US20210095001A1 - Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells - Google Patents
Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells Download PDFInfo
- Publication number
- US20210095001A1 US20210095001A1 US17/051,248 US201917051248A US2021095001A1 US 20210095001 A1 US20210095001 A1 US 20210095001A1 US 201917051248 A US201917051248 A US 201917051248A US 2021095001 A1 US2021095001 A1 US 2021095001A1
- Authority
- US
- United States
- Prior art keywords
- domain
- seq
- caar
- cell
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 210000001744 T-lymphocyte Anatomy 0.000 title claims abstract description 179
- 238000000034 method Methods 0.000 title claims abstract description 69
- 108010043045 Phospholipase A2 Receptors Proteins 0.000 title claims description 183
- 102000004050 Phospholipase A2 Receptors Human genes 0.000 title claims description 183
- 239000000203 mixture Substances 0.000 title abstract description 32
- 210000004027 cell Anatomy 0.000 claims abstract description 330
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 82
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 82
- 239000002157 polynucleotide Substances 0.000 claims abstract description 82
- 239000013598 vector Substances 0.000 claims abstract description 63
- 108020003175 receptors Proteins 0.000 claims abstract description 31
- 108090000342 C-Type Lectins Proteins 0.000 claims description 103
- 102000003930 C-Type Lectins Human genes 0.000 claims description 103
- 150000007523 nucleic acids Chemical group 0.000 claims description 85
- 230000003834 intracellular effect Effects 0.000 claims description 69
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 66
- 230000011664 signaling Effects 0.000 claims description 64
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 56
- 235000018417 cysteine Nutrition 0.000 claims description 51
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 51
- 239000012634 fragment Substances 0.000 claims description 46
- 108010067306 Fibronectins Proteins 0.000 claims description 44
- 102000016359 Fibronectins Human genes 0.000 claims description 44
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 42
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 42
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 38
- 241000282414 Homo sapiens Species 0.000 claims description 37
- 108010043610 KIR Receptors Proteins 0.000 claims description 36
- 102000002698 KIR Receptors Human genes 0.000 claims description 35
- 230000001404 mediated effect Effects 0.000 claims description 33
- 230000000139 costimulatory effect Effects 0.000 claims description 28
- 208000017169 kidney disease Diseases 0.000 claims description 27
- 230000001086 cytosolic effect Effects 0.000 claims description 22
- 208000033709 Primary membranous glomerulonephritis Diseases 0.000 claims description 20
- 102000004856 Lectins Human genes 0.000 claims description 13
- 108090001090 Lectins Proteins 0.000 claims description 13
- 108010039491 Ricin Proteins 0.000 claims description 13
- 239000002523 lectin Substances 0.000 claims description 13
- 239000012636 effector Substances 0.000 claims description 12
- 230000001939 inductive effect Effects 0.000 claims description 11
- 230000006378 damage Effects 0.000 claims description 10
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 101000945339 Homo sapiens Killer cell immunoglobulin-like receptor 2DS2 Proteins 0.000 claims description 7
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 claims description 7
- 102100033630 Killer cell immunoglobulin-like receptor 2DS2 Human genes 0.000 claims description 7
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 claims description 7
- 231100000419 toxicity Toxicity 0.000 claims description 7
- 230000001988 toxicity Effects 0.000 claims description 7
- 208000022461 Glomerular disease Diseases 0.000 claims description 6
- 231100000852 glomerular disease Toxicity 0.000 claims description 6
- 230000002147 killing effect Effects 0.000 claims description 6
- 210000000130 stem cell Anatomy 0.000 claims description 6
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 5
- 210000003289 regulatory T cell Anatomy 0.000 claims description 5
- 210000002443 helper t lymphocyte Anatomy 0.000 claims description 4
- 210000004405 cytokine-induced killer cell Anatomy 0.000 claims description 3
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims description 3
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 claims description 3
- 210000003071 memory t lymphocyte Anatomy 0.000 claims description 3
- 210000000822 natural killer cell Anatomy 0.000 claims description 3
- 101000933320 Homo sapiens Breakpoint cluster region protein Proteins 0.000 claims description 2
- 108091008875 B cell receptors Proteins 0.000 abstract description 26
- 102100029392 Secretory phospholipase A2 receptor Human genes 0.000 abstract 2
- 101710122046 Secretory phospholipase A2 receptor Proteins 0.000 abstract 2
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 72
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 71
- 230000014509 gene expression Effects 0.000 description 60
- 108090000623 proteins and genes Proteins 0.000 description 48
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 47
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 47
- 239000011324 bead Substances 0.000 description 39
- 108090000765 processed proteins & peptides Proteins 0.000 description 39
- 239000002773 nucleotide Substances 0.000 description 30
- 125000003729 nucleotide group Chemical group 0.000 description 30
- 239000005090 green fluorescent protein Substances 0.000 description 29
- 239000000427 antigen Substances 0.000 description 27
- 102000005962 receptors Human genes 0.000 description 27
- 238000011282 treatment Methods 0.000 description 27
- 230000004913 activation Effects 0.000 description 25
- 102000004196 processed proteins & peptides Human genes 0.000 description 25
- 108091007433 antigens Proteins 0.000 description 24
- 102000036639 antigens Human genes 0.000 description 24
- 150000002632 lipids Chemical class 0.000 description 24
- 239000002245 particle Substances 0.000 description 24
- 206010018372 Glomerulonephritis membranous Diseases 0.000 description 22
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 22
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 22
- 239000003795 chemical substances by application Substances 0.000 description 22
- 201000008350 membranous glomerulonephritis Diseases 0.000 description 22
- 231100000855 membranous nephropathy Toxicity 0.000 description 22
- 102000039446 nucleic acids Human genes 0.000 description 22
- 108020004707 nucleic acids Proteins 0.000 description 22
- 239000003446 ligand Substances 0.000 description 19
- 229920001184 polypeptide Polymers 0.000 description 19
- 235000018102 proteins Nutrition 0.000 description 19
- 102000004169 proteins and genes Human genes 0.000 description 19
- 230000000638 stimulation Effects 0.000 description 19
- 235000001014 amino acid Nutrition 0.000 description 17
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 17
- 238000000684 flow cytometry Methods 0.000 description 16
- 229940024606 amino acid Drugs 0.000 description 14
- 150000001413 amino acids Chemical class 0.000 description 14
- 201000010099 disease Diseases 0.000 description 14
- 239000002502 liposome Substances 0.000 description 14
- 239000000463 material Substances 0.000 description 14
- 239000000047 product Substances 0.000 description 14
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 13
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 13
- 241000713666 Lentivirus Species 0.000 description 13
- 230000006044 T cell activation Effects 0.000 description 13
- 230000004936 stimulating effect Effects 0.000 description 13
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 12
- 210000004369 blood Anatomy 0.000 description 12
- 239000008280 blood Substances 0.000 description 12
- 230000006870 function Effects 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 239000000523 sample Substances 0.000 description 12
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 11
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 11
- 239000013604 expression vector Substances 0.000 description 11
- 210000002966 serum Anatomy 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 230000010261 cell growth Effects 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- 230000001105 regulatory effect Effects 0.000 description 10
- 230000001225 therapeutic effect Effects 0.000 description 10
- 238000013518 transcription Methods 0.000 description 10
- 230000035897 transcription Effects 0.000 description 10
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 9
- 101710090900 C-type lectin 1 Proteins 0.000 description 9
- -1 CD86 Proteins 0.000 description 9
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 9
- 206010028980 Neoplasm Diseases 0.000 description 9
- 101710198350 Snaclec 1 Proteins 0.000 description 9
- 238000002617 apheresis Methods 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 230000004044 response Effects 0.000 description 9
- 239000013603 viral vector Substances 0.000 description 9
- 108020004705 Codon Proteins 0.000 description 8
- 102000004127 Cytokines Human genes 0.000 description 8
- 108090000695 Cytokines Proteins 0.000 description 8
- 108700008625 Reporter Genes Proteins 0.000 description 8
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 238000012360 testing method Methods 0.000 description 8
- 208000023275 Autoimmune disease Diseases 0.000 description 7
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- 108020004999 messenger RNA Proteins 0.000 description 7
- 239000013642 negative control Substances 0.000 description 7
- 102100024263 CD160 antigen Human genes 0.000 description 6
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 6
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 6
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 102100032816 Integrin alpha-6 Human genes 0.000 description 6
- 102100037850 Interferon gamma Human genes 0.000 description 6
- 108010074328 Interferon-gamma Proteins 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 102100029197 SLAM family member 6 Human genes 0.000 description 6
- 230000000735 allogeneic effect Effects 0.000 description 6
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 238000011534 incubation Methods 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 230000000977 initiatory effect Effects 0.000 description 6
- 239000002953 phosphate buffered saline Substances 0.000 description 6
- 210000004180 plasmocyte Anatomy 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 230000035755 proliferation Effects 0.000 description 6
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 5
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 5
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 101001126009 Homo sapiens Secretory phospholipase A2 receptor Proteins 0.000 description 5
- 102100025323 Integrin alpha-1 Human genes 0.000 description 5
- 102100022338 Integrin alpha-M Human genes 0.000 description 5
- 102100025390 Integrin beta-2 Human genes 0.000 description 5
- 108010002350 Interleukin-2 Proteins 0.000 description 5
- 102000000588 Interleukin-2 Human genes 0.000 description 5
- 108010076504 Protein Sorting Signals Proteins 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000011575 calcium Substances 0.000 description 5
- 229910052791 calcium Inorganic materials 0.000 description 5
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 5
- 230000002354 daily effect Effects 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 230000004068 intracellular signaling Effects 0.000 description 5
- 210000003734 kidney Anatomy 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 101710090902 C-type lectin 2 Proteins 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 4
- 108010036949 Cyclosporine Proteins 0.000 description 4
- 241000702421 Dependoparvovirus Species 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 4
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 4
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 description 4
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 4
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 4
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 description 4
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 4
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 description 4
- 102100032818 Integrin alpha-4 Human genes 0.000 description 4
- 102100039904 Integrin alpha-D Human genes 0.000 description 4
- 102100022341 Integrin alpha-E Human genes 0.000 description 4
- 102100022297 Integrin alpha-X Human genes 0.000 description 4
- 102100025304 Integrin beta-1 Human genes 0.000 description 4
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 4
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 4
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 239000000232 Lipid Bilayer Substances 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 102100027744 Semaphorin-4D Human genes 0.000 description 4
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 4
- 101710198343 Snaclec 2 Proteins 0.000 description 4
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 4
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 230000001363 autoimmune Effects 0.000 description 4
- 230000009286 beneficial effect Effects 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 229940112129 campath Drugs 0.000 description 4
- 229960001265 ciclosporin Drugs 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- 229930182912 cyclosporin Natural products 0.000 description 4
- 210000004443 dendritic cell Anatomy 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 229960000390 fludarabine Drugs 0.000 description 4
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 4
- 238000007710 freezing Methods 0.000 description 4
- 230000008014 freezing Effects 0.000 description 4
- 102000051273 human PLA2R1 Human genes 0.000 description 4
- 210000005260 human cell Anatomy 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000000693 micelle Substances 0.000 description 4
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 229960004641 rituximab Drugs 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 241001430294 unidentified retrovirus Species 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 102100027207 CD27 antigen Human genes 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 101000702486 Echis pyramidum leakeyi Snaclec 7 Proteins 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 3
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 3
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 3
- 108091006905 Human Serum Albumin Proteins 0.000 description 3
- 102000008100 Human Serum Albumin Human genes 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 108091027981 Response element Proteins 0.000 description 3
- 101710198344 Snaclec 3 Proteins 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 3
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 3
- 238000010317 ablation therapy Methods 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 239000006143 cell culture medium Substances 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 3
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 229920002521 macromolecule Polymers 0.000 description 3
- FVVLHONNBARESJ-NTOWJWGLSA-H magnesium;potassium;trisodium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;acetate;tetrachloride;nonahydrate Chemical compound O.O.O.O.O.O.O.O.O.[Na+].[Na+].[Na+].[Mg+2].[Cl-].[Cl-].[Cl-].[Cl-].[K+].CC([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O FVVLHONNBARESJ-NTOWJWGLSA-H 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 229960002930 sirolimus Drugs 0.000 description 3
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 238000002054 transplantation Methods 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 108010013238 70-kDa Ribosomal Protein S6 Kinases Proteins 0.000 description 2
- 241000059559 Agriotes sordidus Species 0.000 description 2
- 108010083359 Antigen Receptors Proteins 0.000 description 2
- 102000006306 Antigen Receptors Human genes 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 108010031480 Artificial Receptors Proteins 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 108010056102 CD100 antigen Proteins 0.000 description 2
- 108010017009 CD11b Antigen Proteins 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 108010062802 CD66 antigens Proteins 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- 102100027217 CD82 antigen Human genes 0.000 description 2
- 101710139831 CD82 antigen Proteins 0.000 description 2
- 102000004631 Calcineurin Human genes 0.000 description 2
- 108010042955 Calcineurin Proteins 0.000 description 2
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- 229930105110 Cyclosporin A Natural products 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 2
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 2
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 2
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 description 2
- 101001046668 Homo sapiens Integrin alpha-X Proteins 0.000 description 2
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 2
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 2
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 description 2
- 101000873418 Homo sapiens P-selectin glycoprotein ligand 1 Proteins 0.000 description 2
- 101000692259 Homo sapiens Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 Proteins 0.000 description 2
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 2
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 2
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 2
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 2
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 2
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 2
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- 102100022339 Integrin alpha-L Human genes 0.000 description 2
- 108010041100 Integrin alpha6 Proteins 0.000 description 2
- 108010030465 Integrin alpha6beta1 Proteins 0.000 description 2
- 102100033016 Integrin beta-7 Human genes 0.000 description 2
- 102000000589 Interleukin-1 Human genes 0.000 description 2
- 108010002352 Interleukin-1 Proteins 0.000 description 2
- 102000003814 Interleukin-10 Human genes 0.000 description 2
- 108090000174 Interleukin-10 Proteins 0.000 description 2
- 102000003812 Interleukin-15 Human genes 0.000 description 2
- 108090000172 Interleukin-15 Proteins 0.000 description 2
- 108010002386 Interleukin-3 Proteins 0.000 description 2
- 102000000646 Interleukin-3 Human genes 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- 102100021592 Interleukin-7 Human genes 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 101100236305 Mus musculus Ly9 gene Proteins 0.000 description 2
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 2
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 2
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 2
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 description 2
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 2
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 2
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 2
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 2
- 240000007019 Oxalis corniculata Species 0.000 description 2
- 102100034925 P-selectin glycoprotein ligand 1 Human genes 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 2
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 2
- 102100026066 Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 Human genes 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- 102000014128 RANK Ligand Human genes 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 102100029216 SLAM family member 5 Human genes 0.000 description 2
- 102100029198 SLAM family member 7 Human genes 0.000 description 2
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 2
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 2
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 2
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 2
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 2
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 239000012736 aqueous medium Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 230000006472 autoimmune response Effects 0.000 description 2
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 2
- 229960002170 azathioprine Drugs 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 210000001772 blood platelet Anatomy 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- 238000002659 cell therapy Methods 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 229940119744 dextran 40 Drugs 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- RNPXCFINMKSQPQ-UHFFFAOYSA-N dicetyl hydrogen phosphate Chemical compound CCCCCCCCCCCCCCCCOP(O)(=O)OCCCCCCCCCCCCCCCC RNPXCFINMKSQPQ-UHFFFAOYSA-N 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 239000003018 immunosuppressive agent Substances 0.000 description 2
- 229940125721 immunosuppressive agent Drugs 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 2
- 201000006370 kidney failure Diseases 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 230000005291 magnetic effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 229940014456 mycophenolate Drugs 0.000 description 2
- 229960000951 mycophenolic acid Drugs 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 230000005298 paramagnetic effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 210000000557 podocyte Anatomy 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 229960003452 romidepsin Drugs 0.000 description 2
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 230000002483 superagonistic effect Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000011277 treatment modality Methods 0.000 description 2
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- LWAVGNJLLQSNNN-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-azidobenzoate Chemical compound C1=CC(N=[N+]=[N-])=CC=C1C(=O)ON1C(=O)CCC1=O LWAVGNJLLQSNNN-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- 0 * Chemical compound * 0.000 description 1
- 101150029062 15 gene Proteins 0.000 description 1
- ZIIUUSVHCHPIQD-UHFFFAOYSA-N 2,4,6-trimethyl-N-[3-(trifluoromethyl)phenyl]benzenesulfonamide Chemical compound CC1=CC(C)=CC(C)=C1S(=O)(=O)NC1=CC=CC(C(F)(F)F)=C1 ZIIUUSVHCHPIQD-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000714230 Avian leukemia virus Species 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 102100037904 CD9 antigen Human genes 0.000 description 1
- 108091033409 CRISPR Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 206010010144 Completed suicide Diseases 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- GZDFHIJNHHMENY-UHFFFAOYSA-N Dimethyl dicarbonate Chemical compound COC(=O)OC(=O)OC GZDFHIJNHHMENY-UHFFFAOYSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 101000585551 Equus caballus Pregnancy-associated glycoprotein Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102100022086 GRB2-related adapter protein 2 Human genes 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 1
- 101100112778 Homo sapiens CD247 gene Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000900690 Homo sapiens GRB2-related adapter protein 2 Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001027081 Homo sapiens Killer cell immunoglobulin-like receptor 2DL1 Proteins 0.000 description 1
- 101000945371 Homo sapiens Killer cell immunoglobulin-like receptor 2DL2 Proteins 0.000 description 1
- 101000945331 Homo sapiens Killer cell immunoglobulin-like receptor 2DL4 Proteins 0.000 description 1
- 101000945337 Homo sapiens Killer cell immunoglobulin-like receptor 2DL5A Proteins 0.000 description 1
- 101000945335 Homo sapiens Killer cell immunoglobulin-like receptor 2DL5B Proteins 0.000 description 1
- 101000945340 Homo sapiens Killer cell immunoglobulin-like receptor 2DS1 Proteins 0.000 description 1
- 101000945343 Homo sapiens Killer cell immunoglobulin-like receptor 2DS3 Proteins 0.000 description 1
- 101000945342 Homo sapiens Killer cell immunoglobulin-like receptor 2DS4 Proteins 0.000 description 1
- 101000945346 Homo sapiens Killer cell immunoglobulin-like receptor 2DS5 Proteins 0.000 description 1
- 101000945351 Homo sapiens Killer cell immunoglobulin-like receptor 3DL1 Proteins 0.000 description 1
- 101000945490 Homo sapiens Killer cell immunoglobulin-like receptor 3DL2 Proteins 0.000 description 1
- 101000945493 Homo sapiens Killer cell immunoglobulin-like receptor 3DL3 Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001047640 Homo sapiens Linker for activation of T-cells family member 1 Proteins 0.000 description 1
- 101001090688 Homo sapiens Lymphocyte cytosolic protein 2 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001124867 Homo sapiens Peroxiredoxin-1 Proteins 0.000 description 1
- 101000702132 Homo sapiens Protein spinster homolog 1 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 101000738335 Homo sapiens T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102100039897 Interleukin-5 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 102100037363 Killer cell immunoglobulin-like receptor 2DL1 Human genes 0.000 description 1
- 102100033599 Killer cell immunoglobulin-like receptor 2DL2 Human genes 0.000 description 1
- 102100033633 Killer cell immunoglobulin-like receptor 2DL4 Human genes 0.000 description 1
- 102100033629 Killer cell immunoglobulin-like receptor 2DL5A Human genes 0.000 description 1
- 102100033628 Killer cell immunoglobulin-like receptor 2DL5B Human genes 0.000 description 1
- 102100033631 Killer cell immunoglobulin-like receptor 2DS1 Human genes 0.000 description 1
- 102100033625 Killer cell immunoglobulin-like receptor 2DS3 Human genes 0.000 description 1
- 102100033624 Killer cell immunoglobulin-like receptor 2DS4 Human genes 0.000 description 1
- 102100033626 Killer cell immunoglobulin-like receptor 2DS5 Human genes 0.000 description 1
- 102100033627 Killer cell immunoglobulin-like receptor 3DL1 Human genes 0.000 description 1
- 102100034840 Killer cell immunoglobulin-like receptor 3DL2 Human genes 0.000 description 1
- 102100034834 Killer cell immunoglobulin-like receptor 3DL3 Human genes 0.000 description 1
- 102100020880 Kit ligand Human genes 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- PWKSKIMOESPYIA-BYPYZUCNSA-N L-N-acetyl-Cysteine Chemical compound CC(=O)N[C@@H](CS)C(O)=O PWKSKIMOESPYIA-BYPYZUCNSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100024032 Linker for activation of T-cells family member 1 Human genes 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 102100034709 Lymphocyte cytosolic protein 2 Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- 206010029164 Nephrotic syndrome Diseases 0.000 description 1
- 108010070047 Notch Receptors Proteins 0.000 description 1
- 102000005650 Notch Receptors Human genes 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000015439 Phospholipases Human genes 0.000 description 1
- 108010064785 Phospholipases Proteins 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 229920012266 Poly(ether sulfone) PES Polymers 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 108091008109 Pseudogenes Proteins 0.000 description 1
- 102000057361 Pseudogenes Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 108010039445 Stem Cell Factor Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102300046323 T-cell surface glycoprotein CD3 zeta chain isoform 3 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 238000010459 TALEN Methods 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 206010053614 Type III immune complex mediated reaction Diseases 0.000 description 1
- 101001038499 Yarrowia lipolytica (strain CLIB 122 / E 150) Lysine acetyltransferase Proteins 0.000 description 1
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 1
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 1
- PRSMTOHTFYVJSQ-UHFFFAOYSA-N [Ca].[Pb] Chemical compound [Ca].[Pb] PRSMTOHTFYVJSQ-UHFFFAOYSA-N 0.000 description 1
- 229960004308 acetylcysteine Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000012082 adaptor molecule Substances 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 150000001338 aliphatic hydrocarbons Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 150000001414 amino alcohols Chemical class 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000000823 artificial membrane Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 210000002769 b effector cell Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000003012 bilayer membrane Substances 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000029918 bioluminescence Effects 0.000 description 1
- 238000005415 bioluminescence Methods 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229940046731 calcineurin inhibitors Drugs 0.000 description 1
- 239000003710 calcium ionophore Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 229940030156 cell vaccine Drugs 0.000 description 1
- 230000005890 cell-mediated cytotoxicity Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 239000012829 chemotherapy agent Substances 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000020832 chronic kidney disease Diseases 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 238000001246 colloidal dispersion Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 239000004074 complement inhibitor Substances 0.000 description 1
- 230000003750 conditioning effect Effects 0.000 description 1
- 238000005138 cryopreservation Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000011461 current therapy Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229940093541 dicetylphosphate Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- BPHQZTVXXXJVHI-UHFFFAOYSA-N dimyristoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCCCCCCCC BPHQZTVXXXJVHI-UHFFFAOYSA-N 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229960000284 efalizumab Drugs 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 208000028208 end stage renal disease Diseases 0.000 description 1
- 201000000523 end stage renal failure Diseases 0.000 description 1
- 239000012645 endogenous antigen Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- CJAONIOAQZUHPN-KKLWWLSJSA-N ethyl 12-[[2-[(2r,3r)-3-[2-[(12-ethoxy-12-oxododecyl)-methylamino]-2-oxoethoxy]butan-2-yl]oxyacetyl]-methylamino]dodecanoate Chemical compound CCOC(=O)CCCCCCCCCCCN(C)C(=O)CO[C@H](C)[C@@H](C)OCC(=O)N(C)CCCCCCCCCCCC(=O)OCC CJAONIOAQZUHPN-KKLWWLSJSA-N 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 238000011124 ex vivo culture Methods 0.000 description 1
- 238000001400 expression cloning Methods 0.000 description 1
- 238000002710 external beam radiation therapy Methods 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000009093 first-line therapy Methods 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 239000012595 freezing medium Substances 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 230000001434 glomerular Effects 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 229940064366 hespan Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 102000051878 human BCR Human genes 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 101150026046 iga gene Proteins 0.000 description 1
- 230000016178 immune complex formation Effects 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000017555 immunoglobulin mediated immune response Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 210000003519 mature b lymphocyte Anatomy 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 229960005027 natalizumab Drugs 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 210000004882 non-tumor cell Anatomy 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 108010058237 plasma protein fraction Proteins 0.000 description 1
- 229940081858 plasmalyte a Drugs 0.000 description 1
- 229940002993 plasmanate Drugs 0.000 description 1
- 238000002616 plasmapheresis Methods 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000002203 pretreatment Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 210000004986 primary T-cell Anatomy 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 201000001474 proteinuria Diseases 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 239000012808 vapor phase Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- Membranous nephropathy is among the most common primary causes of nephrotic syndrome in adults (up to one-third of cases). About 15-25% of membranous nephropathy cases are secondary membranous nephropathy, caused by drugs, infections, tumors, or immune diseases. The remaining 75-85% of membranous nephropathy cases are idiopathic, also called primary membranous nephropathy. MN is caused by immune complex formation in the glomerulus. The immune complexes are formed by binding of antibodies to antigens on the podocyte. The immune complex serves as an activator that triggers complement-mediated lysis of glomerular epithelial cells and the release of proteases and oxidants damaging capillary walls. Up to 40% of patients with primary membranous nephropathy who do not receive immunosuppressive treatment develop end-stage renal disease requiring dialysis or kidney transplantation.
- the M-type phospholipase A2 receptor (PLA2R) has been described as a major autoantigen in primary membranous nephropathy.
- Autoantibodies to PLA2R are present in 70-80% of cases of primary membranous nephropathy, and can be used for the diagnosis and monitoring of treatment of primary membranous nephropathy both in the native kidneys and after kidney transplant.
- the invention includes a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the CAAR comprises a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
- CAAR chimeric autoantibody receptor
- PLA2R phospholipase A2 receptor
- the invention includes a vector comprising any one of the polynucleotides disclosed herein.
- the invention includes a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof.
- CAAR chimeric autoantibody receptor
- PHA2R phospholipase A2 receptor
- the invention includes a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
- CAAR chimeric autoantibody receptor
- Another aspect of the invention includes a genetically modified cell comprising any one of the CAARs disclosed herein.
- Yet another aspect of the invention includes genetically modified cell comprising: (a) a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) DAP12.
- CAAR chimeric autoantibody receptor
- PLA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- Still another aspect of the invention includes a pharmaceutical composition comprising any one of the polynucleotides disclosed herein, any one of the CAARs disclosed herein or any one of the cells disclosed herein, and a pharmaceutically acceptable excipient.
- the invention includes a method for treating an autoantibody-mediated kidney disease in a subject.
- the method comprises administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby treating the autoantibody mediated kidney disease in the subject.
- CAAR chimeric autoantibody receptor
- the invention includes a method for preventing or reducing glomerulus damage in a subject at risk of or suffering from an autoantibody-mediated kidney disease, the method comprising: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby preventing or reducing glomerulus damage in the subject.
- CAAR chimeric autoantibody receptor
- the invention includes a method for treating an autoantibody-mediated kidney disease in a subject.
- the method comprises administering to the subject an effective amount of a genetically modified T cell comprising: (a) a polynucleotide encoding a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) a polynucleotide encoding DAP12, thereby treating the autoantibody-mediated kidney disease in the subject.
- CAAR chimeric autoantibody receptor
- PDA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- the invention includes a method for preventing or reducing glomerulus damage in a subject at risk of or suffering from an autoantibody-mediated kidney disease
- the method comprises administering to the subject an effective amount of a genetically modified T cell comprising: (a) a polynucleotide encoding a chimeric autoantibody receptor (CAAR) comprising an extracellular domain comprising phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain; and (b) a polynucleotide encoding DAP12, thereby preventing or reducing glomerulus damage in the subject.
- CAAR chimeric autoantibody receptor
- PDA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- the PLA2R autoantigen or fragment thereof is selected from the group consisting of: (a) an extracellular domain comprising a CysR or ricin B type lectin domain, a fibronectin type II domain, a C-type lectin domain 1 and a C-type lectin domain 2; and (b) an extracellular domain comprising a CysR or ricin B type lectin domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2 and a C-type lectin domain 3.
- the PLA2R autoantigen or fragment thereof is selected from the group consisting of: (a) an extracellular domain comprising a cysteine rich domain, (b) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, and a C-type lectin domain 1, (c) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3, (d) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, and a C-type lectin domain 7, (e) an extracellular domain comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 7, or (e) an extra
- the PLA2R extracellular domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 8 or SEQ ID NO: 15 or SEQ ID NO: 47 or SEQ ID NO: 60 or SEQ ID NO: 50 or SEQ ID NO: 62 or SEQ ID NO: 52 or SEQ ID NO: 54 or SEQ ID NO: 56 or SEQ ID NO: 58.
- the transmembrane domain comprises a CD8 alpha chain transmembrane domain.
- the CD8 alpha chain transmembrane domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 20.
- the CD8 alpha chain transmembrane domain comprises the amino acid sequence of SEQ ID NO: 19.
- the CAAR further comprises a hinge domain.
- the hinge domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 10 or SEQ ID NO: 42 or SEQ ID NO: 64.
- the hinge domain comprises the amino acid sequence of SEQ ID NO: SEQ ID NO: 43 or SEQ ID NO: 44.
- the CAAR further comprises a GS linker.
- the GS linker is encoded by a nucleic acid sequence comprising SEQ ID NO: 68. In certain embodiments, the GS linker comprises SEQ ID NO: 69.
- the intracellular domain of a costimulatory molecule comprises 4-1BB.
- the 4-1BB intracellular domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 22 or SEQ ID NO: 66.
- the 4-1BB intracellular domain comprises the amino acid sequence of SEQ ID NO: 21.
- the signaling domain comprises a CD3 zeta signaling domain.
- the CD3 zeta signaling domain is encoded by a nucleic acid sequence comprising SEQ ID NO: 24 or SEQ ID NO: 72.
- the CD3 zeta signaling domain comprises an amino acid sequence of SEQ ID NO: 23 or SEQ ID NO: 45.
- the CAAR is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 25, 27, 29, 31, 33, 35, 37, and 39. In certain embodiments, the CAAR comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 26, 28, 30, 32, 34, 36, 38, and 40.
- the CAAR comprises a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, a killer immunoglobulin-like receptor (KIR) transmembrane domain and a KIR cytoplasmic domain.
- PHA2R phospholipase A2 receptor
- KIR killer immunoglobulin-like receptor
- the vector is a lentiviral vector. In certain embodiments, the vector is a RNA vector.
- the cell expresses the CAAR and has high affinity to autoantibody-based BCRs on B cells. In certain embodiments, the cell expresses the CAAR and induces killing of B cells expressing autoantibodies. In certain embodiments, the cell expresses the CAAR and has limited toxicity toward healthy cells.
- the cell is selected from the group consisting of a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, gamma delta T cell, a natural killer cell, a cytokine induced killer cell, a cell line thereof, a T memory stem cell, a T cell derived from a pluripotent stem and other effector cell.
- the autoantibody mediated kidney disease is selected from the group consisting of a glomerular disease and a primary membranous nephropathy.
- the subject is a human.
- the modified T cell targets B cells.
- the KIR is KIRS2 or KIR2DS2.
- the vector comprises an inducible promoter operably linked to the polynucleotide encoding the CAAR.
- the cell comprises a polynucleotide encoding the CAAR operably linked to an inducible promoter.
- FIG. 1 is an illustration showing a schematic of the native PLA2R molecule.
- the N terminal cysteine-rich (CysR) domain (Ricin B type lectin domain) is the immunodominant epitope that is recognized by patient serum antibodies. In non-reducing conditions, serum antibody recognition has been reported to be dependent on the first 3 C-type lectin domains (CTLD). In addition to the cysteine-rich domain, serum antibody immunoreactivity to the C-type lectin domains 1 and 7 has also been reported.
- C-type lectin domains 1 and 7 has also been reported.
- a commercial Novus monoclonal antibody (mAb) and polyclonal Sigma antibody bind to the CTLD2 domain.
- FIGS. 2A-2G are a series of schematic diagrams illustrating the various PLA2R CAAR constructs described in this invention.
- ECD extracellular domain
- TMD transmembrane domain
- BBZ cytoplasmic tandem 41BB (CD137) and CD3-zeta signaling domain
- CysR cysteine rich domain
- FNII fibronectin type II domain
- CTLD C-type lectin domain.
- All constructs use a CD8 transmembrane domain and BBZ cytoplasmic domain and differ in their extracellular composition as follows:
- FIG. 2A depicts construct 4025.C (or construct C), whose extracellular domain consists of the PLA2R CysR domain, followed by a CD8 hinge domain.
- FIG. 2B depicts construct 4026.CF1 (or construct CF1), consisting of the CysR, FNII, and CTLD1 domains followed by a CD8 hinge domain.
- FIG. 2C depicts construct 4027.CF12, consisting of the CysR, FNII, CTLD1, and CTLD2 domains, followed by a CD8 hinge domain.
- FIG. 2D depicts construct 4028.CF123 (or construct CF123), consisting of the CysR, FNII, CTLD1, CTLD2, and CTLD3 domains, followed by either a CD8 hinge (4028.CF123) or GS linker (CF123).
- FIG. 1 depicts construct 4026.CF1 (or construct CF1), consisting of the CysR, FNII, and CTLD1 domains followed by a CD8 hinge domain.
- FIG. 2C depicts construct 4027.CF12, consisting of the CysR, FNII, CTLD1, and CTLD2 domains, followed by a CD8 hinge domain
- FIG. 2E depicts construct CF1237, consisting of the CysR, FNII, CTLD1, CTLD2, CTLD3, and CTLD7 domains followed by a GS linker.
- FIG. 2F depicts construct CF17, consisting of the CysR, FNII, CTLD1, and CTLD7 domains, followed by a GS linker.
- FIG. 2G depicts construct C17, consisting of the CysR, CTLD1, and CTLD7 domains, followed by a GS linker.
- FIG. 3A is an illustration showing a portion of the plasmid map comprising the 4028.CF123 CAAR.
- FIG. 3B is a table distinguishing the compositions of the CAAR constructs described in this invention.
- FIG. 4 is a series of flow cytometry plots demonstrating surface expression of a subset of PLA2R CAARs (4027.CF12 and 4028.CF123) on Jurkat NFAT-GFP cells.
- the expression of PLA2R CAAR by Jurkat NFAT-GFP cells transduced with different PLA2R lentiviral constructs was measured (MOI 5:1, 48 h) using a commercial Novus monoclonal antibody (mAb) specific for the PLA2R CTLD2 domain.
- FIG. 5 is a series of flow cytometry plots showing the negative and positive controls for PLA2R CAAR T cell activation using an isotype control (top, negative control) or PMA+ionomycin (bottom, positive control).
- FIG. 6 is a series of flow cytometry plots showing the activation of 4027.CF12 and 4028.CF123 PLA2R CAAR T cells by plate-bound monoclonal or polyclonal antibodies specific for the PLA2R CTLD2 domain, measured as GFP expression by Jurkat NFAT-GFP cells (6 h activation). No evidence of T cell activation is seen in construct 4025.C, as expected as this construct does not contain the CTLD2 domain, and untransduced cells upon exposure to the anti-PLA2R monoclonal antibody (mAb) or the polyclonal anti-PLA2R antibody (Ab). Specific T cell activation in response to cross-linking of the PLA2R CAAR by the monoclonal anti-PLA2R mAb but not the polyclonal anti-PLA2R Ab is observed.
- mAb monoclonal antibody
- Ab polyclonal anti-PLA2R antibody
- FIGS. 7A-7B are a series of plots illustrating that PLA2R MN patient IgG detects PLA2R CAAR expression on transduced Jurkat NFAT-GFP and primary human T cells.
- Flow cytometry plots demonstrate robust PLA2R CAAR surface expression on Jurkat NFAT-GFP cells ( FIG. 7A ) and primary human T cells ( FIG. 7B ) for all constructs evaluated (4025.C, 4026.CF1, 4027.CF12, 4028.CF123, C, CF1, CF123, CF1237, CF17, C17).
- PLA2R CAAR The expression of PLA2R CAAR by Jurkat NFAT-GFP and primary human T cells transduced with different PLA2R lentiviral constructs (72 h) was detected by incubation with MN patient IgG followed by APC-conjugated anti-human IgG.
- FIG. 8 is a series of plots illustrating that plate-bound MN patient IgG activates PLA2R CAAR transduced Jurkat-NFAT-GFP cells.
- Flow cytometry plots show the activation of PLA2R CAAR T cells by MN patient IgG measured as GFP expression by Jurkat NFAT-GFP cells (6 h activation). All evaluated PLA2R CAAR T cells (4025.C, 4026.CF1, 4027.CF12, 4028.CF123, C, CF1, CF123, CF1237, CF17, C17) transduced signal after cross-linking by plate-bound anti-PLA2R IgG.
- FIG. 9 is a set of graphs illustrating that plate-bound MN patient IgG stimulates IFN- ⁇ secretion from PLA2R CAAR-transduced primary human T cells.
- 5 ⁇ 10 4 primary human T cells were cultured for 24 h in a 96-well plate coated with 10 ⁇ g/ml of either MN patient IgG or control human IgG. Culture supernatants were then harvested for detection of IFN- ⁇ by ELISA. IFN ⁇ production was detectable in all culture supernatants and was elevated relative to untransduced T cells, or PLA2R CAAR T cells stimulated with control (Ctrl) human IgG.
- the invention includes a chimeric autoantibody receptor (CAAR) specific for anti-phospholipase A2 receptor (PLA2R) B cell receptor (BCR), compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- CAAR chimeric autoantibody receptor
- PHA2R anti-phospholipase A2 receptor
- BCR B cell receptor
- compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- the invention also includes methods of making a genetically modified cell, e.g., a genetically modified T cell, expressing a PLA2R-CAAR wherein the expressed CAAR comprises a PLA2R extracellular domain.
- the present invention also relates generally to the use of cells, e.g., T cells, engineered to express a CAAR to treat an autoantibody-mediated kidney disease associated with targeting of self-antigens (e.g. PLA2R).
- the cells e.g., T cells expressing the CAAR of the invention specifically bind to and kill anti-PLA2R BCR-expressing cells, but do not bind to and kill normal BCR-expressing cells.
- an element means one element or more than one element.
- antibody refers to an immunoglobulin molecule that binds with an antigen.
- Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules.
- the antibody in the present invention may exist in a variety of forms where the antibody is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv) and a humanized antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
- sdAb single domain antibody fragment
- scFv single chain antibody
- humanized antibody Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y
- the binding molecule may have an affinity for the target molecule stronger than 100 nM, 50 nM, 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM, e.g., as determined by surface plasmon resonance.
- antigen or “Ag,” as used herein, is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically competent cells, or both.
- antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an “antigen” as that term is used herein.
- an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
- autoantigen is meant an endogenous antigen that stimulates production of an autoimmune response, such as production of autoantibodies.
- Autoantigen also includes a self-antigen or antigen from a normal tissue that is the target of a cell-mediated or an antibody-mediated immune response that may result in the development of an autoimmune disease.
- autoantigens include, but are not limited to, PLA2R, and fragments thereof.
- limited toxicity refers to the peptides, polynucleotides, cells and/or antibodies of the invention manifesting a lack of substantially negative biological effects, anti-tumor effects, or substantially negative physiological symptoms toward a healthy cell, non-tumor cell, non-diseased cell, non-target cell or population of such cells either in vitro or in vivo.
- Autoantibody refers to an antibody that is specific for an autoantigen.
- autoimmune disease is defined as a disorder or condition that results from an antibody-mediated autoimmune response against autoantigens.
- An autoimmune disease results in the production of autoantibodies that are inappropriately produced and/or excessively produced to a self-antigen or autoantigen.
- autologous is meant to refer to any material derived from the same individual to which it is later to be re-introduced into the individual.
- Allogeneic refers to any material derived from a different animal of the same species.
- Xenogeneic refers to any material derived from an animal of a different species.
- CAAR Chimeric autoantibody receptor
- the CAAR includes an antigen or fragment thereof that is specific for an autoantibody and/or BCR, e.g., a pathogenic autoantibody and/or BCR.
- the CAAR optionally also includes a transmembrane domain, an intracellular domain and/or a signaling domain.
- conservative sequence modifications is intended to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- one or more amino acid residues within the extracellular regions of the CAAR of the invention can be replaced with other amino acid residues having a similar side chain or charge and the altered CAAR can be tested for the ability to bind autoantibodies using the functional assays described herein.
- Co-stimulatory ligand includes a molecule on an antigen presenting cell (e.g., an aAPC, dendritic cell, B cell, and the like) that specifically binds a cognate co-stimulatory molecule on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- an antigen presenting cell e.g., an aAPC, dendritic cell, B cell, and the like
- a “co-stimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
- Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and a Toll ligand receptor.
- Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
- Effective amount or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result. Such results may include, but are not limited to, the inhibition of virus infection as determined by any means suitable in the art.
- effector function refers to a specialized function of a cell.
- endogenous refers to any material from or produced inside an organism, cell, tissue or system.
- exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
- expression is defined as the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
- “Expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
- An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
- Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes), retrotransposons (e.g. piggyback, sleeping beauty), and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
- “Homologous,” as used herein, refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position.
- the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
- Identity refers to the subunit sequence identity between two polymeric molecules particularly between two amino acid molecules, such as, between two polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage.
- the identity between two amino acid sequences is a direct function of the number of matching or identical positions; e.g., if half (e.g., five positions in a polymer ten amino acids in length) of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions (e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical.
- an “instructional material” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the invention.
- the instructional material of the kit of the invention may, for example, be affixed to a container which contains the nucleic acid, peptide, and/or composition of the invention or be shipped together with a container which contains the nucleic acid, peptide, and/or composition.
- the instructional material may be shipped separately from the container with the intention that the instructional material and the compound be used cooperatively by the recipient.
- “Intracellular domain” refers to a portion or region of a molecule that resides inside a cell.
- intracellular signaling domain is meant to include any full-length or truncated portion of the intracellular domain sufficient to transduce the effector function signal.
- isolated means altered or removed from the natural state.
- a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
- An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- A refers to adenosine
- C refers to cytosine
- G refers to guanosine
- T refers to thymidine
- U refers to uridine.
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
- the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
- a “lentivirus,” as used herein, refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses. Vectors derived from lentiviruses offer the means to achieve significant levels of gene transfer in vivo.
- operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
- parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
- plasma cells refer to a type of white blood cells which can produce and secrete antibodies. Plasma cells are also referred to as plasmocytes, plasmacytes, or effector B cells. In some embodiments, these cells comprise B cell precursors capable of B-cell differentiation or B cells in the early stages of B cell differentiation, expressing a ⁇ chain on the cell surface as antigen receptor; B cells in which the transcription process has changed and IgM production has changed from membrane-type IgMs to secreted-type IgMs; mature B cells that have completed class-switching and secrete IgGs, IgAs, and IgMs; and B cells in the final stages of differentiation.
- PLA2R M-type phospholipase A2 receptor
- MN primary membranous nephropathy
- the anti-PLA2R autoantibodies are predominantly of the IgG4 subclass but subclasses IgG1, IgG2, and IgG3 are also represented. Genetic variants of PLA2R were also shown to be associated with MN (Stanescu et al. 2011 N Engl J Med; 364(7):616-26).
- a PLA2R fragment refers to a shortened or truncated PLA2R protein.
- the polypeptide can have N-terminus or C-terminus truncations and/or also internal deletions.
- fragments are fragments comprising the C-type lectin domains (“CTLD”) of PLA2R.
- CTL C-type lectin domains
- a PLA2R fragment includes the external domain of PLA2R, which is the amino acid residues 21-1397 of the human PLA2R (UniProtKB, Q13018) or any shorter portion of the amino acid residues 21-1397.
- nucleotide is defined as a chain of nucleotides.
- nucleic acids are polymers of nucleotides.
- nucleic acids and polynucleotides, as used herein, are interchangeable.
- nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric “nucleotides.” The monomeric nucleotides can be hydrolyzed into nucleosides.
- polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
- a nucleic acid sequence is considered to have at least 95%, 96%, 97%, 98%, or 99% identity or homology to any nucleic acid sequence disclosed herein.
- peptide As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds.
- a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
- Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
- the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
- Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
- the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
- an amino acid sequence is considered to have at 95%, 96%, 97%, 98%, or 99% identity or homology to any amino acid sequence described herein.
- proinflammatory cytokine refers to a cytokine or factor that promotes inflammation or inflammatory responses.
- proinflammatory cytokines include, but are not limited to, chemokines (CCL, CXCL, CX3CL, XCL), interleukins (such as, IL-1, IL-2, IL-3, IL-5, IL-6, IL-7, IL-9, IL10 and IL-15), interferons (IFN ⁇ ), and tumor necrosis factors (TNF ⁇ and TNF ⁇ ).
- promoter is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
- promoter/regulatory sequence means a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence.
- this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
- the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
- a “constitutive” promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
- an “inducible” promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
- tissue-specific promoter is a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
- a “signal transduction pathway” refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
- the phrase “cell surface receptor” includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
- Signal domain refers to the portion or region of a molecule that recruits and interacts with specific proteins in response to an activating signal.
- subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals).
- substantially purified cell is a cell that is essentially free of other cell types.
- a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
- a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cells that have been separated from the cells with which they are naturally associated in their natural state.
- the cells are cultured in vitro. In other embodiments, the cells are not cultured in vitro.
- terapéutica means a treatment and/or prophylaxis.
- a therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
- transfected or “transformed” or “transduced,” as used herein, refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
- the cell includes the primary subject cell and its progeny.
- Transmembrane domain refers to a portion or a region of a molecule that spans a lipid bilayer membrane.
- under transcriptional control means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide.
- a “vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
- vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses.
- the term “vector” includes an autonomously replicating plasmid or a virus.
- the term should also be construed to include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like.
- viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
- telomere binding partner e.g., a stimulatory and/or costimulatory molecule present on a T cell
- stimulation is meant a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
- a stimulatory molecule e.g., a TCR/CD3 complex
- Stimulation can mediate altered expression of certain molecules, such as downregulation of TGF- ⁇ , and/or reorganization of cytoskeletal structures, and the like.
- a “stimulatory molecule,” as the term is used herein, means a molecule on a T cell that specifically binds with a cognate stimulatory ligand present on an antigen presenting cell.
- a “stimulatory ligand,” as used herein, means a ligand that when present on an antigen presenting cell (e.g., an aAPC, a dendritic cell, a B-cell, and the like) can specifically bind with a cognate binding partner (referred to herein as a “stimulatory molecule”) on a T cell, thereby mediating a primary response by the T cell, including, but not limited to, activation, initiation of an immune response, proliferation, and the like.
- an antigen presenting cell e.g., an aAPC, a dendritic cell, a B-cell, and the like
- a cognate binding partner referred to herein as a “stimulatory molecule”
- Stimulatory ligands are well-known in the art and encompass, inter alia, an MHC Class I molecule loaded with a peptide, an anti-CD3 antibody, a superagonist anti-CD28 antibody, and a superagonist anti-CD2 antibody.
- ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
- CAAR Chimeric Autoantibody Receptor
- the present invention is partly based on the discovery that chimeric autoantibody receptors can be used to target B cells that express autoantibody-based B cell receptors, which after activation and autoantibody secretion, may cause an autoantibody-mediated kidney disease.
- the invention includes a chimeric autoantibody receptor (CAAR) specific for anti-phospholipase A2 receptor (PLA2R) B cell receptor (BCR), compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- CAAR chimeric autoantibody receptor
- PLA2R anti-phospholipase A2 receptor
- BCR B cell receptor
- compositions comprising the CAAR, polynucleotides encoding the CAAR, vectors comprising a polynucleotide encoding the CAAR, and recombinant T cells comprising the CAAR.
- the present invention includes a technology for treating an autoantibody-mediated kidney disease.
- technologies that target B cells that ultimately produce the autoantibodies and display the autoantibodies on their cell surfaces mark these B cells as disease-specific targets for therapeutic intervention.
- the invention therefore includes a method for efficiently targeting and killing the pathogenic B cells in autoantibody-mediated kidney diseases by targeting the disease-causing B cells using an antigen-specific (e.g., PLA2R) chimeric autoantibody receptor (or CAAR).
- an antigen-specific e.g., PLA2R
- CAAR chimeric autoantibody receptor
- the invention includes a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain.
- CAAR chimeric autoantibody receptor
- PLA2R phospholipase A2 receptor
- the CAAR of the invention comprises an autoantibody binding domain otherwise referred to as an autoantigen or a fragment thereof.
- an autoantigen for use in the present invention depends upon the type of autoantibody or BCR being targeted (e.g. anti-PLA2R).
- the autoantigen may be chosen because it recognizes a BCR or autoantibody on a target cell, such as a BCR-expressing B cell, associated with a particular autoantibody mediated kidney disease state, e.g. a glomerular disease and an primary membranous nephropathy.
- the autoantibody binding domain is derived from the same species in which the CAAR will ultimately be used.
- the autoantibody binding domain of the CAAR comprises a human autoantigen (or fragment thereof) that binds a human BCR or autoantibody.
- a genetically engineered chimeric autoantibody receptor includes PLA2R or fragments thereof, which binds an anti-PLA2R BCR, e.g., anti-PLA2R BCR on a B cell in a subject.
- the CAAR comprises an extracellular domain of PLA2R.
- the extracellular domain of PLA2R comprises an N-terminal cysteine rich domain (Ricin B type lectin domain), a Fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, a C-type lectin domain 7, or a combination of any of the foregoing.
- the extracellular domain of PLA2R comprises the immunodominant epitope, N-terminal cysteine rich (CysR) domain (Ricin B type lectin domain), encoded by SEQ ID NO: 1, a Fibronectin type II domain encoded by SEQ ID NO: 3, a C-type lectin domain 1 encoded by SEQ ID NO: 5, and a C-type lectin domain 2 encoded by SEQ ID NO: 7.
- This extracellular domain of PLA2R is the extracellular domain of the construct designated as construct 4027.CF12 herein and is encoded by SEQ ID NO: 8, wherein the linker between the immunodominant epitope, N-terminal cysteine rich domain and the Fibronectin type II domain is encoded by SEQ ID NO: 2 and the linker between the Fibronectin type II domain and the C-type lectin domain 1 is encoded by SEQ ID NO: 4, and the linker between the C-type lectin domain 1 and the C-type lectin domain 2 is encoded by SEQ ID NO: 6.
- the extracellular domain of PLA2R comprises the extracellular domain of construct 4027.CF12 and additionally a C-type lectin domain 3 encoded by SEQ ID NO: 14.
- This latter extracellular domain of PLA2R is the extracellular domain of the construct designated as construct 4028.CF123 herein and is encoded by SEQ ID NO: 15, wherein the linkers between the immunodominant epitope, N-terminal cysteine rich domain, the Fibronectin type II, the C-type lectin domain 1 and the C-type lectin domain 2 are the same as those listed above herein for construct 4027.CF12 (SEQ ID NOS: 2, 4 and 6) and further wherein the linker between the C-type lectin domain 2 and the C-type lectin domain 3 is encoded by SEQ ID NO: 13.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct C, comprising a cysteine rich domain.
- the cysteine rich domain comprises SEQ ID NO: 49, and may be encoded by SEQ ID NO: 47.
- the cysteine rich domain comprises SEQ ID NO: 1.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF1, comprising a cysteine rich domain, a fibronectin type II domain, and a C-type lectin domain 1.
- the extracellular domain comprises SEQ ID NO: 51, and may be encoded by SEQ ID NO: 50.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF123, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3.
- the extracellular domain comprises SEQ ID NO: 53, and may be encoded by SEQ ID NO: 52.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF1237, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, a C-type lectin domain 3, and a C-type lectin domain 7.
- the extracellular domain comprises SEQ ID NO: 55, and may be encoded by SEQ ID NO: 54.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct CF17, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 7.
- the extracellular domain comprises SEQ ID NO: 57, and may be encoded by SEQ ID NO: 56.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct C17, comprising a cysteine rich domain, a C-type lectin domain 1, and a C-type lectin domain 7.
- the extracellular domain comprises SEQ ID NO: 59, and may be encoded by SEQ ID NO: 58.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4025.C, comprising a cysteine rich domain.
- the extracellular domain comprises SEQ ID NO: 61, and may be encoded by SEQ ID NO: 60.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4026.CF1, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1.
- the extracellular domain comprises SEQ ID NO: 40, and may be encoded by SEQ ID NO: 39.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4027.CF12, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, and a C-type lectin domain 2.
- the extracellular domain comprises SEQ ID NO: 70, and may be encoded by SEQ ID NO: 8.
- the extracellular domain of PLA2R comprises the extracellular domain of the construct referred to herein as construct 4028.CF123, comprising a cysteine rich domain, a fibronectin type II domain, a C-type lectin domain 1, a C-type lectin domain 2, and a C-type lectin domain 3.
- the extracellular domain comprises SEQ ID NO: 71, and may be encoded by SEQ ID NO: 15.
- the autoantigen or a fragment thereof comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the amino acid sequences set forth in SEQ ID NO: 49, 51, 53, 55, 57, 59, 61, 63, 70 or 71.
- the autoantigen or a fragment thereof is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least or 99% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 8, 15, 47, 50, 52, 54, 56, 58, 60, or 62.
- the PLA2R CAAR comprises a transmembrane domain that is fused to the extracellular domain of the PLA2R CAAR.
- the PLA2R CAAR comprises a transmembrane domain that naturally is associated with one of the domains in the PLA2R CAAR.
- the transmembrane domain is selected or modified by amino acid substitution to avoid binding to the transmembrane domains of the same or different surface membrane proteins in order to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be derived either from a natural or from a synthetic source. When the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one embodiment, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In one aspect a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the PLA2R CAAR.
- a glycine-serine doublet provides a particularly suitable linker.
- spacer domains before the transmembrane domain can be employed as well including a hinge (e.g. a CD8 or human Ig (immunoglobulin) hinge), or a glycine-serine (GS) linker.
- a hinge e.g. a CD8 or human Ig (immunoglobulin) hinge
- GS glycine-serine
- hinge and/or transmembrane domain examples include, but are not limited to, a hinge and/or transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, killer immunoglobulin-like receptor (KIR), OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R ⁇ , ITGA1, VLA1, CD49a, ITGA4, IA4, CD49 D, ITGA6, VLA-6, CD49f, ITGAD, CD11d,
- the PLA2R CAAR comprises a transmembrane domain, such as, but not limited to, a CD8 alpha transmembrane domain.
- the CD8 alpha transmembrane domain comprises the amino acid sequence IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO: 19).
- the CD8 alpha transmembrane domain is encoded by the nucleotide sequence
- the transmembrane domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 19, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
- the PLA2R CAAR comprises a hinge domain such as, but not limited to, a CD8 alpha hinge domain.
- the hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 43).
- the hinge domain comprises the amino acid sequence FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 44).
- the hinge domain is encoded by the nucleotide sequence of SEQ ID NO: 10.
- the hinge domain is encoded by the nucleotide sequence ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGC AGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGT GCACACGAGGGGGTGGACTTCGCCTGTGAT (SEQ ID NO: 42).
- the hinge domain is encoded by the nucleotide sequence TTCGTGCCGGTCTTCCTGCCAGCGAAGCCAACCACGACGCCAGCACCGCGAC CACCAACACCTGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGA GGCGTGCAGACCAGCAGCGGGGGGCAGTGCACACGAGGGGGTGGACTT CGCCTGTGAT (SEQ ID NO: 64).
- the PLA2R CAAR comprises a transmembrane domain and a hinge domain.
- the hinge domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO:43 or SEQ ID NO: 44, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at
- the PLA2R CAAR comprises a glycine serine (GS) linker.
- the PLA2R CAAR comprises a GS linker and a transmembrane domain.
- the GS linker is encoded by the nucleotide sequence: GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 68).
- the GS linker comprises the amino acid sequence: GGGGSGGGGS (SEQ ID NO: 69).
- the PLA2R CAAR comprises an intracellular domain of a costimulatory molecule.
- the intracellular domain of a costimulatory molecule of the PLA2R CAAR of the invention is a cytoplasmic domain responsible for the activation of at least one of the normal effector functions of the immune cell in which the PLA2R CAAR has been placed in.
- Effector function of a T cell may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular domain of a costimulatory molecule refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While the entire intracellular domain of a costimulatory molecule can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular domain of a costimulatory molecule is used, such truncated portion may be used in place of the intact domain as long as it transduces the effector function signal.
- the intracellular domain of a costimulatory molecule refers to a portion of the CAAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, CD5, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD127, CD160, CD19, CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7
- the nucleic acid sequence of the intracellular domain of a costimulatory molecule encodes an amino acid sequence comprising costimulatory molecule 4-1BB (also known and referred to as CD137) intracellular domain:
- nucleic acid sequence encoding the 4-1BB intracellular domain comprises: AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGAC CAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGA AGAAGAAGGAGGATGTGAACTG (SEQ ID NO: 22).
- nucleic acid sequence encoding the 4-1BB intracellular domain comprises: SEQ ID NO: 66.
- the human intracellular 4-1BB domain provides co-stimulatory intracellular signaling upon binding to the extracellular autoantigen, such as PLA2R, or a fragment thereof, without the need of its original ligand.
- the intracellular domain of a costimulatory molecule comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 21, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
- the PLA2R CAAR comprises a signaling domain.
- Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory manner or in an inhibitory manner.
- Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary signaling sequences examples include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that signaling molecule in the CAAR of the invention comprises a signaling domain derived from CD3-zeta.
- the signaling domain of the CAAR can be designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAAR of the invention.
- the signaling domain of the CAAR can comprise a CD3 zeta chain portion and a costimulatory signaling domain.
- the PLA2R CAAR comprises a CD3-zeta signaling domain by itself or in combination with any other desired cytoplasmic domain(s) useful in the context of the PLA2R CAAR of the invention.
- the PLA2R CAAR can comprise a CD3 zeta chain portion and an intracellular domain of a costimulatory molecule.
- the CD3 zeta chain portion is a human T-cell surface glycoprotein CD3 zeta chain isoform 3 intracellular domain (human CD247).
- the human intracellular CD3 zeta domain provides stimulatory intracellular signaling upon binding to the extracellular autoantigen, such as PLA2R or a fragment thereof, without HLA restriction.
- the nucleic acid sequence of the signaling domain comprises a nucleic acid sequence encoding a CD3 zeta signaling domain.
- the nucleic acid sequence of the CD3 zeta signaling domain encodes an amino acid sequence comprising RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR (SEQ ID NO: 23).
- nucleic acid sequence of the CD3 zeta signaling domain encodes an amino acid sequence comprising RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR (SEQ ID NO: 45).
- the nucleic acid sequence encoding the CD3 zeta signaling domain comprises: AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAG AACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTT TGGACAAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGA AGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGG AGGCCTACAGTGAGATTGGGATGAAAGGCGAGCCGGAGGGGCAAGGGGC ACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGC CCTTCACATGCAGGCCCTGCCCCCTCGC (SEQ ID NO: 24).
- the nucleic acid sequence encoding the CD3 zeta signaling domain comprises SEQ ID NO: 74.
- the signaling domain comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 23 or SEQ ID NO: 45, or is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%
- the PLA2R CAAR and the polynucleotide encoding the PLA2R CAAR comprise a human T cell surface glycoprotein CD8 alpha chain signal peptide.
- the human CD8 alpha signal peptide is responsible for the translocation of the receptor to the T cell surface.
- the polynucleotide encoding the PLA2R CAAR comprises a nucleic acid sequence of a peptide linker.
- the PLA2R CAAR comprises a peptide linker.
- the cytoplasmic signaling sequences within the intracellular signaling domain of the PLA2R CAAR can be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example, between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet is a particularly suitable linker.
- the CAAR comprises a transmembrane domain and/or a cytoplasmic (intracellular) domain from a killer immunoglobulin-like receptor (KIR) family protein.
- the KIR gene family has at least 15 gene loci (KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DL1/S1, KIR3DL2, KIR3DL3) and two pseudogenes (KIR2DP1 and KIR3DP1) encoded within a 100-200 Kb region of the Leukocyte Receptor Complex (LRC) located on chromosome 19 (19q13.4).
- LRC Leukocyte Receptor Complex
- a cell comprising the CAAR of the invention comprising a KIR transmembrane domain and/or cytoplasmic domain may also comprise a polynucleotide encoding DAP10 or DAP12.
- the KIR is KIRS2 or KIR2DS2
- the CAAR is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 25, 27, 29, 31, 33, 35, 37, and 39. In certain embodiments, the CAAR comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 26, 28, 30, 32, 34, 36, 38, 40, and 42.
- the CAAR comprises an amino acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the amino acid sequences set forth in SEQ ID NOs: 12, and 18, 26, 28, 30, 32, 34, 36, 38, or 40.
- the CAAR is encoded by a nucleic acid sequence that has at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the nucleic acid sequence set forth in SEQ ID NO: 11, 17, 25, 27, 29, 31, 33, 35, 37, or 39.
- a 3 rd generation self-inactivating lentiviral vector plasmid can be used in which the expression of the CAR is regulated by the human elongation factor 1 alpha promoter. This results in stable (permanent) expression of the CAR in the host T cell.
- the encoding mRNA can be electroporated into the host cell, which would achieve the same therapeutic effect as the virally transduced T cells, but would not be permanent because the mRNA would dilute out with cell division.
- the invention includes a vector comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide comprises an extracellular domain comprising a human PLA2R autoantigen or fragment thereof, and optionally, a transmembrane domain, and/or an intracellular signaling domain.
- the vector comprises any of the nucleic acid sequences encoding the CAAR as described herein.
- the vector comprises a plasmid vector, viral vector, retrotransposon (e.g. piggyback, sleeping beauty), site directed insertion vector (e.g. CRISPR, Zinc finger nucleases, TALEN), or suicide expression vector, or other known vector in the art.
- the vector is a viral vector, such as a lentiviral vector.
- the vector is a RNA vector.
- the expression of the PLA2R CAAR can be verified by sequencing. Expression of the full length CAAR protein may be verified using immunoblot, immunohistochemistry, flow cytometry or other technology well known and available in the art.
- the present invention also provides a vector in which DNA encoding the CAAR of the present invention is inserted.
- Vectors including those derived from retroviruses such as lentivirus, are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
- Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses, such as murine leukemia viruses, in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of resulting in low immunogenicity in the subject into which they are introduced.
- the expression of natural or synthetic polynucleotides encoding CAARs is typically achieved by operably linking a nucleic acid encoding the CAAR polypeptide or portions thereof to a promoter (e.g. EF1alpha promoter), and incorporating the construct into an expression vector.
- the vector is one generally capable of replication in a mammalian cell, and/or also capable of integration into the cellular genome of the mammal.
- Typical vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
- the nucleic acid can be cloned into any number of different types of vectors.
- the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
- Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
- the expression vector may be provided to a cell in the form of a viral vector.
- Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals.
- Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
- a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
- promoter elements e.g., enhancers
- promoters regulate the frequency of transcriptional initiation.
- these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
- the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
- tk thymidine kinase
- the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
- individual elements can function either cooperatively or independently to activate transcription.
- CMV immediate early cytomegalovirus
- This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
- other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, the elongation factor-1 ⁇ promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, when appropriate for use in a CAAR construct.
- SV40 simian virus 40
- MMTV mouse mammary tumor virus
- HSV human immunodeficiency virus
- LTR
- inducible promoters are also contemplated as part of the invention.
- the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence, which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
- inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
- an inducible promoter is activated in response to a extracellular ligand.
- the inducible promoter is activated (and the expression of the CAAR is regulated) by an extracellular ligand binding to a synthetic receptor.
- a synthetic receptor e.g., a synthetic Notch receptor (i.e., “synNotch”) may be employed as a binding-triggered transcriptional switch that, when bound to its ligand, activates a promoter to which a nucleic acid sequence encoding the CAAR is operably linked.
- such systems may require the presence of a ligand (e.g., to which the synNotch binds) for the immune cell to be responsive to a BCR or autoantibody (e.g., to which the CAAR binds).
- a ligand e.g., to which the synNotch binds
- BCR or autoantibody e.g., to which the CAAR binds.
- the requirement of particular combinations to generate certain signaling outputs in molecular circuits results in a logic gate. See, for example, Roybal et al., 2016 Cell 164(4):770-9.
- Examples of other systems for expressing or regulating expression of a chimeric receptor include those described in Wu et al. (2015) Science 350: aab4077; Fedorov et al. (2014) Cancer Journal 20:160-165; Kloss et al. (2013) Nature Biotechnology 31: 71-75; Sakemura et al. (2016) Cancer Immunol. Res. 4:658-668; Hill et al. (2016) Nature Chemical Biology 14:112-117; Di Stasi et al. (2011) N. Engl. J. Med. 365:1673-1683; Budde et al. (2013) PLoS One 8: e82742; Wei et al. (2012) Nature 488: 384-388; Ma et al. (2016) Proc.
- the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
- the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
- Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
- Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
- a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assessed at a suitable time after the DNA has been introduced into the recipient cells.
- Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82).
- Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
- the construct with the minimal 5′ flanking region showing the highest level of expression of reporter gene is identified as the promoter.
- Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
- the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
- the expression vector can be transferred into a host cell by physical, chemical, or biological means.
- Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like.
- Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY).
- RNA vectors include vectors having a RNA promoter and/other relevant domains for production of a RNA transcript.
- Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
- Other viral vectors may be derived from lentivirus, poxviruses, herpes simplex virus, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
- Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
- an exemplary delivery vehicle is a liposome.
- lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
- the nucleic acid may be associated with a lipid.
- the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
- Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
- Lipids are fatty substances, which may be naturally occurring or synthetic lipids.
- lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- Lipids suitable for use can be obtained from commercial sources.
- DMPC dimyristyl phosphatidylcholine
- DCP dicetyl phosphate
- Choi cholesterol
- DMPG dimyristyl phosphatidylglycerol
- Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about ⁇ 20° C.
- Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
- compositions that have different structures in solution than the normal vesicular structure are also encompassed.
- the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
- lipofectamine-nucleic acid complexes are also contemplated.
- Any domains and/or fragments of the CAAR, vector, and the promoter may be synthesized gene fragments amplified by PCR or any other means known in the art.
- the invention includes a genetically modified cell comprising the PLA2R chimeric autoantibody receptor (CAAR) disclosed herein.
- CAAR PLA2R chimeric autoantibody receptor
- the genetically modified cell expresses the PLA2R CAAR.
- the cell has high affinity for PLA2R autoantibody-based B cell receptors (BCRs) on B cells or rarely, on B cells that have differentiated into plasma cells that have not yet downregulated their BCR.
- BCRs PLA2R autoantibody-based B cell receptors
- the genetically modified cell can induce direct killing of anti-PLA2R B cells or indirect killing of plasma cells expressing PLA2R autoantibodies.
- the genetically modified cell has low affinity for antibodies bound to an Fc receptor.
- the genetically modified cell is a T cell, such as a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, gamma delta T cell, a natural killer cell, cytokine induced killer cell, a cell line thereof, a T memory stem cell, or other T effector cell. It is also useful for the T cell to have limited toxicity toward healthy cells and specificity to cells expressing autoantibodies. Such specificity prevents or reduces off-target toxicity that is prevalent in current therapies that are not specific for autoantibodies. In one embodiment, the T cell has limited toxicity toward healthy cells. In one embodiment the T cell is an autologous cell. In another embodiment, the T cell is an allogeneic cell.
- the invention includes genetically modified immune cells derived from pluripotent stem cells that were differentiated in vitro.
- the invention includes T cells, such as primary cells, expanded T cells derived from primary T cells, T cells derived from stem cells differentiated in vitro, T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
- T cells such as primary cells, expanded T cells derived from primary T cells, T cells derived from stem cells differentiated in vitro, T cell lines such as Jurkat cells, other sources of T cells, combinations thereof, and other effector cells.
- a transduced Jurkat cell line with a NFAT response element followed by GFP can be used to detect and isolate PLA2R specific B cells and to clone the PLA2R specific antibody repertoire in a comprehensive and unbiased fashion.
- the interacting B and Jurkat cells can be detected as GFP positive doublets or multimers and sorted by flow cytometry.
- Expression cloning of the B cell receptor encoding genes will provide further information on how auto
- CAARs to specifically bind to autoantibodies and sera, for example, primary membranous nephropathy sera, can be assessed in a Jurkat reporter cell line, which depends on activation of the CAAR by binding to plate-bound autoantibody (in response to which the activated cells fluoresce green due to an NFAT-GFP reporter construct contained therein).
- a Jurkat reporter cell line which depends on activation of the CAAR by binding to plate-bound autoantibody (in response to which the activated cells fluoresce green due to an NFAT-GFP reporter construct contained therein).
- Such methods are useful and reliable qualitative measures for functional binding ability.
- the proper processing of the autoantigen on the cell surface is also important and can be measured using monoclonal antibodies.
- truncations of PLA2R based on major disease epitopes are also useful and included herein. Versions using a different length hinge region or GS linker are also useful.
- With regard to safety preventing or reducing possible homophilic and heterophilic interactions and activ
- Constructs can be transiently transfected into human cells, such as 293T/17.
- the surface expression can be detected with monoclonal antibodies (either IgG or ScFv) or serum antibodies from PLA2R MN patients specific for the abovementioned extracellular domains, the linker between the domains, or other structure included in the CAAR. Binding can be verified with specific secondary antibodies and quantified by flow cytometry.
- Production of membrane expressed constructs of human anti-PLA2R antibodies of any isotype can serve as target cells for testing the different PLA2R-CAARs.
- Additional target cell lines can be produced as needed by expression of human monoclonal antibodies on the surface of cell lines (e.g. Nalm6 or K562 cells).
- the present invention also provides methods for preventing, treating and/or managing a disorder or autoimmune disease associated with autoantibody-expressing cells in the context of an autoantibody-mediated kidney disease.
- the methods comprise administering to a subject in need thereof a genetically modified T cell comprising the CAAR of the invention that binds to the autoantibody-expressing cell.
- the subject is a human.
- Non-limiting examples of an autoantibody-mediated kidney disease include to glomerular disease and primary membranous nephropathy.
- T cells isolated from a subject can be modified to express the appropriate CAAR, expanded ex vivo and then reinfused into the same subject (e.g., the T cells are autologous T cells).
- the T cells are reinfused into a different subject than the original T cells' donor (e.g., the T cells are allogeneic T cells).
- the modified T cells recognize target cells, such as anti-PLA2R B cells or PLA2R autoantibody producing B cells or plasma cells, and become activated, resulting in killing of the autoimmune target cells.
- Relapse may also occur in patients with an autoimmune disease, for example in primary membranous nephropathy patients.
- the relapse may be mediated by persistence of the same autoantibody B cell clones, whereas remission is associated with disappearance of these clones.
- the autoimmune cells are depleted to induce long-term remission, possibly due to the longevity of the PLA2R CAAR T cells and/or autoantigen-reactive clones do not re-appear.
- PLA2R CAAR cells can further express a detectable marker.
- the detectable marker is activated and expressed, which can be detected by assays known in the art, such as flow cytometry.
- the PLA2R CAAR includes a NFAT response element and a detectable marker, such as a green fluorescent protein (GFP), to detect and quantify PLA2R CAAR expressing cells.
- GFP green fluorescent protein
- T cells Prior to expansion and genetic modification, T cells (e.g., autologous or allogeneic T cells) are obtained from a subject. Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from a number of sources, including skin, peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available in the art, may be used.
- T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation.
- cells from the circulating blood of an individual are obtained by apheresis.
- the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
- initial activation steps in the absence of calcium lead to magnified activation.
- a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
- a semi-automated “flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
- the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
- buffers such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
- the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
- T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
- a specific subpopulation of T cells such as CD3 + , CD28 + , CD4 + , CD8 + , CD45RA + , and CD45RO + T cells, can be further isolated by positive or negative selection techniques.
- T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3 ⁇ 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
- the time period is about 30 minutes.
- the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
- the time period is at least 1, 2, 3, 4, 5, or 6 hours.
- the time period is 10 to 24 hours.
- the incubation time period is 24 hours.
- TIL tumor infiltrating lymphocytes
- subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
- multiple rounds of selection can also be used in the context of this invention. In certain embodiments, it may be desirable to perform the selection procedure and use the “unselected” cells in the activation and expansion process. “Unselected” cells can also be subjected to further rounds of selection.
- Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
- One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
- a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
- T regulatory cells are depleted by anti-CD25 conjugated beads or other similar method of selection.
- subpopulation of T cells such as, but not limited to, cells positive or expressing high levels of one or more surface markers e.g. CD28+, CD8+, CCR7+, CD27+, CD127+, CD45RA+, and/or CD45RO+ T cells, can be isolated by positive or negative selection techniques.
- the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
- a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
- concentrations can result in increased cell yield, cell activation, and cell expansion.
- use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
- the concentration of cells used is 5 ⁇ 10 6 /ml. In other embodiments, the concentration used can be from about 1 ⁇ 10 5 /ml to 1 ⁇ 10 6 /ml, and any integer value in between.
- the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C. or at room temperature.
- T cells for stimulation can also be frozen after a washing step.
- the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
- the cells may be suspended in a freezing solution.
- one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to ⁇ 80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at ⁇ 20° C. or in liquid nitrogen.
- cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
- a blood sample or an apheresis product is taken from a generally healthy subject.
- a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
- the T cells may be expanded, frozen, and used at a later time.
- samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
- the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
- agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3
- These drugs may, for example, inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
- rapamycin growth factor induced signaling
- the cells are isolated prior to and can be frozen for later use for treatment following B-cell ablative therapy, e.g., Rituxan.
- T cells are obtained from a patient directly following treatment.
- the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
- these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
- mobilization for example, mobilization with GM-CSF
- conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
- Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
- T cells are activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.
- the T cells of the invention are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
- T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
- a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
- a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
- an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol Meth. 227(1-2):53-63, 1999).
- the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols.
- the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in “cis” formation) or to separate surfaces (i.e., in “trans” formation).
- one agent may be coupled to a surface and the other agent in solution.
- the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
- the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- the two agents are immobilized on beads, either on the same bead, i.e., “cis,” or to separate beads, i.e., “trans.”
- the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
- a 1:1 ratio of each antibody bound to the beads for CD4 + T cell expansion and T cell growth is used.
- a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular embodiment an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1. In one embodiment, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect of the present invention, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain embodiments of the invention, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
- a 1:100 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:75 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:50 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:30 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:10 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:3 CD3:CD28 ratio of antibody bound to the beads is used.
- a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
- Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells.
- the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
- the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
- the ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, and 15:1 with one preferred ratio being at least 1:1 particles per T cell.
- a ratio of particles to cells of 1:1 or less is used.
- a preferred particle:cell ratio is 1:5.
- the ratio of particles to cells can be varied depending on the day of stimulation.
- the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition).
- the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation.
- particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation.
- the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation.
- particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation.
- ratios will vary depending on particle size and on cell size and type.
- the cells such as T cells
- the cells are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured.
- the agent-coated beads and cells prior to culture, are not separated but are cultured together.
- the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
- cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3 ⁇ 28 beads) to contact the T cells.
- the cells for example, 10 4 to 10 9 T cells
- beads for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1:1
- a buffer for example PBS (without divalent cations such as, calcium and magnesium).
- the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest.
- any cell number is within the context of the present invention.
- it may be desirable to significantly decrease the volume in which particles and cells are mixed together i.e., increase the concentration of cells, to ensure maximum contact of cells and particles.
- a concentration of about 2 billion cells/ml is used. In another embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
- Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain embodiments. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
- the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In another embodiment, the mixture may be cultured for 21 days. In one embodiment of the invention the beads and the T cells are cultured together for about eight days. In another embodiment, the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
- Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGF ⁇ , and TNF- ⁇ or any other additives for the growth of cells known to the skilled artisan.
- Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
- Media can include RPMI 1640, AIM-V, DMEM, MEM, ⁇ -MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
- Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
- the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C.) and atmosphere (e.g., air plus 5% CO 2 ).
- T cells that have been exposed to varied stimulation times may exhibit different characteristics.
- typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (T H , CD4 + ) that is greater than the cytotoxic or suppressor T cell population (T C , CD8 + ).
- T H , CD4 + helper T cell population
- T C cytotoxic or suppressor T cell population
- Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of T H cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of T C cells.
- infusing a subject with a T cell population comprising predominately of T C cells or T H cells may be advantageous.
- an antigen-specific subset of T C cells has been isolated it may be beneficial to expand this subset to a greater degree.
- CD4 and CD8 markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
- the invention includes a method for treating an autoantibody-mediated kidney disease in a subject.
- the method comprises: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a chimeric autoantibody receptor (CAAR), wherein the polynucleotide encodes a phospholipase A2 receptor (PLA2R) autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby treating the autoantibody-mediated kidney disease in the subject.
- CAAR chimeric autoantibody receptor
- the invention includes a method for preventing or reducing glomerulus damage in a subject at risk or suffering from an autoantibody-mediated kidney disease.
- the method comprises: administering to the subject an effective amount of a genetically modified T cell comprising a polynucleotide encoding a CAAR, wherein the polynucleotide encodes a PLA2R autoantigen or fragment thereof, and optionally, a transmembrane domain, an intracellular domain of a costimulatory molecule, and/or a signaling domain, thereby preventing or reducing glomerulus damage in the subject.
- the autoantibody-mediated kidney disease is selected from the group consisting of a glomerular disease and a primary membranous nephropathy, e.g., a primary membranous nephropathy mediated by or otherwise associated with a known anti-PLA2R autoantibody and/or BCR.
- the subject is a human.
- the anti-autoantibody immune response elicited by the CAAR-modified T cells may be an active or a passive immune response.
- the modified T cell targets a B cell.
- autoantibody expressing B cells may be susceptible to indirect destruction by CAAR-redirected T cells that have previously reacted against adjacent autoantibody-expressing cells.
- the genetically modified T cells of the invention are modified by a fully-human CAAR.
- the fully-human CAAR-genetically modified T cells may be a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal.
- the mammal is a human.
- cells are isolated from a mammal (e.g., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAAR disclosed herein.
- the CAAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
- the mammalian recipient may be a human and the CAAR-modified cell can be autologous with respect to the recipient.
- the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
- ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo.
- other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
- the present invention also includes compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
- the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised.
- the PLA2R CAAR-modified T cells of the invention are used in the treatment of diseases, disorders and conditions associated with expression of autoantibodies.
- the cells of the invention are used in the treatment of patients at risk for developing autoimmune kidney diseases, disorders and conditions associated with expression of autoantibodies.
- the present invention provides methods for the treatment or prevention of autoimmune kidney diseases, disorders and conditions associated with expression of autoantibodies (PLA2R) comprising administering to a subject in need thereof, a therapeutically effective amount of the CAAR-modified T cells of the invention.
- CAAR-modified T cells of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations.
- pharmaceutical compositions of the present invention may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
- compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- buffers such as neutral buffered saline, phosphate buffered saline and the like
- carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol
- proteins polypeptides or amino acids
- antioxidants such as glycine
- chelating agents such as EDTA or glutathione
- adjuvants e.g., aluminum hydroxide
- preservatives e.g., aluminum hydroxide
- compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented).
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- an immunologically effective amount When “an immunologically effective amount,” “an anti-BCR effective amount,” “an autoimmune disease-inhibiting effective amount,” or “therapeutic amount” is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, in some instances 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages.
- the cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).
- the optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
- activated T cells are administered to a subject. Subsequent to administration, blood is redrawn or apheresis is performed, and T cells are activated and expanded therefrom using the methods described here, and are then reinfused back into the patient. This process can be carried out multiple times every few weeks.
- T cells can be activated from blood draws of from 10cc to 400cc. In certain embodiments, T cells are activated from blood draws of 20cc, 30cc, 40cc, 50cc, 60cc, 70cc, 80cc, 90cc, or 100cc. Not to be bound by theory, using this multiple blood draw/multiple reinfusion protocol, may select out certain populations of T cells.
- the cells of the invention to be administered may be autologous, allogeneic or xenogeneic with respect to the subject undergoing therapy.
- Administration of the cells of the invention may be carried out using any convenient means, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
- the compositions described herein may be administered to a patient transarterially, subcutaneously, intradermally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally.
- the T cell compositions of the present invention are administered to a patient by intradermal or subcutaneous injection.
- the T cell compositions of the present invention are administered by i.v. injection.
- the compositions of T cells may be injected directly into a lymph node, or other site of pathophysiologic activity.
- cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as immunosuppressive agents, such as azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, Cytoxan, fludarabine, mycophenolic acid, steroids, FR901228, cytokines, and irradiation.
- immunosuppressive agents such as azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents
- CAMPATH anti-CD3 antibodies or other antibody therapies
- These drugs may, for example, inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
- cyclosporine and FK506 calcium dependent phosphatase calcineurin
- p70S6 kinase that is important for growth factor induced signaling (rapamycin).
- the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
- chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
- the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
- the T cells of the invention may be used in combination with complement inhibitors to reduce risk of complement-mediated cytotoxicity or an antibody anti-FcRn, IVIg, or plasmapheresis in order to reduce the anti-PLA2R antibody concentration before therapy.
- a mild lymphodepletion regimen e.g. Low-dose fludarabine or Cytoxan
- the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
- the scaling of dosages for human administration can be performed according to art-accepted practices.
- the dose for CAMPATH for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days.
- the preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Pat. No. 6,120,766).
- Cysteine-rich (CysR) domain (Ricin B type lectin domain) (SEQ ID NO: 1) AAGGGCATCTTCGTGATCCAGAGCGAGAGCCTGAAGAAGTGCATCCAGG CCGGCAAGAGCGTGCTGACCCTGGAAAATTGCAAGCAGGCCAACAAGCA CATGCTGTGGAAATGGGTGTCCAACCACGGCCTGTTCAACATCGGCGGC TCTGGATGTCTGGGCCTGAATTTCTCTGCCCCTGAGCAGCCTCTGAGCC TGTACGAGTGTGATAGCACCCTGGTGTCCCTGAGATGGCGGTGCAACCG GAAGATGATCACAGGCCCTCTGCAGTACTCTGTGCAGGTCGCCCACGAC AATACCGTGGTGGCCAGCAGAAAGTACATCCACAAGTGGATCAGCTACG GCAGCGGCGGAGGCGACATCTGTGAATAC Linker between ricin B type lectin domain and fibronectin type II
- CysR-FNII-CTLD1.CD8H.BBz CAAR construct 4026.CF1 (SEQ ID NO: 65) PLA2R pro-peptide 61-117 (SEQ ID NO: 62) CysR-FNII-CTLD1 118-1143 (SEQ ID NO: 42) CD8 Hinge region 1149-1284 (SEQ ID NO: 20) CD8 TMD 1285-1356 (SEQ ID NO: 22) 4-1BB intracellular domain 1357-1482 (SEQ ID NO: 72) Stop codon 1819-1821 ACTGCTGGAATGGCAGGACAAGGGCATCTTCGTGATCCAGAGCGAGC CTGAAGAAGTGCATCCAGGCCGGCAAGAGCGTGCTGACCCTGGAAAATT GCAAGCAGGCCAACAAGCACATGCTGTGGAAATGGGTGTCCAACCACGG CCTGTTCAACATCGGCGGCTCTGGATGTCTGGGCCTGAATTTCTCTGCC CCTGAGCAGCCTCTGAGCCTGTACGAGTGATAGCACCCTGGTG
- CysR-FNII-CTLD1.CD8H.BBz CAAR (construct 4026.CF1) (SEQ ID NO: 63) CysR-FNII-CTLD1 40-381 (SEQ ID NO: 43) CD8 Hinge region 384-428 (SEQ ID NO: 19) CD8 TMD 429-452 (SEQ ID NO: 21) 4-1BB intracellular domain 453-494 (SEQ ID NO: 23) LKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSA PEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYI HKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTR EGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICY QFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWM GLNQ
- 293T cells were transfected at a confluence of 90% with a mixture of the pTRPE-gene-of-interest, the packaging plasmid pGAG-Pol and pRSV-Rev and the envelope plasmid pCI VSVg in a complex with Lipofectamine 2000.
- Lentivirus containing supernatant was harvested after 24 and 48 hours, filtered through a 0.45 micron polyethersulfone (PES) membrane, concentrated at 12,000 ⁇ g for 24 hours at 4° C., and stored at ⁇ 80° C.
- PES polyethersulfone
- Jurkat cells were cultured at 37° C. with 5% CO2 in a completely humidified environment using RPMI1640, HEPES 10 mM, and FBS at 10%.
- the CAAR constructs were expressed in a Jurkat reporter cell line that has been selected (G418) for stable expression of GFP controlled under an NFAT response element, facilitating GFP expression after CAAR engagement and PLCgamma and IP3 mediated intracellular calcium release.
- Jurkat cells were transduced with CAAR lentivirus at a multiplicity of infection of 3 and expression of the CAAR construct was validated after >72 hours with an anti-PLA2R monoclonal antibody (Novus Biologicals®) and IgG purified from the plasma of a patient with primary membranous nephropathy by flow cytometry.
- an anti-PLA2R monoclonal antibody Novus Biologicals®
- IgG purified from the plasma of a patient with primary membranous nephropathy by flow cytometry.
- the CAAR Jurkat cells were incubated at 37° C. for 6 hours with plate-bound anti-PLA2R monoclonal as below. GFP expression was validated by flow cytometry.
- Jurkat-NFAT-GFP cells 1 million Jurkat-NFAT-GFP cells were transduced with each lentivirus encoding for PLA2R CAAR construct C, CF1, CF123, CF1237, CD17, C17, 4025.C, 4026.CF1, 4027.CF12, 4028.CF123 and untransduced Jurkat cells were used as negative control.
- Transduced and untransduced cells were plated in a 96-well plate at 2 ⁇ 10 5 cells/well in 100 ⁇ l cell culture medium.
- the stimulation conditions were as follows:
- transduced and untransduced cells were plated in a 96-well plate at 5 ⁇ 10 4 cells/well in 100 ⁇ l cell culture medium.
- PLA2R CAAR or mock transduced primary human T cells were cultured for 24 h at 5 ⁇ 10 4 /well in a 96-well plate coated with 10 ⁇ g/ml either IgG purified from plasma of patient with primary membranous nephropathy or control human IgG. Culture supernatants were then harvested for detection of IFN- ⁇ by ELISA.
- anti-PLA2R BCR-expressing cells for example hybridoma cells or human cell lines, targeting human PLA2R are generated.
- PLA2R BCR-expressing cells are transduced with lentiviral vectors expressing click-beetle green or click-beetle red luciferase and GFP.
- approximately 2 ⁇ 10 5 anti-PLA2R cells are injected intravenously into NSG mice (age 6-8 weeks), after pre-treatment of mice daily for 2 days with 600 mg/kg intravenous immunoglobulin to minimize Fc ⁇ R-mediated toxicity against BCR-expressing cells.
- PLA2R CAAR T cells (approximately 10 7 cells per mouse) are injected intravenously. Bioluminescence and/or serum autoantibodies are quantified every 2-3 days after injection to monitor CAAR T cell efficacy.
- FIG. 1 The general schematics of the extracellular domains of PLA2R of particular interest in the invention are illustrated in FIG. 1 .
- the N terminal domain is an immunodominant epitope that is recognized by patient serum antibodies.
- the CysR and CTLD3 domain interact to form a ring-like structure that may better present immunodominant epitopes; hence constructs including the CysR through CTLD3 domains were generated.
- serum antibody immunoreactivity to the C-type lectin domains 1 and 7 has also been reported.
- the PLA2R CAAR constructs illustrated in FIGS. 2A-2G All constructs use the CD8 transmembrane domain and BBZ intracellular domain and differ in their extracellular composition.
- Construct 4025.C was comprised of a cysteine rich extracellular domain, a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2A , SEQ ID NOs: 37 & 38).
- Construct 4026.CF1 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, and a C-type lectin 1 domain. Construct 4026.CF1 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2B , SEQ ID NOs: 39 & 40).
- Construct 4027.CF12 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, and a C-type lectin 2 domain. Construct 4027.CF12 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2C , SEQ ID NOs: 11 & 12).
- Construct 4028.CF123 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, and a C-type lectin 3 domain. Construct 4028.CF123 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2D , SEQ ID NOs: 17 & 18). A detailed map of PLA2R CAAR Construct 4028.CF123 is shown in FIG. 3A .
- FIG. 4 shows the PLA2R CAAR expression.
- the expression of PLA2R CAAR by Jurkat NFAT-GFP cells transduced with different PLA2R lentiviral constructs was measured by staining with soluble anti-PLA2R monoclonal antibody conjugated to PE.
- FIGS. 5 and 6 show T cell activation by GFP expression of Jurkat cells transduced with the indicated constructs. Negative and positive controls are shown in FIG. 5 . Test samples are shown in FIG. 6 .
- FIG. 5 depicts the negative and positive controls for PLA2R CAAR T cell activation using an isotype control (top, negative control) or PMA+ionomycin (bottom, positive control).
- FIG. 6 illustrates the activation of PLA2R CAAR T cells by specific antibodies measured as GFP expression by Jurkat NFAT-GFP cells (6 h activation). No evidence of T cell activation is seen in construct 4025.C and untransduced cells upon exposure to the monoclonal anti-PLA2R Mab or the polyclonal anti-PLA2R Ab. Specific T cell activation in response to cross-linking by the monoclonal anti-PLA2R Ab but not the polyclonal anti-PLA2R Ab is seen using constructs 4027.CF12 and 4028.CF123.
- Construct C was comprised of a cysteine rich domain, a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2A , SEQ ID NOs: 25 & 26).
- Construct CF1 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, and a C-type lectin 1 domain. Construct CF1 also included a CD8 hinge region, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2B , SEQ ID NOs: 27 & 28).
- Construct CF123 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, and a C-type lectin 3 domain. Also included in construct CF123 was a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2C , SEQ ID NOs: 29 & 30).
- Construct CF1237 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, a C-type lectin 2 domain, a C-type lectin 3 domain and a C-type lectin 7 domain. Additionally included in construct CF1237 was a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 2D , SEQ ID NOs: 31 & 32).
- Construct CF17 was comprised of an extracellular domain comprising a cysteine rich domain, a fibronectin II domain, a C-type lectin 1 domain, and a C-type lectin 7 domain. Construct CF17 also included a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 7E , SEQ ID NOs: 33 & 34).
- Construct C17 was comprised of an extracellular domain comprising a cysteine rich domain, a C-type lectin 1 domain, and a C-type lectin 7 domain. Construct C17 also included a GS linker, a CD8 transmembrane domain, a 4-1BB intracellular domain and CD3 zeta signaling domain ( FIG. 7F , SEQ ID NOs: 35 & 36).
- the various PLA2R CAAR constructs were transduced into Jurkat cells and primary human T cells. Surface expression of the PLA2R CAARs was assessed by flow cytometry using MN patient IgG, followed by APC-labeled anti-human IgG secondary antibody. All of the transduced Jurkat ( FIG. 7A ) and primary human T cells ( FIG. 7B ), but not the untransduced control cells, exhibited detectable surface expression of the CAAR constructs.
- PLA2R CAAR T cells were exposed to either plate-bound MN patient IgG or control human IgG for 24 h. IFN- ⁇ secretion was measured by ELISA of culture supernatants. MN patient IgG stimulated markedly higher IFN- ⁇ production compared to the control human IgG, reflecting primary human CAAR T cell activation after target engagement ( FIG. 9 ).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Urology & Nephrology (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Transplantation (AREA)
- Rheumatology (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/051,248 US20210095001A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862665863P | 2018-05-02 | 2018-05-02 | |
| PCT/US2019/030459 WO2019213434A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
| US17/051,248 US20210095001A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/030459 A-371-Of-International WO2019213434A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/543,429 Continuation US11884716B2 (en) | 2018-05-02 | 2021-12-06 | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells |
| US18/640,092 Continuation US20240383965A1 (en) | 2018-05-02 | 2024-04-19 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20210095001A1 true US20210095001A1 (en) | 2021-04-01 |
Family
ID=68386834
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/051,248 Abandoned US20210095001A1 (en) | 2018-05-02 | 2019-05-02 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
| US17/543,429 Active US11884716B2 (en) | 2018-05-02 | 2021-12-06 | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells |
| US18/640,092 Pending US20240383965A1 (en) | 2018-05-02 | 2024-04-19 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/543,429 Active US11884716B2 (en) | 2018-05-02 | 2021-12-06 | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells |
| US18/640,092 Pending US20240383965A1 (en) | 2018-05-02 | 2024-04-19 | Compositions and methods of phospholipase a2 receptor chimeric autoantibody receptor t cells |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US20210095001A1 (https=) |
| EP (1) | EP3813885A4 (https=) |
| JP (2) | JP7519906B2 (https=) |
| KR (1) | KR20210007998A (https=) |
| CN (1) | CN112312930A (https=) |
| AU (1) | AU2019262131A1 (https=) |
| CA (1) | CA3098865A1 (https=) |
| MX (1) | MX2020011610A (https=) |
| WO (1) | WO2019213434A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11517589B2 (en) | 2015-02-19 | 2022-12-06 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
| WO2023015239A1 (en) * | 2021-08-05 | 2023-02-09 | The Trustees Of The University Of Pennsylvania | Compositions and methods of chimeric autoantibody receptor cells expressing extended phospholipase a2 receptor fragments |
| CN116082517A (zh) * | 2022-05-26 | 2023-05-09 | 成都地奥制药集团有限公司 | 融合蛋白及其用途 |
| US11944680B2 (en) | 2020-11-04 | 2024-04-02 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12030938B2 (en) | 2021-03-17 | 2024-07-09 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12252545B2 (en) | 2019-12-11 | 2025-03-18 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113527507A (zh) * | 2020-04-16 | 2021-10-22 | 上海赛比曼生物科技有限公司 | 靶向cd22的嵌合抗原受体及其制法和应用 |
| WO2022136503A1 (en) | 2020-12-22 | 2022-06-30 | Deutsches Zentrum Für Neurodegenerative Erkrankungen E. V. (Dzne) | Chimeric autoantibody receptor (caar) comprising a nicotinic acetylcholine receptor autoantigen |
| EP4083061A1 (en) * | 2021-04-30 | 2022-11-02 | Kilometro Rosso SPA | Fusion proteins and use thereof in the treatment of membranous nephropathy |
| US20250049849A1 (en) * | 2021-12-15 | 2025-02-13 | Shanghai Synvida Biotechnology Co. Ltd. | Product and method for treating thrombocytopenia |
| CN114588881B (zh) * | 2022-03-07 | 2023-07-18 | 大连理工大学 | 免疫吸附剂及其制备方法 |
| IL317811A (en) | 2022-07-25 | 2025-02-01 | Interius Biotherapeutics Inc | Mutated polypeptides, compositions containing them and uses thereof |
| CN115838751A (zh) * | 2022-11-22 | 2023-03-24 | 迪亚莱博(张家港)生物科技有限公司 | 一种磷脂酶a2受体重组蛋白的制备方法 |
| AU2024318666A1 (en) * | 2023-08-01 | 2026-01-22 | Merida Biosciences, Inc. | Molecules for controlling autoimmune response |
Family Cites Families (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| US5199942A (en) | 1991-06-07 | 1993-04-06 | Immunex Corporation | Method for improving autologous transplantation |
| GB9125768D0 (en) | 1991-12-04 | 1992-02-05 | Hale Geoffrey | Therapeutic method |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| ZA973051B (en) | 1996-04-24 | 1998-10-12 | Genentech Inc | Type c lectins |
| CA2386270A1 (en) | 1999-10-15 | 2001-04-26 | University Of Massachusetts | Rna interference pathway genes as tools for targeted genetic interference |
| US6326193B1 (en) | 1999-11-05 | 2001-12-04 | Cambria Biosciences, Llc | Insect control agent |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| CA2406864A1 (en) | 2000-02-24 | 2001-08-30 | Life Technologies Corporation | Simultaneous stimulation and concentration of cells |
| US7572631B2 (en) | 2000-02-24 | 2009-08-11 | Invitrogen Corporation | Activation and expansion of T cells |
| AU2001275474A1 (en) | 2000-06-12 | 2001-12-24 | Akkadix Corporation | Materials and methods for the control of nematodes |
| US7745140B2 (en) | 2002-01-03 | 2010-06-29 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| AU2005250408B2 (en) | 2004-05-27 | 2010-09-23 | The Trustees Of The University Of Pennsylvania | Novel artificial antigen presenting cells and uses therefor |
| EP2318036B1 (en) * | 2008-06-30 | 2015-06-03 | The Regents of the University of Michigan | Lysosomal phospholipase a2 (lpla2) activity as a diagnostic and therapeutic target for identifying and treating systemic lupus erythematosis |
| PH12013501201A1 (en) * | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| WO2013007640A1 (en) * | 2011-07-08 | 2013-01-17 | Centre Leon Berard | Pla2r1 as anti-tumoral compound and as biomarker for the detection of cancer |
| US9708384B2 (en) * | 2011-09-22 | 2017-07-18 | The Trustees Of The University Of Pennsylvania | Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens |
| AU2013243948A1 (en) * | 2012-04-02 | 2014-10-30 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins associated with human disease |
| DK3166968T3 (da) * | 2014-05-02 | 2021-12-06 | Univ Pennsylvania | Sammensætninger og fremgangsmåder til kimæriske autoantistofreceptor-T-celler |
| KR20180072662A (ko) | 2015-07-10 | 2018-06-29 | 추 드 니스 | Pla2r1 에피토프 프로파일 및 확산의 분석을 기반으로 한 막성 신병증의 예후 및 모니터링 |
| WO2018031947A1 (en) | 2016-08-12 | 2018-02-15 | Immunowork, Llc | Diagnosis, prevention, and/or treatment of autoimmune diseases |
| WO2018127585A1 (en) | 2017-01-06 | 2018-07-12 | Txcell | Monospecific regulatory t cell population with cytotoxicity for b cells |
| CN107663235B (zh) * | 2017-08-11 | 2018-05-22 | 南京诺唯赞医疗科技有限公司 | 特发性膜性肾病相关的pla2r重组蛋白及其应用 |
-
2019
- 2019-05-02 CA CA3098865A patent/CA3098865A1/en active Pending
- 2019-05-02 US US17/051,248 patent/US20210095001A1/en not_active Abandoned
- 2019-05-02 AU AU2019262131A patent/AU2019262131A1/en not_active Abandoned
- 2019-05-02 KR KR1020207033822A patent/KR20210007998A/ko not_active Ceased
- 2019-05-02 CN CN201980042269.7A patent/CN112312930A/zh active Pending
- 2019-05-02 EP EP19796773.0A patent/EP3813885A4/en active Pending
- 2019-05-02 MX MX2020011610A patent/MX2020011610A/es unknown
- 2019-05-02 WO PCT/US2019/030459 patent/WO2019213434A1/en not_active Ceased
- 2019-05-02 JP JP2020561076A patent/JP7519906B2/ja active Active
-
2021
- 2021-12-06 US US17/543,429 patent/US11884716B2/en active Active
-
2024
- 2024-02-28 JP JP2024027975A patent/JP2024059867A/ja active Pending
- 2024-04-19 US US18/640,092 patent/US20240383965A1/en active Pending
Non-Patent Citations (1)
| Title |
|---|
| Burbelo, Peter D., Laurence H. Beck Jr, and Meryl Waldman. "Detection and monitoring PLA2R autoantibodies by LIPS in membranous nephropathy." Journal of immunological methods 444 (2017): 17-23. (Year: 2017) * |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11517589B2 (en) | 2015-02-19 | 2022-12-06 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
| US11918604B2 (en) | 2015-02-19 | 2024-03-05 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
| US11918605B1 (en) | 2015-02-19 | 2024-03-05 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
| US12252545B2 (en) | 2019-12-11 | 2025-03-18 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| US11944680B2 (en) | 2020-11-04 | 2024-04-02 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12030938B2 (en) | 2021-03-17 | 2024-07-09 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| WO2023015239A1 (en) * | 2021-08-05 | 2023-02-09 | The Trustees Of The University Of Pennsylvania | Compositions and methods of chimeric autoantibody receptor cells expressing extended phospholipase a2 receptor fragments |
| CN116082517A (zh) * | 2022-05-26 | 2023-05-09 | 成都地奥制药集团有限公司 | 融合蛋白及其用途 |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240383965A1 (en) | 2024-11-21 |
| US20220098271A1 (en) | 2022-03-31 |
| EP3813885A1 (en) | 2021-05-05 |
| MX2020011610A (es) | 2021-02-09 |
| KR20210007998A (ko) | 2021-01-20 |
| EP3813885A4 (en) | 2022-01-12 |
| AU2019262131A1 (en) | 2020-11-19 |
| JP2024059867A (ja) | 2024-05-01 |
| CN112312930A (zh) | 2021-02-02 |
| JP2021522790A (ja) | 2021-09-02 |
| WO2019213434A1 (en) | 2019-11-07 |
| JP7519906B2 (ja) | 2024-07-22 |
| US11884716B2 (en) | 2024-01-30 |
| CA3098865A1 (en) | 2019-11-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11884716B2 (en) | Compositions and methods of phospholipase A2 receptor chimeric autoantibody receptor T cells | |
| US20230303653A1 (en) | Compositions and methods of chimeric autoantibody receptor t cells | |
| US20240425564A1 (en) | Compositions and methods of muscle specific kinase chimeric autoantibody receptor cells | |
| JP2022133308A (ja) | キメラアロ抗原受容体t細胞の組成物および方法 | |
| US20260001934A1 (en) | Compositions and methods of acetycholine receptor chimeric autoantibody receptor cells | |
| US20250073265A1 (en) | Compositions and Methods of Chimeric Autoantibody Receptor Cells Expressing Extended Phospholipase A2 Receptor Fragments | |
| US20230167429A1 (en) | Compositions and methods of adamts13 chimeric autoantibody receptor cells | |
| HK40074993A (en) | Compositions and methods of chimeric autoantibody receptor t cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| AS | Assignment |
Owner name: THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA, PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GILL, SAAR;HOGAN, JONATHAN;PAYNE, AIMEE;AND OTHERS;SIGNING DATES FROM 20190603 TO 20190628;REEL/FRAME:062409/0162 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |