
  • PHA2R anti-phospholipase A2 receptor
  • BCR B cell receptor
  • compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
  • the invention also includes methods of making a genetically modified cell, e.g., a genetically modified T cell, expressing a PLA2R-CAAR wherein the expressed CAAR comprises a PLA2R extracellular domain.
  • the present invention also relates generally to the use of cells, e.g., T cells, engineered to express a CAAR to treat an autoantibody-mediated kidney disease associated with targeting of self-antigens (e.g. PLA2R).
  • the cells e.g., T cells expressing the CAAR of the invention specifically bind to and kill anti-PLA2R BCR-expressing cells, but do not bind to and kill normal BCR-expressing cells.
  • an element means one element or more than one element.
  • antibody refers to an immunoglobulin molecule that binds with an antigen.
  • Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules.
  • the antibody in the present invention may exist in a variety of forms where the antibody is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv) and a humanized antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
  • sdAb single domain antibody fragment
  • scFv single chain antibody
  • humanized antibody Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y
  • the binding molecule may have an affinity for the target molecule stronger than 100 nM, 50 nM, 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM, e.g., as determined by surface plasmon resonance.
  • antigen or “Ag,” as used herein, is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically competent cells, or both.
  • antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an “antigen” as that term is used herein.
  • an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
  • autoantigen is meant an endogenous antigen that stimulates production of an autoimmune response, such as production of autoantibodies.
  • Autoantigen also includes a self-antigen or antigen from a normal tissue that is the target of a cell-mediated or an antibody-mediated immune response that may result in the development of an autoimmune disease.
  • autoantigens include, but are not limited to, PLA2R, and fragments thereof.
  • limited toxicity refers to the peptides, polynucleotides, cells and/or antibodies of the invention manifesting a lack of substantially negative biological effects, anti-tumor effects, or substantially negative physiological symptoms toward a healthy cell, non-tumor cell, non-diseased cell, non-target cell or population of such cells either in vitro or in vivo.
  • Autoantibody refers to an antibody that is specific for an autoantigen.
  • autoimmune disease is defined as a disorder or condition that results from an antibody-mediated autoimmune response against autoantigens.
  • An autoimmune disease results in the production of autoantibodies that are inappropriately produced and/or excessively produced to a self-antigen or autoantigen.
  • autologous is meant to refer to any material derived from the same individual to which it is later to be re-introduced into the individual.
  • Allogeneic refers to any material derived from a different animal of the same species.
  • Xenogeneic refers to any material derived from an animal of a different species.
  • CAAR Chimeric autoantibody receptor
  • the CAAR includes an antigen or fragment thereof that is specific for an autoantibody and/or BCR, e.g., a pathogenic autoantibody and/or BCR.
  • the CAAR optionally also includes a transmembrane domain, an intracellular domain and/or a signaling domain.
  • conservative sequence modifications is intended to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • one or more amino acid residues within the extracellular regions of the CAAR of the invention can be replaced with other amino acid residues having a similar side chain or charge and the altered CAAR can be tested for the ability to bind autoantibodies using the functional assays described herein.
  • Co-stimulatory ligand includes a molecule on an antigen presenting cell (e.g., an aAPC, dendritic cell, B cell, and the like) that specifically binds a cognate co-stimulatory molecule on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
  • an antigen presenting cell e.g., an aAPC, dendritic cell, B cell, and the like
  • a “co-stimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and a Toll ligand receptor.
  • Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • Effective amount or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result. Such results may include, but are not limited to, the inhibition of virus infection as determined by any means suitable in the art.
  • effector function refers to a specialized function of a cell.
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • expression is defined as the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
  • “Expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
  • An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
  • Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes), retrotransposons (e.g. piggyback, sleeping beauty), and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
  • “Homologous,” as used herein, refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position.
  • the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
  • Identity refers to the subunit sequence identity between two polymeric molecules particularly between two amino acid molecules, such as, between two polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage.
  • the identity between two amino acid sequences is a direct function of the number of matching or identical positions; e.g., if half (e.g., five positions in a polymer ten amino acids in length) of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions (e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical.
  • an “instructional material” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the invention.
  • the instructional material of the kit of the invention may, for example, be affixed to a container which contains the nucleic acid, peptide, and/or composition of the invention or be shipped together with a container which contains the nucleic acid, peptide, and/or composition.
  • the instructional material may be shipped separately from the container with the intention that the instructional material and the compound be used cooperatively by the recipient.
  • “Intracellular domain” refers to a portion or region of a molecule that resides inside a cell.
  • intracellular signaling domain is meant to include any full-length or truncated portion of the intracellular domain sufficient to transduce the effector function signal.
  • isolated means altered or removed from the natural state.
  • a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • A refers to adenosine
  • C refers to cytosine
  • G refers to guanosine
  • T refers to thymidine
  • U refers to uridine.
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • a “lentivirus,” as used herein, refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses. Vectors derived from lentiviruses offer the means to achieve significant levels of gene transfer in vivo.
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
  • parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
  • plasma cells refer to a type of white blood cells which can produce and secrete antibodies. Plasma cells are also referred to as plasmocytes, plasmacytes, or effector B cells. In some embodiments, these cells comprise B cell precursors capable of B-cell differentiation or B cells in the early stages of B cell differentiation, expressing a ⁇ chain on the cell surface as antigen receptor; B cells in which the transcription process has changed and IgM production has changed from membrane-type IgMs to secreted-type IgMs; mature B cells that have completed class-switching and secrete IgGs, IgAs, and IgMs; and B cells in the final stages of differentiation.
  • PLA2R M-type phospholipase A2 receptor
  • MN primary membranous nephropathy
  • the anti-PLA2R autoantibodies are predominantly of the IgG4 subclass but subclasses IgG1, IgG2, and IgG3 are also represented. Genetic variants of PLA2R were also shown to be associated with MN (Stanescu et al. 2011 N Engl J Med; 364(7):616-26).
  • a PLA2R fragment refers to a shortened or truncated PLA2R protein.
  • the polypeptide can have N-terminus or C-terminus truncations and/or also internal deletions.
  • fragments are fragments comprising the C-type lectin domains (“CTLD”) of PLA2R.
  • CTL C-type lectin domains
  • a PLA2R fragment includes the external domain of PLA2R, which is the amino acid residues 21-1397 of the human PLA2R (UniProtKB, Q13018) or any shorter portion of the amino acid residues 21-1397.
  • nucleotide is defined as a chain of nucleotides.
  • nucleic acids are polymers of nucleotides.
  • nucleic acids and polynucleotides, as used herein, are interchangeable.
  • nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric “nucleotides.” The monomeric nucleotides can be hydrolyzed into nucleosides.
  • polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
  • a nucleic acid sequence is considered to have at least 95%, 96%, 97%, 98%, or 99% identity or homology to any nucleic acid sequence disclosed herein.
  • peptide As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
  • the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
  • Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
  • the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
  • an amino acid sequence is considered to have at 95%, 96%, 97%, 98%, or 99% identity or homology to any amino acid sequence described herein.
  • proinflammatory cytokine refers to a cytokine or factor that promotes inflammation or inflammatory responses.
  • proinflammatory cytokines include, but are not limited to, chemokines (CCL, CXCL, CX3CL, XCL), interleukins (such as, IL-1, IL-2, IL-3, IL-5, IL-6, IL-7, IL-9, IL10 and IL-15), interferons (IFN ⁇ ), and tumor necrosis factors (TNF ⁇ and TNF ⁇ ).
  • promoter is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • promoter/regulatory sequence means a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence.
  • this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • a “constitutive” promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
  • an “inducible” promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
  • tissue-specific promoter is a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
  • a “signal transduction pathway” refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
  • the phrase “cell surface receptor” includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
  • Signal domain refers to the portion or region of a molecule that recruits and interacts with specific proteins in response to an activating signal.
  • subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals).
  • substantially purified cell is a cell that is essentially free of other cell types.
  • a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
  • a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cells that have been separated from the cells with which they are naturally associated in their natural state.
  • the cells are cultured in vitro. In other embodiments, the cells are not cultured in vitro.
  • terapéutica means a treatment and/or prophylaxis.
  • a therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
  • transfected or “transformed” or “transduced,” as used herein, refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • Transmembrane domain refers to a portion or a region of a molecule that spans a lipid bilayer membrane.
  • under transcriptional control means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide.
  • a “vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses.
  • the term “vector” includes an autonomously replicating plasmid or a virus.
  • the term should also be construed to include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like.
  • viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
  • telomere binding partner e.g., a stimulatory and/or costimulatory molecule present on a T cell
  • stimulation is meant a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
  • a stimulatory molecule e.g., a TCR/CD3 complex
  • Stimulation can mediate altered expression of certain molecules, such as downregulation of TGF- ⁇ , and/or reorganization of cytoskeletal structures, and the like.
  • a “stimulatory molecule,” as the term is used herein, means a molecule on a T cell that specifically binds with a cognate stimulatory ligand present on an antigen presenting cell.
  • a “stimulatory ligand,” as used herein, means a ligand that when present on an antigen presenting cell (e.g., an aAPC, a dendritic cell, a B-cell, and the like) can specifically bind with a cognate binding partner (referred to herein as a “stimulatory molecule”) on a T cell, thereby mediating a primary response by the T cell, including, but not limited to, activation, initiation of an immune response, proliferation, and the like.
  • an antigen presenting cell e.g., an aAPC, a dendritic cell, a B-cell, and the like
  • a cognate binding partner referred to herein as a “stimulatory molecule”
  • Stimulatory ligands are well-known in the art and encompass, inter alia, an MHC Class I molecule loaded with a peptide, an anti-CD3 antibody, a superagonist anti-CD28 antibody, and a superagonist anti-CD2 antibody.
  • ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
  • CAAR Chimeric Autoantibody Receptor
  • the present invention is partly based on the discovery that chimeric autoantibody receptors can be used to target B cells that express autoantibody-based B cell receptors, which after activation and autoantibody secretion, may cause an autoantibody-mediated kidney disease.
  • the invention includes a chimeric autoantibody receptor (CAAR) specific for anti-phospholipase A2 receptor (PLA2R) B cell receptor (BCR), compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
  • CAAR chimeric autoantibody receptor
  • PLA2R anti-phospholipase A2 receptor
  • BCR B cell receptor
  • compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
  • the present invention includes a technology for treating an autoantibody-mediated kidney disease.
  • technologies that target B cells that ultimately produce the autoantibodies and display the autoantibodies on their cell surfaces mark these B cells as disease-specific targets for therapeutic intervention.
  • the invention therefore includes a method for efficiently targeting and killing the pathogenic B cells in autoantibody-mediated kidney diseases by targeting the disease-causing B cells using an antigen-specific (e.g., PLA2R) chimeric autoantibody receptor (or CAAR).
  • an antigen-specific e.g., PLA2R
  • CAAR chimeric autoantibody receptor
  • the invention includes a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
  • CAAR chimeric autoantibody receptor
  • PLA2R phospholipase A2 receptor
  • the CAAR of the invention comprises an autoantibody binding domain otherwise referred to as an autoantigen or a fragment thereof.
  • an autoantigen for use in the present invention depends upon the type of autoantibody or BCR being targeted (e.g. anti-PLA2R).
  • the autoantigen may be chosen because it recognizes a BCR or autoantibody on a target cell, such as a BCR-expressing B cell, associated with a particular autoantibody mediated kidney disease state, e.g. a glomerular disease and an primary membranous nephropathy.
  • the autoantibody binding domain is derived from the same species in which the CAAR will ultimately be used.
  • the autoantibody binding domain of the CAAR comprises a human autoantigen (or fragment thereof) that binds a human BCR or autoantibody.
  • a genetically engineered chimeric autoantibody receptor includes PLA2R or fragments thereof, which binds an anti-PLA2R BCR, e.g., anti-PLA2R BCR on a B cell in a subject.
  • the CAAR comprises an extracellular domain of PLA2R.
  • the extracellular domain of PLA2R comprises an N-terminal cysteine rich domain (Ricin B type lectin domain), a Fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, a C-type lectin domain 7, or a combination of any of the foregoing.
  • the extracellular domain of PLA2R comprises the immunodominant epitope, N-terminal cysteine rich (CysR) domain (Ricin B type lectin domain), encoded by SEQ ID NO: 1, a Fibronectin type II domain encoded by SEQ ID NO: 3, a C-type lectin domain 1 encoded by SEQ ID NO: 5, and a C-type lectin domain 2 encoded by SEQ ID NO: 7.
  • This extracellular domain of PLA2R is the extracellular domain of the construct designated as construct 4027.CF12 herein and is encoded by SEQ ID NO: 8, wherein the linker between the immunodominant epitope, N-terminal cysteine rich domain and the Fibronectin type II domain is encoded by SEQ ID NO: 2 and the linker between the Fibronectin type II domain and the C-type lectin domain 1 is encoded by SEQ ID NO: 4, and the linker between the C-type lectin domain 1 and the C-type lectin domain 2 is encoded by SEQ ID NO: 6.
  • the extracellular domain of PLA2R comprises the extracellular domain of construct 4027.CF12 and additionally a C-type lectin domain 3 encoded by SEQ ID NO: 14.
  • This latter extracellular domain of PLA2R is the extracellular domain of the construct designated as construct 4028.CF123 herein and is encoded by SEQ ID NO: 15, wherein the linkers between the immunodominant epitope, N-terminal cysteine rich domain, the Fibronectin type II, the C-type lectin domain 1 and the C-type lectin domain 2 are the same as those listed above herein for construct 4027.CF12 (SEQ ID NOS: 2, 4 and 6) and further wherein the linker between the C-type lectin domain 2 and the C-type lectin domain 3 is encoded by SEQ ID NO: 13.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct C, comprising a cysteine rich domain.
  • the cysteine rich domain comprises SEQ ID NO: 49, and may be encoded by SEQ ID NO: 47.
  • the cysteine rich domain comprises SEQ ID NO: 1.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF1, comprising a cysteine rich domain, a fibronectin type II domain, and a C-type lectin domain 1.
  • the extracellular domain comprises SEQ ID NO: 51, and may be encoded by SEQ ID NO: 50.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF123, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3.
  • the extracellular domain comprises SEQ ID NO: 53, and may be encoded by SEQ ID NO: 52.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF1237, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, and a C-type lectin domain 7.
  • the extracellular domain comprises SEQ ID NO: 55, and may be encoded by SEQ ID NO: 54.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF17, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 7.
  • the extracellular domain comprises SEQ ID NO: 57, and may be encoded by SEQ ID NO: 56.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct C17, comprising a cysteine rich domain, a C-type lectin domain 1, and a C-type lectin domain 7.
  • the extracellular domain comprises SEQ ID NO: 59, and may be encoded by SEQ ID NO: 58.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4025.C, comprising a cysteine rich domain.
  • the extracellular domain comprises SEQ ID NO: 61, and may be encoded by SEQ ID NO: 60.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4026.CF1, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1.
  • the extracellular domain comprises SEQ ID NO: 40, and may be encoded by SEQ ID NO: 39.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4027.CF12, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 2.
  • the extracellular domain comprises SEQ ID NO: 70, and may be encoded by SEQ ID NO: 8.
  • the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4028.CF123, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3.
  • the extracellular domain comprises SEQ ID NO: 71, and may be encoded by SEQ ID NO: 15.
  • the autoantigen or a fragment thereof comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the amino acid sequences set forth in SEQ ID NO: 49, 51, 53, 55, 57, 59, 61, 63, 70 or 71.
  • the autoantigen or a fragment thereof is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least or 99% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 8, 15, 47, 50, 52, 54, 56, 58, 60, or 62.
  • the PLA2R CAAR comprises a transmembrane domain that is fused to the extracellular domain of the PLA2R CAAR.
  • the PLA2R CAAR comprises a transmembrane domain that naturally is associated with one of the domains in the PLA2R CAAR.
  • the transmembrane domain is selected or modified by amino acid substitution to avoid binding to the transmembrane domains of the same or different surface membrane proteins in order to minimize interactions with other members of the receptor complex.
  • the transmembrane domain may be derived either from a natural or from a synthetic source. When the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one embodiment, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In one aspect a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the PLA2R CAAR.
  • a glycine-serine doublet provides a particularly suitable linker.
  • spacer domains before the transmembrane domain can be employed as well including a hinge (e.g. a CD8 or human Ig (immunoglobulin) hinge), or a glycine-serine (GS) linker.
  • a hinge e.g. a CD8 or human Ig (immunoglobulin) hinge
  • GS glycine-serine
  • hinge and/or transmembrane domain examples include, but are not limited to, a hinge and/or transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, killer immunoglobulin-like receptor (KIR), OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R ⁇ , ITGA1, VLA1, CD49a, ITGA4, IA4, CD49 D, ITGA6, VLA-6, CD49f, ITGAD, CD11d,
  • the PLA2R CAAR comprises a transmembrane domain, such as, but not limited to, a CD8 alpha transmembrane domain.
  • the CD8 alpha transmembrane domain comprises the amino acid sequence IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 19).
  • the CD8 alpha transmembrane domain is encoded by the nucleotide sequence
  • the transmembrane domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 19, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
  • the PLA2R CAAR comprises a hinge domain such as, but not limited to, a CD8 alpha hinge domain.
  • the hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 43).
  • the hinge domain comprises the amino acid sequence FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 44).
  • the hinge domain is encoded by the nucleotide sequence of SEQ ID NO: 10.
  • the hinge domain is encoded by the nucleotide sequence ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGC AGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGT GCACACGAGGGGGTGGACTTCGCCTGTGAT (SEQ ID NO: 42).
  • the hinge domain is encoded by the nucleotide sequence TTCGTGCCGGTCTTCCTGCCAGCGAAGCCAACCACGACGCCAGCACCGCGAC CACCAACACCTGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGA GGCGTGCAGACCAGCAGCGGGGGGCAGTGCACACGAGGGGGTGGACTT CGCCTGTGAT (SEQ ID NO: 64).
  • the PLA2R CAAR comprises a transmembrane domain and a hinge domain.
  • the hinge domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO:43 or SEQ ID NO: 44, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at
  • the PLA2R CAAR comprises a glycine serine (GS) linker.
  • the PLA2R CAAR comprises a GS linker and a transmembrane domain.
  • the GS linker is encoded by the nucleotide sequence: GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 68).
  • the GS linker comprises the amino acid sequence: GGGGSGGGGS (SEQ ID NO: 69).
  • the PLA2R CAAR comprises an intracellular domain of a costimulatory molecule.
  • the intracellular domain of a costimulatory molecule of the PLA2R CAAR of the invention is a cytoplasmic domain responsible for the activation of at least one of the normal effector functions of the immune cell in which the PLA2R CAAR has been placed in.
  • Effector function of a T cell may be cytolytic activity or helper activity including the secretion of cytokines.
  • intracellular domain of a costimulatory molecule refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While the entire intracellular domain of a costimulatory molecule can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular domain of a costimulatory molecule is used, such truncated portion may be used in place of the intact domain as long as it transduces the effector function signal.
  • the intracellular domain of a costimulatory molecule refers to a portion of the CAAR comprising the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
  • Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, CD5, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD127, CD160, CD19, CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7
  • the nucleic acid sequence of the intracellular domain of a costimulatory molecule encodes an amino acid sequence comprising costimulatory molecule 4-1BB (also known and referred to as CD137) intracellular domain:
  • nucleic acid sequence encoding the 4-1BB intracellular domain comprises: AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGAC CAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGA AGAAGAAGGAGGATGTGAACTG (SEQ ID NO: 22).
  • nucleic acid sequence encoding the 4-1BB intracellular domain comprises: SEQ ID NO: 66.
  • the human intracellular 4-1BB domain provides co-stimulatory intracellular signaling upon binding to the extracellular autoantigen, such as PLA2R, or a fragment thereof, without the need of its original ligand.
  • the intracellular domain of a costimulatory molecule comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 21, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%
  • T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
  • the PLA2R CAAR comprises a signaling domain.
  • Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory manner or in an inhibitory manner.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing primary signaling sequences examples include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that signaling molecule in the CAAR of the invention comprises a signaling domain derived from CD3-zeta.
  • the signaling domain of the CAAR can be designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAAR of the invention.
  • the signaling domain of the CAAR can comprise a CD3 zeta chain portion and a costimulatory signaling domain.
  • the PLA2R CAAR comprises a CD3-zeta signaling domain by itself or in combination with any other desired cytoplasmic domain(s) useful in the context of the PLA2R CAAR of the invention.
  • the PLA2R CAAR can comprise a CD3 zeta chain portion and an intracellular domain of a costimulatory molecule.
  • the CD3 zeta chain portion is a human T-cell surface glycoprotein CD3 zeta chain isoform 3 intracellular domain (human CD247).
  • the human intracellular CD3 zeta domain provides stimulatory intracellular signaling upon binding to the extracellular autoantigen, such as PLA2R or a fragment thereof, without HLA restriction.
  • the nucleic acid sequence of the signaling domain comprises a nucleic acid sequence encoding a CD3 zeta signaling domain.
  • the nucleic acid sequence of the CD3 zeta signaling domain encodes an amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR (SEQ ID NO: 23).
  • nucleic acid sequence of the CD3 zeta signaling domain encodes an amino acid sequence comprising RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR (SEQ ID NO: 45).
  • the nucleic acid sequence encoding the CD3 zeta signaling domain comprises: AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAG AACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTT TGGACAAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGA AGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGG AGGCCTACAGTGAGATTGGGATGAAAGGCGAGCCGGAGGGGCAAGGGGC ACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGC CCTTCACATGCAGGCCCTGCCCCCTCGC (SEQ ID NO: 24).
  • the nucleic acid sequence encoding the CD3 zeta signaling domain comprises SEQ ID NO: 74.
  • the signaling domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 23 or SEQ ID NO: 45, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%
  • the PLA2R CAAR and the polynucleotide encoding the PLA2R CAAR comprise a human T cell surface glycoprotein CD8 alpha chain signal peptide.
  • the human CD8 alpha signal peptide is responsible for the translocation of the receptor to the T cell surface.
  • the polynucleotide encoding the PLA2R CAAR comprises a nucleic acid sequence of a peptide linker.
  • the PLA2R CAAR comprises a peptide linker.
  • the cytoplasmic signaling sequences within the intracellular signaling domain of the PLA2R CAAR can be linked to each other in a random or specified order.
  • a short oligo- or polypeptide linker for example, between 2 and 10 amino acids in length may form the linkage.
  • a glycine-serine doublet is a particularly suitable linker.
  • the CAAR comprises a transmembrane domain and/or a cytoplasmic (intracellular) domain from a killer immunoglobulin-like receptor (KIR) family protein.
  • the KIR gene family has at least 15 gene loci (KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DL1/S1, KIR3DL2, KIR3DL3) and two pseudogenes (KIR2DP1 and KIR3DP1) encoded within a 100-200 Kb region of the Leukocyte Receptor Complex (LRC) located on chromosome 19 (19q13.4).
  • LRC Leukocyte Receptor Complex
  • a cell comprising the CAAR of the invention comprising a KIR transmembrane domain and/or cytoplasmic domain may also comprise a polynucleotide encoding DAP10 or DAP12.
  • the KIR is KIRS2 or KIR2DS2
  • the CAAR is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 25, 27, 29, 31, 33, 35, 37, and 39. In certain embodiments, the CAAR comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 26, 28, 30, 32, 34, 36, 38, 40, and 42.
  • the CAAR comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the amino acid sequences set forth in SEQ ID NOs: 12, and 18, 26, 28, 30, 32, 34, 36, 38, or 40.
  • the CAAR is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 11, 17, 25, 27, 29, 31, 33, 35, 37, or 39.
  • a 3 rd generation self-inactivating lentiviral vector plasmid can be used in which the expression of the CAR is regulated by the human elongation factor 1 alpha promoter. This results in stable (permanent) expression of the CAR in the host T cell.
  • the encoding mRNA can be electroporated into the host cell, which would achieve the same therapeutic effect as the virally transduced T cells, but would not be permanent because the mRNA would dilute out with cell division.
  • the invention includes a vector comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide comprises an extracellular domain comprising a human PLA2R autoantigen or fragment thereof, and optionally, a transmembrane domain, and/or an intracellular signaling domain.
  • the vector comprises any of the nucleic acid sequences encoding the CAAR as described herein.
  • the vector comprises a plasmid vector, viral vector, retrotransposon (e.g. piggyback, sleeping beauty), site directed insertion vector (e.g. CRISPR, Zinc finger nucleases, TALEN), or suicide expression vector, or other known vector in the art.
  • the vector is a viral vector, such as a lentiviral vector.
  • the vector is a RNA vector.
  • the expression of the PLA2R CAAR can be verified by sequencing. Expression of the full length CAAR protein may be verified using immunoblot, immunohistochemistry, flow cytometry or other technology well known and available in the art.
  • the present invention also provides a vector in which DNA encoding the CAAR of the present invention is inserted.
  • Vectors including those derived from retroviruses such as lentivirus, are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
  • Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses, such as murine leukemia viruses, in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of resulting in low immunogenicity in the subject into which they are introduced.
  • the expression of natural or synthetic polynucleotides encoding CAARs is typically achieved by operably linking a nucleic acid encoding the CAAR polypeptide or portions thereof to a promoter (e.g. EF1alpha promoter), and incorporating the construct into an expression vector.
  • the vector is one generally capable of replication in a mammalian cell, and/or also capable of integration into the cellular genome of the mammal.
  • Typical vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
  • the nucleic acid can be cloned into any number of different types of vectors.
  • the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
  • Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • the expression vector may be provided to a cell in the form of a viral vector.
  • Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals.
  • Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
  • a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
  • promoter elements e.g., enhancers
  • promoters regulate the frequency of transcriptional initiation.
  • these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • tk thymidine kinase
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • individual elements can function either cooperatively or independently to activate transcription.
  • CMV immediate early cytomegalovirus
  • This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
  • other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, the elongation factor-1 ⁇ promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, when appropriate for use in a CAAR construct.
  • SV40 simian virus 40
  • MMTV mouse mammary tumor virus
  • HSV human immunodeficiency virus
  • LTR
  • inducible promoters are also contemplated as part of the invention.
  • the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence, which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
  • inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
  • an inducible promoter is activated in response to a extracellular ligand.
  • the inducible promoter is activated (and the expression of the CAAR is regulated) by an extracellular ligand binding to a synthetic receptor.
  • a synthetic receptor e.g., a synthetic Notch receptor (i.e., “synNotch”) may be employed as a binding-triggered transcriptional switch that, when bound to its ligand, activates a promoter to which a nucleic acid sequence encoding the CAAR is operably linked.
  • such systems may require the presence of a ligand (e.g., to which the synNotch binds) for the immune cell to be responsive to a BCR or autoantibody (e.g., to which the CAAR binds).
  • a ligand e.g., to which the synNotch binds
  • BCR or autoantibody e.g., to which the CAAR binds.
  • the requirement of particular combinations to generate certain signaling outputs in molecular circuits results in a logic gate. See, for example, Roybal et al., 2016 Cell 164(4):770-9.
  • Examples of other systems for expressing or regulating expression of a chimeric receptor include those described in Wu et al. (2015) Science 350: aab4077; Fedorov et al. (2014) Cancer Journal 20:160-165; Kloss et al. (2013) Nature Biotechnology 31: 71-75; Sakemura et al. (2016) Cancer Immunol. Res. 4:658-668; Hill et al. (2016) Nature Chemical Biology 14:112-117; Di Stasi et al. (2011) N. Engl. J. Med. 365:1673-1683; Budde et al. (2013) PLoS One 8: e82742; Wei et al. (2012) Nature 488: 384-388; Ma et al. (2016) Proc.
  • the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
  • the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
  • Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
  • Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
  • a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assessed at a suitable time after the DNA has been introduced into the recipient cells.
  • Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82).
  • Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
  • the construct with the minimal 5′ flanking region showing the highest level of expression of reporter gene is identified as the promoter.
  • Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
  • the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
  • the expression vector can be transferred into a host cell by physical, chemical, or biological means.
  • Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like.
  • Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY).
  • RNA vectors include vectors having a RNA promoter and/other relevant domains for production of a RNA transcript.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
  • Other viral vectors may be derived from lentivirus, poxviruses, herpes simplex virus, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
  • an exemplary delivery vehicle is a liposome.
  • lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
  • the nucleic acid may be associated with a lipid.
  • the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
  • Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
  • Lipids are fatty substances, which may be naturally occurring or synthetic lipids.
  • lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
  • Lipids suitable for use can be obtained from commercial sources.
  • DMPC dimyristyl phosphatidylcholine
  • DCP dicetyl phosphate
  • Choi cholesterol
  • DMPG dimyristyl phosphatidylglycerol
  • Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about ⁇ 20° C.
  • Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
  • compositions that have different structures in solution than the normal vesicular structure are also encompassed.
  • the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
  • lipofectamine-nucleic acid complexes are also contemplated.
  • Any domains and/or fragments of the CAAR, vector, and the promoter may be synthesized gene fragments amplified by PCR or any other means known in the art.
  • the invention includes a genetically modified cell comprising the PLA2R chimeric autoantibody receptor (CAAR) disclosed herein.
  • CAAR PLA2R chimeric autoantibody receptor
  • the genetically modified cell expresses the PLA2R CAAR.
  • the cell has high affinity for PLA2R autoantibody-based B cell receptors (BCRs) on B cells or rarely, on B cells that have differentiated into plasma cells that have not yet downregulated their BCR.
  • BCRs PLA2R autoantibody-based B cell receptors
  • the genetically modified cell can induce direct killing of anti-PLA2R B cells or indirect killing of plasma cells expressing PLA2R autoantibodies.
  • the genetically modified cell has low affinity for antibodies bound to an Fc receptor.
  • the genetically modified cell is a T cell, such as a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, gamma delta T cell, a natural killer cell, cytokine induced killer cell, a cell line thereof, a T memory stem cell, or other T effector cell. It is also useful for the T cell to have limited toxicity toward healthy cells and specificity to cells expressing autoantibodies. Such specificity prevents or reduces off-target toxicity that is prevalent in current therapies that are not specific for autoantibodies. In one embodiment, the T cell has limited toxicity toward healthy cells. In one embodiment the T cell is an autologous cell. In another embodiment, the T cell is an allogeneic cell.
  • the invention includes genetically modified immune cells derived from pluripotent stem cells that were differentiated in vitro.
  • the invention includes T cells, such as primary cells, expanded T cells derived from primary T cells, T cells derived from stem cells differentiated in vitro, T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
  • T cells such as primary cells, expanded T cells derived from primary T cells, T cells derived from stem cells differentiated in vitro, T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
  • a transduced Jurkat cell line with a NFAT response element followed by GFP can be used to detect and isolate PLA2R specific B cells and to clone the PLA2R specific antibody repertoire in a comprehensive and unbiased fashion.
  • the interacting B and Jurkat cells can be detected as GFP positive doublets or multimers and sorted by flow cytometry.
  • Expression cloning of the B cell receptor encoding genes will provide further information on how auto
  • CAARs to specifically bind to autoantibodies and sera, for example, primary membranous nephropathy sera, can be assessed in a Jurkat reporter cell line, which depends on activation of the CAAR by binding to plate-bound autoantibody (in response to which the activated cells fluoresce green due to an NFAT-GFP reporter construct contained therein).
  • a Jurkat reporter cell line which depends on activation of the CAAR by binding to plate-bound autoantibody (in response to which the activated cells fluoresce green due to an NFAT-GFP reporter construct contained therein).
  • Such methods are useful and reliable qualitative measures for functional binding ability.
  • the proper processing of the autoantigen on the cell surface is also important and can be measured using monoclonal antibodies.
  • truncations of PLA2R based on major disease epitopes are also useful and included herein. Versions using a different length hinge region or GS linker are also useful.
  • With regard to safety preventing or reducing possible homophilic and heterophilic interactions and activ
  • Constructs can be transiently transfected into human cells, such as 293T/17.
  • the surface expression can be detected with monoclonal antibodies (either IgG or ScFv) or serum antibodies from PLA2R MN patients specific for the abovementioned extracellular domains, the linker between the domains, or other structure included in the CAAR. Binding can be verified with specific secondary antibodies and quantified by flow cytometry.
  • Production of membrane expressed constructs of human anti-PLA2R antibodies of any isotype can serve as target cells for testing the different PLA2R-CAARs.
  • Additional target cell lines can be produced as needed by expression of human monoclonal antibodies on the surface of cell lines (e.g. Nalm6 or K562 cells).
  • the present invention also provides methods for preventing, treating and/or managing a disorder or autoimmune disease associated with autoantibody-expressing cells in the context of an autoantibody-mediated kidney disease.
  • the methods comprise administering to a subject in need thereof a genetically modified T cell comprising the CAAR of the invention that binds to the autoantibody-expressing cell.
  • the subject is a human.
  • Non-limiting examples of an autoantibody-mediated kidney disease include to glomerular disease and primary membranous nephropathy.
  • T cells isolated from a subject can be modified to express the appropriate CAAR, expanded ex vivo and then reinfused into the same subject (e.g., the T cells are autologous T cells).
  • the T cells are reinfused into a different subject than the original T cells' donor (e.g., the T cells are allogeneic T cells).
  • the modified T cells recognize target cells, such as anti-PLA2R B cells or PLA2R autoantibody producing B cells or plasma cells, and become activated, resulting in killing of the autoimmune target cells.
  • Relapse may also occur in patients with an autoimmune disease, for example in primary membranous nephropathy patients.
  • the relapse may be mediated by persistence of the same autoantibody B cell clones, whereas remission is associated with disappearance of these clones.
  • the autoimmune cells are depleted to induce long-term remission, possibly due to the longevity of the PLA2R CAAR T cells and/or autoantigen-reactive clones do not re-appear.
  • PLA2R CAAR cells can further express a detectable marker.
  • the detectable marker is activated and expressed, which can be detected by assays known in the art, such as flow cytometry.
  • the PLA2R CAAR includes a NFAT response element and a detectable marker, such as a green fluorescent protein (GFP), to detect and quantify PLA2R CAAR expressing cells.
  • GFP green fluorescent protein
  • T cells Prior to expansion and genetic modification, T cells (e.g., autologous or allogeneic T cells) are obtained from a subject. Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from a number of sources, including skin, peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available in the art, may be used.
  • T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • initial activation steps in the absence of calcium lead to magnified activation.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
  • a semi-automated “flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • buffers such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
  • a specific subpopulation of T cells such as CD3 + , CD28 + , CD4 + , CD8 + , CD45RA + , and CD45RO + T cells, can be further isolated by positive or negative selection techniques.
  • T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3 ⁇ 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
  • the time period is about 30 minutes.
  • the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
  • the time period is at least 1, 2, 3, 4, 5, or 6 hours.
  • the time period is 10 to 24 hours.
  • the incubation time period is 24 hours.
  • TIL tumor infiltrating lymphocytes
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • multiple rounds of selection can also be used in the context of this invention. In certain embodiments, it may be desirable to perform the selection procedure and use the “unselected” cells in the activation and expansion process. “Unselected” cells can also be subjected to further rounds of selection.
  • Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
  • T regulatory cells are depleted by anti-CD25 conjugated beads or other similar method of selection.
  • subpopulation of T cells such as, but not limited to, cells positive or expressing high levels of one or more surface markers e.g. CD28+, CD8+, CCR7+, CD27+, CD127+, CD45RA+, and/or CD45RO+ T cells, can be isolated by positive or negative selection techniques.
  • the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
  • concentrations can result in increased cell yield, cell activation, and cell expansion.
  • use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
  • the concentration of cells used is 5 ⁇ 10 6 /ml. In other embodiments, the concentration used can be from about 1 ⁇ 10 5 /ml to 1 ⁇ 10 6 /ml, and any integer value in between.
  • the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C. or at room temperature.
  • T cells for stimulation can also be frozen after a washing step.
  • the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
  • the cells may be suspended in a freezing solution.
  • one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to ⁇ 80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at ⁇ 20° C. or in liquid nitrogen.
  • cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
  • a blood sample or an apheresis product is taken from a generally healthy subject.
  • a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
  • the T cells may be expanded, frozen, and used at a later time.
  • samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
  • the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
  • agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3
  • These drugs may, for example, inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
  • rapamycin growth factor induced signaling
  • the cells are isolated prior to and can be frozen for later use for treatment following B-cell ablative therapy, e.g., Rituxan.
  • T cells are obtained from a patient directly following treatment.
  • the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • mobilization for example, mobilization with GM-CSF
  • conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
  • Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • T cells are activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.
  • the T cells of the invention are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
  • T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol Meth. 227(1-2):53-63, 1999).
  • the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols.
  • the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in “cis” formation) or to separate surfaces (i.e., in “trans” formation).
  • one agent may be coupled to a surface and the other agent in solution.
  • the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
  • the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • the two agents are immobilized on beads, either on the same bead, i.e., “cis,” or to separate beads, i.e., “trans.”
  • the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
  • a 1:1 ratio of each antibody bound to the beads for CD4 + T cell expansion and T cell growth is used.
  • a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular embodiment an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1. In one embodiment, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect of the present invention, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain embodiments of the invention, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
  • a 1:100 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:75 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:50 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:30 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:10 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:3 CD3:CD28 ratio of antibody bound to the beads is used.
  • a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
  • Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells.
  • the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
  • the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
  • the ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, and 15:1 with one preferred ratio being at least 1:1 particles per T cell.
  • a ratio of particles to cells of 1:1 or less is used.
  • a preferred particle:cell ratio is 1:5.
  • the ratio of particles to cells can be varied depending on the day of stimulation.
  • the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition).
  • the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation.
  • the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation.
  • ratios will vary depending on particle size and on cell size and type.
  • the cells such as T cells
  • the cells are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured.
  • the agent-coated beads and cells prior to culture, are not separated but are cultured together.
  • the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
  • cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3 ⁇ 28 beads) to contact the T cells.
  • the cells for example, 10 4 to 10 9 T cells
  • beads for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1:1
  • a buffer for example PBS (without divalent cations such as, calcium and magnesium).
  • the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest.
  • any cell number is within the context of the present invention.
  • it may be desirable to significantly decrease the volume in which particles and cells are mixed together i.e., increase the concentration of cells, to ensure maximum contact of cells and particles.
  • a concentration of about 2 billion cells/ml is used. In another embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain embodiments. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In another embodiment, the mixture may be cultured for 21 days. In one embodiment of the invention the beads and the T cells are cultured together for about eight days. In another embodiment, the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGF ⁇ , and TNF- ⁇ or any other additives for the growth of cells known to the skilled artisan.
  • Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
  • Media can include RPMI 1640, AIM-V, DMEM, MEM, ⁇ -MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C.) and atmosphere (e.g., air plus 5% CO 2 ).
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics.
  • typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (T H , CD4 + ) that is greater than the cytotoxic or suppressor T cell population (T C , CD8 + ).
  • T H , CD4 + helper T cell population
  • T C cytotoxic or suppressor T cell population
  • Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of T H cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of T C cells.
  • infusing a subject with a T cell population comprising predominately of T C cells or T H cells may be advantageous.
  • an antigen-specific subset of T C cells has been isolated it may be beneficial to expand this subset to a greater degree.
  • CD4 and CD8 markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
  • the invention includes a method for treating an autoantibody-mediated kidney disease in a subject.
  • the method comprises: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby treating the autoantibody-mediated kidney disease in the subject.
  • CAAR chimeric autoantibody receptor
  • the invention includes a method for preventing or reducing glomerulus damage in a subject at risk or suffering from an autoantibody-mediated kidney disease.
  • the method comprises: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a CAAR, wherein the polynucleotide encodes a PLA2R autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby preventing or reducing glomerulus damage in the subject.
  • the autoantibody-mediated kidney disease is selected from the group consisting of a glomerular disease and a primary membranous nephropathy, e.g., a primary membranous nephropathy mediated by or otherwise associated with a known anti-PLA2R autoantibody and/or BCR.
  • the subject is a human.
  • the anti-autoantibody immune response elicited by the CAAR-modified T cells may be an active or a passive immune response.
  • the modified T cell targets a B cell.
  • autoantibody expressing B cells may be susceptible to indirect destruction by CAAR-redirected T cells that have previously reacted against adjacent autoantibody-expressing cells.
  • the genetically modified T cells of the invention are modified by a fully-human CAAR.
  • the fully-human CAAR-genetically modified T cells may be a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal.
  • the mammal is a human.
  • cells are isolated from a mammal (e.g., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAAR disclosed herein.
  • the CAAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
  • the mammalian recipient may be a human and the CAAR-modified cell can be autologous with respect to the recipient.
  • the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
  • ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo.
  • other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
  • the present invention also includes compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
  • the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised.
  • the PLA2R CAAR-modified T cells of the invention are used in the treatment of diseases, disorders and conditions associated with expression of autoantibodies.
  • the cells of the invention are used in the treatment of patients at risk for developing autoimmune kidney diseases, disorders and conditions associated with expression of autoantibodies.
  • the present invention provides methods for the treatment or prevention of autoimmune kidney diseases, disorders and conditions associated with expression of autoantibodies (PLA2R) comprising administering to a subject in need thereof, a therapeutically effective amount of the CAAR-modified T cells of the invention.
  • CAAR-modified T cells of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations.
  • pharmaceutical compositions of the present invention may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • buffers such as neutral buffered saline, phosphate buffered saline and the like
  • carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol
  • proteins polypeptides or amino acids
  • antioxidants such as glycine
  • chelating agents such as EDTA or glutathione
  • adjuvants e.g., aluminum hydroxide
  • preservatives e.g., aluminum hydroxide
  • compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented).
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • an immunologically effective amount When “an immunologically effective amount,” “an anti-BCR effective amount,” “an autoimmune disease-inhibiting effective amount,” or “therapeutic amount” is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, in some instances 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages.
  • the cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).
  • the optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
  • activated T cells are administered to a subject. Subsequent to administration, blood is redrawn or apheresis is performed, and T cells are activated and expanded therefrom using the methods described here, and are then reinfused back into the patient. This process can be carried out multiple times every few weeks.
  • T cells can be activated from blood draws of from 10cc to 400cc. In certain embodiments, T cells are activated from blood draws of 20cc, 30cc, 40cc, 50cc, 60cc, 70cc, 80cc, 90cc, or 100cc. Not to be bound by theory, using this multiple blood draw/multiple reinfusion protocol, may select out certain populations of T cells.
  • the cells of the invention to be administered may be autologous, allogeneic or xenogeneic with respect to the subject undergoing therapy.
  • Administration of the cells of the invention may be carried out using any convenient means, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
  • the compositions described herein may be administered to a patient transarterially, subcutaneously, intradermally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally.
  • the T cell compositions of the present invention are administered to a patient by intradermal or subcutaneous injection.
  • the T cell compositions of the present invention are administered by i.v. injection.
  • the compositions of T cells may be injected directly into a lymph node, or other site of pathophysiologic activity.
  • cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as immunosuppressive agents, such as azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, Cytoxan, fludarabine, mycophenolic acid, steroids, FR901228, cytokines, and irradiation.
  • immunosuppressive agents such as azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents
  • CAMPATH anti-CD3 antibodies or other antibody therapies
  • These drugs may, for example, inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
  • cyclosporine and FK506 calcium dependent phosphatase calcineurin
  • p70S6 kinase that is important for growth factor induced signaling (rapamycin).
  • the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • the T cells of the invention may be used in combination with complement inhibitors to reduce risk of complement-mediated cytotoxicity or an antibody anti-FcRn, IVIg, or plasmapheresis in order to reduce the anti-PLA2R antibody concentration before therapy.
  • a mild lymphodepletion regimen e.g. Low-dose fludarabine or Cytoxan
  • the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
  • the scaling of dosages for human administration can be performed according to art-accepted practices.
  • the dose for CAMPATH for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days.
  • the preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Pat. No. 6,120,766).
  • Cysteine-rich (CysR) domain (Ricin B type lectin domain) (SEQ ID NO: 1) AAGGGCATCTTCGTGATCCAGAGCGAGAGCCTGAAGAAGTGCATCCAGG CCGGCAAGAGCGTGCTGACCCTGGAAAATTGCAAGCAGGCCAACAAGCA CATGCTGTGGAAATGGGTGTCCAACCACGGCCTGTTCAACATCGGCGGC TCTGGATGTCTGGGCCTGAATTTCTCTGCCCCTGAGCAGCCTCTGAGCC TGTACGAGTGTGATAGCACCCTGGTGTCCCTGAGATGGCGGTGCAACCG GAAGATGATCACAGGCCCTCTGCAGTACTCTGTGCAGGTCGCCCACGAC AATACCGTGGTGGCCAGCAGAAAGTACATCCACAAGTGGATCAGCTACG GCAGCGGCGGAGGCGACATCTGTGAATAC Linker between ricin B type lectin domain and fibronectin type II
  • CysR-FNII-CTLD1.CD8H.BBz CAAR construct 4026.CF1 (SEQ ID NO: 65) PLA2R pro-peptide 61-117 (SEQ ID NO: 62) CysR-FNII-CTLD1 118-1143 (SEQ ID NO: 42) CD8 Hinge region 1149-1284 (SEQ ID NO: 20) CD8 TMD 1285-1356 (SEQ ID NO: 22) 4-1BB intracellular domain 1357-1482 (SEQ ID NO: 72) Stop codon 1819-1821 ACTGCTGGAATGGCAGGACAAGGGCATCTTCGTGATCCAGAGCGAGC CTGAAGAAGTGCATCCAGGCCGGCAAGAGCGTGCTGACCCTGGAAAATT GCAAGCAGGCCAACAAGCACATGCTGTGGAAATGGGTGTCCAACCACGG CCTGTTCAACATCGGCGGCTCTGGATGTCTGGGCCTGAATTTCTCTGCC CCTGAGCAGCCTCTGAGCCTGTACGAGTGATAGCACCCTGGTG
  • CysR-FNII-CTLD1.CD8H.BBz CAAR (construct 4026.CF1) (SEQ ID NO: 63) CysR-FNII-CTLD1 40-381 (SEQ ID NO: 43) CD8 Hinge region 384-428 (SEQ ID NO: 19) CD8 TMD 429-452 (SEQ ID NO: 21) 4-1BB intracellular domain 453-494 (SEQ ID NO: 23) LKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSA PEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYI HKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTR EGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICY QFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWM GLNQ
  • 293T cells were transfected at a confluence of 90% with a mixture of the pTRPE-gene-of-interest, the packaging plasmid pGAG-Pol and pRSV-Rev and the envelope plasmid pCI VSVg in a complex with Lipofectamine 2000.
  • Lentivirus containing supernatant was harvested after 24 and 48 hours, filtered through a 0.45 micron polyethersulfone (PES) membrane, concentrated at 12,000 ⁇ g for 24 hours at 4° C., and stored at ⁇ 80° C.
  • PES polyethersulfone
  • Jurkat cells were cultured at 37° C. with 5% CO2 in a completely humidified environment using RPMI1640, HEPES 10 mM, and FBS at 10%.
  • the CAAR constructs were expressed in a Jurkat reporter cell line that has been selected (G418) for stable expression of GFP controlled under an NFAT response element, facilitating GFP expression after CAAR engagement and PLCgamma and IP3 mediated intracellular calcium release.
  • Jurkat cells were transduced with CAAR lentivirus at a multiplicity of infection of 3 and expression of the CAAR construct was validated after >72 hours with an anti-PLA2R monoclonal antibody (Novus Biologicals®) and IgG purified from the plasma of a patient with primary membranous nephropathy by flow cytometry.
  • an anti-PLA2R monoclonal antibody Novus Biologicals®
  • IgG purified from the plasma of a patient with primary membranous nephropathy by flow cytometry.
  • the CAAR Jurkat cells were incubated at 37° C. for 6 hours with plate-bound anti-PLA2R monoclonal as below. GFP expression was validated by flow cytometry.
  • Jurkat-NFAT-GFP cells 1 million Jurkat-NFAT-GFP cells were transduced with each lentivirus encoding for PLA2R CAAR construct C, CF1, CF123, CF1237, CD17, C17, 4025.C, 4026.CF1, 4027.CF12, 4028.CF123 and untransduced Jurkat cells were used as negative control.
  • Transduced and untransduced cells were plated in a 96-well plate at 2 ⁇ 10 5 cells/well in 100 ⁇ l cell culture medium.
  • the stimulation conditions were as follows:
  • transduced and untransduced cells were plated in a 96-well plate at 5 ⁇ 10 4 cells/well in 100 ⁇ l cell culture medium.
  • PLA2R CAAR or mock transduced primary human T cells were cultured for 24 h at 5 ⁇ 10 4 /well in a 96-well plate coated with 10 ⁇ g/ml either IgG purified from plasma of patient with primary membranous nephropathy or control human IgG. Culture supernatants were then harvested for detection of IFN- ⁇ by ELISA.
  • anti-PLA2R BCR-expressing cells for example hybridoma cells or human cell lines, targeting human PLA2R are generated.
  • PLA2R BCR-expressing cells are transduced with lentiviral vectors expressing click-beetle green or click-beetle red luciferase and GFP.
  • approximately 2 ⁇ 10 5 anti-PLA2R cells are injected intravenously into NSG mice (age 6-8 weeks), after pre-treatment of mice daily for 2 days with 600 mg/kg intravenous immunoglobulin to minimize Fc ⁇ R-mediated toxicity against BCR-expressing cells.
  • PLA2R CAAR T cells (approximately 10 7 cells per mouse) are injected intravenously. Bioluminescence and/or serum autoantibodies are quantified every 2-3 days after injection to monitor CAAR T cell efficacy.
  • FIG. 1 The general schematics of the extracellular domains of PLA2R of particular interest in the invention are illustrated in FIG. 1 .
  • the N terminal domain is an immunodominant epitope that is recognized by patient serum antibodies.
  • the CysR and CTLD3 domain interact to form a ring-like structure that may better present immunodominant epitopes; hence constructs including the CysR through CTLD3 domains were generated.
  • serum antibody immunoreactivity to the C-type lectin domains 1 and 7 has also been reported.
  • the PLA2R CAAR constructs illustrated in FIGS. 2A-2G All constructs use the CD8 transmembrane domain and BBZ intracellular domain and differ in their extracellular composition.
  • Construct 4025.C was comprised of a cysteine rich extracellular domain, a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2A , SEQ ID NOs: 37 & 38).
  • Construct 4026.CF1 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, and a C-type lectin 1 domain. Construct 4026.CF1 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2B , SEQ ID NOs: 39 & 40).
  • Construct 4027.CF12 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, and a C-type lectin 2 domain. Construct 4027.CF12 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2C , SEQ ID NOs: 11 & 12).
  • Construct 4028.CF123 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, and a C-type lectin 3 domain. Construct 4028.CF123 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2D , SEQ ID NOs: 17 & 18). A detailed map of PLA2R CAAR Construct 4028.CF123 is shown in FIG. 3A .
  • FIG. 4 shows the PLA2R CAAR expression.
  • the expression of PLA2R CAAR by Jurkat NFAT-GFP cells transduced with different PLA2R lentiviral constructs was measured by staining with soluble anti-PLA2R monoclonal antibody conjugated to PE.
  • FIGS. 5 and 6 show T cell activation by GFP expression of Jurkat cells transduced with the indicated constructs. Negative and positive controls are shown in FIG. 5 . Test samples are shown in FIG. 6 .
  • FIG. 5 depicts the negative and positive controls for PLA2R CAAR T cell activation using an isotype control (top, negative control) or PMA+ionomycin (bottom, positive control).
  • FIG. 6 illustrates the activation of PLA2R CAAR T cells by specific antibodies measured as GFP expression by Jurkat NFAT-GFP cells (6 h activation). No evidence of T cell activation is seen in construct 4025.C and untransduced cells upon exposure to the monoclonal anti-PLA2R Mab or the polyclonal anti-PLA2R Ab. Specific T cell activation in response to cross-linking by the monoclonal anti-PLA2R Ab but not the polyclonal anti-PLA2R Ab is seen using constructs 4027.CF12 and 4028.CF123.
  • Construct C was comprised of a cysteine rich domain, a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2A , SEQ ID NOs: 25 & 26).
  • Construct CF1 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, and a C-type lectin 1 domain. Construct CF1 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2B , SEQ ID NOs: 27 & 28).
  • Construct CF123 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, and a C-type lectin 3 domain. Also included in construct CF123 was a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2C , SEQ ID NOs: 29 & 30).
  • Construct CF1237 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, a C-type lectin 3 domain and a C-type lectin 7 domain. Additionally included in construct CF1237 was a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2D , SEQ ID NOs: 31 & 32).
  • Construct CF17 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, and a C-type lectin 7 domain. Construct CF17 also included a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 7E , SEQ ID NOs: 33 & 34).
  • Construct C17 was comprised of an extracellular domain comprising a cysteine rich domain, a C-type lectin 1 domain, and a C-type lectin 7 domain. Construct C17 also included a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 7F , SEQ ID NOs: 35 & 36).
  • the various PLA2R CAAR constructs were transduced into Jurkat cells and primary human T cells. Surface expression of the PLA2R CAARs was assessed by flow cytometry using MN patient IgG, followed by APC-labeled anti-human IgG secondary antibody. All of the transduced Jurkat ( FIG. 7A ) and primary human T cells ( FIG. 7B ), but not the untransduced control cells, exhibited detectable surface expression of the CAAR constructs.
  • PLA2R CAAR T cells were exposed to either plate-bound MN patient IgG or control human IgG for 24 h. IFN- ⁇ secretion was measured by ELISA of culture supernatants. MN patient IgG stimulated markedly higher IFN- ⁇ production compared to the control human IgG, reflecting primary human CAAR T cell activation after target engagement ( FIG. 9 ).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Urology & Nephrology (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Transplantation (AREA)
  • Rheumatology (AREA)
US17/051,248 2018-05-02 2019-05-02 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells Abandoned US20210095001A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/051,248 US20210095001A1 (en) 2018-05-02 2019-05-02 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201862665863P 2018-05-02 2018-05-02
PCT/US2019/030459 WO2019213434A1 (en) 2018-05-02 2019-05-02 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells
US17/051,248 US20210095001A1 (en) 2018-05-02 2019-05-02 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/030459 A-371-Of-International WO2019213434A1 (en) 2018-05-02 2019-05-02 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17/543,429 Continuation US11884716B2 (en) 2018-05-02 2021-12-06 Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells
US18/640,092 Continuation US20240383965A1 (en) 2018-05-02 2024-04-19 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells

Publications (1)

Publication Number Publication Date
US20210095001A1 true US20210095001A1 (en) 2021-04-01

Family

ID=68386834

Family Applications (3)

Application Number Title Priority Date Filing Date
US17/051,248 Abandoned US20210095001A1 (en) 2018-05-02 2019-05-02 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells
US17/543,429 Active US11884716B2 (en) 2018-05-02 2021-12-06 Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells
US18/640,092 Pending US20240383965A1 (en) 2018-05-02 2024-04-19 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells

Family Applications After (2)

Application Number Title Priority Date Filing Date
US17/543,429 Active US11884716B2 (en) 2018-05-02 2021-12-06 Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells
US18/640,092 Pending US20240383965A1 (en) 2018-05-02 2024-04-19 Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells

Country Status (9)

Country Link
US (3) US20210095001A1 (https=)
EP (1) EP3813885A4 (https=)
JP (2) JP7519906B2 (https=)
KR (1) KR20210007998A (https=)
CN (1) CN112312930A (https=)
AU (1) AU2019262131A1 (https=)
CA (1) CA3098865A1 (https=)
MX (1) MX2020011610A (https=)
WO (1) WO2019213434A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11517589B2 (en) 2015-02-19 2022-12-06 Myeloid Therapeutics, Inc. Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer
WO2023015239A1 (en) * 2021-08-05 2023-02-09 The Trustees Of The University Of Pennsylvania Compositions and methods of chimeric autoantibody receptor cells expressing extended phospholipase a2 receptor fragments
CN116082517A (zh) * 2022-05-26 2023-05-09 成都地奥制药集团有限公司 融合蛋白及其用途
US11944680B2 (en) 2020-11-04 2024-04-02 Myeloid Therapeutics, Inc. Engineered chimeric fusion protein compositions and methods of use thereof
US12030938B2 (en) 2021-03-17 2024-07-09 Myeloid Therapeutics, Inc. Engineered chimeric fusion protein compositions and methods of use thereof
US12252545B2 (en) 2019-12-11 2025-03-18 Myeloid Therapeutics, Inc. Therapeutic cell compositions and methods of manufacturing and use thereof
US12319925B2 (en) 2021-05-11 2025-06-03 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113527507A (zh) * 2020-04-16 2021-10-22 上海赛比曼生物科技有限公司 靶向cd22的嵌合抗原受体及其制法和应用
WO2022136503A1 (en) 2020-12-22 2022-06-30 Deutsches Zentrum Für Neurodegenerative Erkrankungen E. V. (Dzne) Chimeric autoantibody receptor (caar) comprising a nicotinic acetylcholine receptor autoantigen
EP4083061A1 (en) * 2021-04-30 2022-11-02 Kilometro Rosso SPA Fusion proteins and use thereof in the treatment of membranous nephropathy
JP2024545870A (ja) * 2021-12-15 2024-12-13 シャンハイ シンヴィダ バイオテクノロジー カンパニー リミテッド 血小板減少症を治療するための製品及び方法
CN114588881B (zh) * 2022-03-07 2023-07-18 大连理工大学 免疫吸附剂及其制备方法
KR20250057777A (ko) 2022-07-25 2025-04-29 인테리우스 바이오테라퓨틱스, 인코포레이티드 돌연변이된 폴리펩티드, 이를 포함하는 조성물, 및 그 용도(mutated polypeptides, compositions comprising the same, and uses thereof)
CN115838751A (zh) * 2022-11-22 2023-03-24 迪亚莱博(张家港)生物科技有限公司 一种磷脂酶a2受体重组蛋白的制备方法
CN121941504A (zh) * 2023-08-01 2026-04-28 梅里达生物科学公司 用于控制自身免疫反应的分子

Family Cites Families (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
GB9125768D0 (en) 1991-12-04 1992-02-05 Hale Geoffrey Therapeutic method
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
ZA973051B (en) 1996-04-24 1998-10-12 Genentech Inc Type c lectins
HK1047109A1 (zh) 1999-10-15 2003-02-07 University Of Massachusetts 作为指定基因干预工具的rna干预轨迹基因
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
KR20030032922A (ko) 2000-02-24 2003-04-26 싸이트 테라피스 인코포레이티드 세포의 동시 자극 및 농축
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
AU2001275474A1 (en) 2000-06-12 2001-12-24 Akkadix Corporation Materials and methods for the control of nematodes
US7745140B2 (en) 2002-01-03 2010-06-29 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
WO2005118788A2 (en) 2004-05-27 2005-12-15 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
JP2011526916A (ja) * 2008-06-30 2011-10-20 ザ リージェンツ オブ ザ ユニバーシティ オブ ミシガン 全身性紅斑性狼瘡を同定および処置するための診断標的および治療標的としてのリソソームホスホリパーゼa2(lpla2)活性
PH12013501201A1 (en) * 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
US20140155470A1 (en) * 2011-07-08 2014-06-05 David Bernard Pla2r1 as anti-tumoral compound and as biomarker for the detection of cancer
WO2013044225A1 (en) * 2011-09-22 2013-03-28 The Trustees Of The University Of Pennsylvania A universal immune receptor expressed by t cells for the targeting of diverse and multiple antigens
WO2013151665A2 (en) * 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of proteins associated with human disease
CN113604491A (zh) * 2014-05-02 2021-11-05 宾夕法尼亚大学董事会 嵌合自身抗体受体t细胞的组合物和方法
CN108027367A (zh) * 2015-07-10 2018-05-11 楚尼斯 基于pla2r1表位谱和扩散分析的膜性肾病的预后和监测
CN109891245B (zh) * 2016-08-12 2023-05-05 美国创新免疫科技有限公司 自身免疫疾病的诊断、预防和/或治疗
WO2018127585A1 (en) 2017-01-06 2018-07-12 Txcell Monospecific regulatory t cell population with cytotoxicity for b cells
CN107663235B (zh) * 2017-08-11 2018-05-22 南京诺唯赞医疗科技有限公司 特发性膜性肾病相关的pla2r重组蛋白及其应用

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Burbelo, Peter D., Laurence H. Beck Jr, and Meryl Waldman. "Detection and monitoring PLA2R autoantibodies by LIPS in membranous nephropathy." Journal of immunological methods 444 (2017): 17-23. (Year: 2017) *

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11517589B2 (en) 2015-02-19 2022-12-06 Myeloid Therapeutics, Inc. Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer
US11918604B2 (en) 2015-02-19 2024-03-05 Myeloid Therapeutics, Inc. Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer
US11918605B1 (en) 2015-02-19 2024-03-05 Myeloid Therapeutics, Inc. Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer
US12252545B2 (en) 2019-12-11 2025-03-18 Myeloid Therapeutics, Inc. Therapeutic cell compositions and methods of manufacturing and use thereof
US11944680B2 (en) 2020-11-04 2024-04-02 Myeloid Therapeutics, Inc. Engineered chimeric fusion protein compositions and methods of use thereof
US12030938B2 (en) 2021-03-17 2024-07-09 Myeloid Therapeutics, Inc. Engineered chimeric fusion protein compositions and methods of use thereof
US12319925B2 (en) 2021-05-11 2025-06-03 Myeloid Therapeutics, Inc. Methods and compositions for genomic integration
WO2023015239A1 (en) * 2021-08-05 2023-02-09 The Trustees Of The University Of Pennsylvania Compositions and methods of chimeric autoantibody receptor cells expressing extended phospholipase a2 receptor fragments
CN116082517A (zh) * 2022-05-26 2023-05-09 成都地奥制药集团有限公司 融合蛋白及其用途

Also Published As

Publication number Publication date
KR20210007998A (ko) 2021-01-20
US20220098271A1 (en) 2022-03-31
AU2019262131A1 (en) 2020-11-19
JP2024059867A (ja) 2024-05-01
MX2020011610A (es) 2021-02-09
EP3813885A1 (en) 2021-05-05
WO2019213434A1 (en) 2019-11-07
CN112312930A (zh) 2021-02-02
CA3098865A1 (en) 2019-11-07
US20240383965A1 (en) 2024-11-21
EP3813885A4 (en) 2022-01-12
JP2021522790A (ja) 2021-09-02
JP7519906B2 (ja) 2024-07-22
US11884716B2 (en) 2024-01-30

Similar Documents

Publication Publication Date Title
US11884716B2 (en) Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells
US20230303653A1 (en) Compositions and methods of chimeric autoantibody receptor t cells
US20240425564A1 (en) Compositions and methods of muscle specific kinase chimeric autoantibody receptor cells
JP2022133308A (ja) キメラアロ抗原受容体t細胞の組成物および方法
US20260001934A1 (en) Compositions and methods of acetycholine receptor chimeric autoantibody receptor cells
US20250073265A1 (en) Compositions and Methods of Chimeric Autoantibody Receptor Cells Expressing Extended Phospholipase A2 Receptor Fragments
US20230167429A1 (en) Compositions and methods of adamts13 chimeric autoantibody receptor cells
HK40074993A (en) Compositions and methods of chimeric autoantibody receptor t cells

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

AS Assignment

Owner name: THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA, PENNSYLVANIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GILL, SAAR;HOGAN, JONATHAN;PAYNE, AIMEE;AND OTHERS;SIGNING DATES FROM 20190603 TO 20190628;REEL/FRAME:062409/0162

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION