US20210002665A1 - Rna-guided gene editing and gene regulation - Google Patents

Rna-guided gene editing and gene regulation Download PDF

Info

Publication number
US20210002665A1
US20210002665A1 US16/858,689 US202016858689A US2021002665A1 US 20210002665 A1 US20210002665 A1 US 20210002665A1 US 202016858689 A US202016858689 A US 202016858689A US 2021002665 A1 US2021002665 A1 US 2021002665A1
Authority
US
United States
Prior art keywords
gene
cas9
target
crispr
dna
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US16/858,689
Inventor
Charles A. Gersbach
Isaac B. Hilton
Pablo Perez-Pinera
Ami M. Kabadi
Pratiksha I. Thakore
David G. Ousterout
Joshua B. Black
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Duke University
Original Assignee
Duke University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Duke University filed Critical Duke University
Priority to US16/858,689 priority Critical patent/US20210002665A1/en
Assigned to DUKE UNIVERSITY reassignment DUKE UNIVERSITY ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: KABADI, AMI M., BLACK, JOSHUA B., GERSBACH, CHARLES A., THAKORE, PRATIKSHA I., HILTON, ISAAC B., OUSTEROUT, DAVID G., PEREZ-PINERA, PABLO
Publication of US20210002665A1 publication Critical patent/US20210002665A1/en
Pending legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/465Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A61K48/0058Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4707Muscular dystrophy
    • C07K14/4708Duchenne dystrophy
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1003Transferases (2.) transferring one-carbon groups (2.1)
    • C12N9/1007Methyltransferases (general) (2.1.1.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/71Fusion polypeptide containing domain for protein-protein interaction containing domain for transcriptional activaation, e.g. VP16
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/40Systems of functionally co-operating vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/20Vectors comprising a special translation-regulating system translation of more than one cistron
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)

Definitions

  • the present disclosure relates to the field of gene expression alteration, genome engineering and genomic alteration of genes using Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/CRISPR-associated (Cas) 9-based systems and viral delivery systems.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • Cas CRISPR-associated 9-based systems and viral delivery systems.
  • the present disclosure also relates to the field of genome engineering and genomic alteration of genes in muscle, such as skeletal muscle and cardiac muscle.
  • Synthetic transcription factors have been engineered to control gene expression for many different medical and scientific applications in mammalian systems, including stimulating tissue regeneration, drug screening, compensating for genetic defects, activating silenced tumor suppressors, controlling stem cell differentiation, performing genetic screens, and creating synthetic gene circuits.
  • These transcription factors can target promoters or enhancers of endogenous genes, or be purposefully designed to recognize sequences orthogonal to mammalian genomes for transgene regulation.
  • the most common strategies for engineering novel transcription factors targeted to user-defined sequences have been based on the programmable DNA-binding domains of zinc finger proteins and transcription-activator like effectors (TALEs). Both of these approaches involve applying the principles of protein-DNA interactions of these domains to engineer new proteins with unique DNA-binding specificity. Although these methods have been widely successful for many applications, the protein engineering necessary for manipulating protein-DNA interactions can be laborious and require specialized expertise.
  • these new proteins are not always effective. The reasons for this are not yet known but may be related to the effects of epigenetic modifications and chromatin state on protein binding to the genomic target site. In addition, there are challenges in ensuring that these new proteins, as well as other components, are delivered to each cell.
  • Existing methods for delivering these new proteins and their multiple components include delivery to cells on separate plasmids or vectors which leads to highly variable expression levels in each cell due to differences in copy number. Additionally, gene activation following transfection is transient due to dilution of plasmid DNA, and temporary gene expression may not be sufficient for inducing therapeutic effects. Furthermore, this approach is not amenable to cell types that are not easily transfected. Thus another limitation of these new proteins is the potency of transcriptional activation.
  • Site-specific nucleases can be used to introduce site-specific double strand breaks at targeted genomic loci. This DNA cleavage stimulates the natural DNA-repair machinery, leading to one of two possible repair pathways. In the absence of a donor template, the break will be repaired by non-homologous end joining (NHEJ), an error-prone repair pathway that leads to small insertions or deletions of DNA. This method can be used to intentionally disrupt, delete, or alter the reading frame of targeted gene sequences. However, if a donor template is provided along with the nucleases, then the cellular machinery will repair the break by homologous recombination, which is enhanced several orders of magnitude in the presence of DNA cleavage. This method can be used to introduce specific changes in the DNA sequence at target sites.
  • NHEJ non-homologous end joining
  • Engineered nucleases have been used for gene editing in a variety of human stem cells and cell lines, and for gene editing in the mouse liver.
  • the major hurdle for implementation of these technologies is delivery to particular tissues in vivo in a way that is effective, efficient, and facilitates successful genome modification.
  • DMD Duchenne Muscular Dystrophy
  • DMD is the most common hereditary monogenic disease and occurs in 1 in 3500 males.
  • DMD is the result of inherited or spontaneous mutations in the dystrophin gene.
  • Dystrophin is a key component of a protein complex that is responsible for regulating muscle cell integrity and function. DMD patients typically lose the ability to physically support themselves during childhood, become progressively weaker during the teenage years, and die in their twenties.
  • the present invention is directed to a fusion protein comprising two heterologous polypeptide domains.
  • the first polypeptide domain comprises a Clustered Regularly Interspaced Short Palindromic Repeats associated (Cas) protein and the second polypeptide domain has an activity selected from the group consisting of transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, and demethylase activity.
  • the Cas protein may comprise Cas9.
  • the Cas9 may comprise at least one amino acid mutation which knocks out nuclease activity of Cas9.
  • the at least one amino acid mutation may be at least one of D10A and H840A.
  • the Cas protein may comprise iCas9 (amino acids 36-1403 of SEQ ID NO: 1).
  • the second polypeptide domain may have transcription activation activity.
  • the second polypeptide domain may comprise at least one VP16 transcription activation domain repeat.
  • the second polypeptide domain may comprise a VP16 tetramer (“VP64”) or a p65 activation domain.
  • the fusion protein may further comprise a linker connecting the first polypeptide domain to the second polypeptide domain.
  • the fusion protein may comprise iCas9-VP64.
  • the present invention is directed to a DNA targeting system comprising said fusion protein and at least one guide RNA (gRNA).
  • the at least one gRNA may comprise a 12-22 base pair complementary polynucleotide sequence of the target DNA sequence followed by a protospacer-adjacent motif.
  • the at least one gRNA may target a promoter region of a gene, an enhancer region of a gene, or a transcribed region of a gene.
  • the at least one gRNA may target an intron of a gene.
  • the at least one gRNA may target an exon of a gene.
  • the at least one gRNA may target a the promoter region of a gene selected from the group consisting of ASCL1, BRN2, MYTIL, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, and MYOD1.
  • the at least one gRNA may comprise at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the present invention is directed to a DNA targeting system that binds to a dystrophin gene comprising Cas9 and at least one guide RNA (gRNA).
  • the at least one gRNA may target an intron of the dystrophin gene.
  • the at least one gRNA may target an exon of the dystrophin gene.
  • the at least one guide RNA may comprise at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the DNA targeting system may comprise between one and ten different gRNAs.
  • the present invention is directed to an isolated polynucleotide encoding said fusion protein or said DNA targeting system.
  • the present invention is directed to a vector comprising said isolated polynucleotide.
  • the present invention is directed to a cell comprising said isolated polynucleotide or said vector.
  • the present invention is directed to a method of modulating mammalian gene expression in a cell.
  • the method comprises contacting the cell with said fusion protein, said DNA targeting system, said isolated polynucleotide, or said vector.
  • the gene expression may be induced.
  • the present invention is directed to a method of transdifferentiating or inducing differentiation of a cell.
  • the method comprises contacting the cell with said fusion protein, said DNA targeting system, said isolated polynucleotide, or said vector.
  • the cell may be a fibroblast cell or an induced pluripotent stem cells.
  • the fibroblast cell may be trandifferentiated into a neuronal cell or a myogenic cell.
  • the DNA targeting system may be contacted with the cell and at least one gRNA targets a promoter region of at least one gene selected from the group consisting of ASCL1, BRN2, MYOD1, and MYT1L.
  • the DNA targeting system may comprise at least one gRNA that targets the promoter region of the ASCL1 gene and at least one gRNA that targets the promoter region of the BRN2 gene.
  • the DNA targeting system may comprise between one and twenty different gRNAs.
  • the DNA targeting system may comprise 8 or 16 different gRNAs.
  • the DNA targeting system may comprise dCas9-VP64.
  • the DNA targeting system may be delivered to the cell virally or non-virally.
  • the present invention is directed to a method of correcting a mutant gene in a cell.
  • the method comprises administering to a cell containing said DNA targeting system, said isolated polynucleotide, or said vector.
  • the correction of the mutant gene may comprise homology-directed repair.
  • the method may further comprise administering to the cell a donor DNA.
  • the mutant gene may comprise a frameshift mutation which causes a premature stop codon and a truncated gene product.
  • the correction of the mutant gene may comprise nuclease mediated non-homologous end joining.
  • the correction of the mutant gene may comprise a deletion of a premature stop codon, a disruption of a splice acceptor site, a deletion of one or more exons, or disruption of a splice donor sequence. The deletion of one or more exons may result in the correction of the reading frame.
  • the present invention is directed to a method of treating a subject in need thereof having a mutant dystrophin gene.
  • the method comprises administering to the subject said DNA targeting system, said isolated polynucleotide, or said vector.
  • the subject may be suffering from Duchenne muscular dystrophy.
  • the present invention is directed to a method of correcting a mutant dystrophin gene in a cell.
  • the method comprises administering to a cell containing a mutant dystrophin gene said DNA targeting system, said isolated polynucleotide, said vector, or said cell.
  • the mutant dystrophin gene may comprise a premature stop codon, disrupted reading frame via gene deletion, an aberrant splice acceptor site, or an aberrant splice donor site, and wherein the target region is upstream or downstream of the premature stop codon, disrupted reading frame, aberrant splice acceptor site, or the aberrant splice donor site.
  • the correction of the mutant dystrophin gene may comprise homology-directed repair.
  • the method may further comprise administering to the cell a donor DNA.
  • the mutant dystrophin gene may comprise a frameshift mutation which causes a premature stop codon and a truncated gene product.
  • the correction of the mutant dystrophin gene may comprise nuclease mediated non-homologous end joining.
  • the correction of the mutant dystrophin gene may comprise a deletion of a premature stop codon, correction of a disrupted reading frame, or modulation of splicing by disruption of a splice acceptor site or disruption of a splice donor sequence.
  • the correction of the mutant dystrophin gene may comprise a deletion of exons 45-55 or exon 51.
  • the present invention is directed to a kit comprising said fusion protein, said DNA targeting system, said isolated polynucleotide, said vector, or said cell.
  • the present invention is directed to a method of modulating mammalian gene expression in a cell.
  • the method comprises contacting the cell with a polynucleotide encoding a DNA targeting system.
  • the DNA targeting system comprises said fusion protein and at least one guide RNA (gRNA).
  • the DNA targeting system may comprise between one and ten different gRNAs.
  • the different gRNAs may bind to different target regions within the target gene.
  • the target regions may be separated by at least one nucleotide.
  • the target regions may be separated by about 15 to about 700 base pairs.
  • Each of the different gRNAs may bind to at least one different target genes.
  • the different target genes may be located on same chromosome.
  • the different target genes may be located on different chromosomes.
  • the at least one target region may be within a non-open chromatin region, an open chromatin region, a promoter region of the target gene, an enhancer region of the target gene, a transcribed region of the target gene, or a region upstream of a transcription start site of the target gene.
  • the at least one target region may be located between about 1 to about 1000 base pairs upstream of a transcription start site of a target gene.
  • the at least one target region may be located between about 1 to about 600 base pairs upstream of a transcription start site of a target gene.
  • the gene expression may be induced.
  • the DNA targeting system may comprise two different gRNAs, three different gRNAs, four different gRNAs, five different gRNAs, six different gRNAs, seven different gRNAs, eight different gRNAs, nine different gRNAs, or ten different gRNAs.
  • the at least one guide RNA may target a promoter region of a gene selected from the group consisting of ASCL1, BRN2, MYT1L, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, and MYOD1.
  • the at least one guide RNA may comprise at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the at least one target region may be within an intron or an exon of a target gene.
  • the present invention is directed to a composition for inducing mammalian gene expression in a cell.
  • the composition comprises said fusion protein and at least one guide RNA (gRNA).
  • the present invention is directed to a composition for inducing mammalian gene expression in a cell.
  • the composition comprises an isolated polynucleotide sequence encoding said fusion protein and at least one guide RNA (gRNA).
  • the at least one guide RNA may target a promoter region of a gene selected from the group consisting of ASCL1, BRN2, MYT1L, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, and MYOD1.
  • the at least one guide RNA may comprise at least one of SEQ ID NOs 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the present invention is directed to a cell comprising said composition for inducing mammalian gene expression in a cell.
  • the present invention is directed to a kit comprising said composition for inducing mammalian gene expression in a cell or said cell comprising said composition for inducing mammalian gene expression in a cell.
  • the present invention is directed to a kit for inducing mammalian gene expression in a cell.
  • the kit comprises said composition for inducing mammalian gene expression in a cell or said cell comprising said composition for inducing mammalian gene expression in a cell.
  • the present invention is directed to a composition for genome editing in a muscle of a subject.
  • the composition comprises a modified adeno-associated virus (AAV) vector and a nucleotide sequence encoding a site-specific nuclease.
  • the muscle is skeletal muscle or cardiac muscle.
  • the modified AAV vector may have enhanced cardiac and skeletal muscle tissue tropism.
  • the site-specific nuclease may comprise a zinc finger nuclease, a TAL effector nuclease, or a CRISPR/Cas9 system.
  • the site-specific nuclease may bind a gene or locus in the cell of the muscle.
  • the gene or locus may be dystrophin gene.
  • the composition may further comprise a donor DNA or transgene.
  • the present invention is directed to a kit comprising said composition for genome editing in a muscle of a subject.
  • the present invention is directed to a method of genome editing in a muscle of a subject.
  • the method comprises administering to the muscle said composition for genome editing in a muscle of a subject, wherein the muscle is skeletal muscle or cardiac muscle.
  • the genome editing may comprise correcting a mutant gene or inserting a transgene. Correcting a mutant gene may comprise deleting, rearranging, or replacing the mutant gene. Correcting the mutant gene may comprise nuclease-mediated non-homologous end joining or homology-directed repair.
  • the present invention is directed to a method of treating a subject.
  • the method comprises administering said composition for genome editing in a muscle of a subject to a muscle of the subject, wherein the muscle is skeletal muscle or cardiac muscle.
  • the subject may be suffering from a skeletal muscle condition or a genetic disease.
  • the subject may be suffering from Duchenne muscular dystrophy.
  • the present invention is directed to a method of correcting a mutant gene in a subject, the method comprises administering said composition for genome editing in a muscle of a subject.
  • the muscle is skeletal muscle or cardiac muscle.
  • the composition may be injected into the skeletal muscle of the subject.
  • the composition may be injected systemically to the subject.
  • the skeletal muscle may be tibialis anterior muscle.
  • the present invention is directed to a modified lentiviral vector for genome editing in a subject comprising a first polynucleotide sequence encoding said fusion protein and a second polynucleotide sequence encoding at least one sgRNA.
  • the first polynucleotide sequence may be operably linked to a first promoter.
  • the first promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter.
  • the second polynucleotide sequence may encode between one and ten different sgRNAs.
  • the second polynucleotide sequence may encode two different sgRNAs, three different sgRNAs, four different sgRNAs, five different sgRNAs, six different sgRNAs, seven different sgRNAs, eight different sgRNAs, nine different sgRNAs, or ten different sgRNAs.
  • Each of the polynucleotide sequences encoding the different sgRNAs may be operably linked to a promoter.
  • Each of the promoters operably linked to the different sgRNAs may be the same promoter.
  • Each of the promoters operably linked to the different sgRNAs may be different promoters.
  • the promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter.
  • the sgRNA may bind to a target gene. Each of the sgRNA may bind to a different target region within one target loci. Each of the sgRNA may bind to a different target region within different gene loci.
  • the fusion protein may comprise Cas9 protein or iCas9-VP64 protein.
  • the fusion protein may comprise a VP64 domain, a p300 domain, or a KRAB domain.
  • the two or more endogenous genes may be transcriptionally activated. The two or more endogenous genes may be repressed.
  • the present invention is directed to a method of activating an endogenous gene in a cell.
  • the method comprises contacting a cell with said modified lentiviral vector.
  • the endogenous gene may be transiently activated.
  • the endogenous gene may be stably activated.
  • the endogenous gene may be transiently repressed.
  • the endogenous gene may be stably repressed.
  • the fusion protein may be expressed at similar levels to the sgRNAs.
  • the fusion protein may be expressed at different levels to the sgRNAs.
  • the cell may be a primary human cell.
  • the present invention is directed to a method of multiplex gene editing in a cell.
  • the method comprises contacting a cell with said modified lentiviral vector.
  • the multiplex gene editing may comprise correcting at least one mutant gene or inserting a transgene. Correcting a mutant gene may comprise deleting, rearranging, or replacing the at least one mutant gene. Correcting the at least one mutant gene may comprise nuclease-mediated non-homologous end joining or homology-directed repair.
  • the multiplex gene editing may comprise deleting at least one gene, wherein the gene is an endogenous normal gene or a mutant gene.
  • the multiplex gene editing may comprise deleting at least two genes.
  • the multiplex gene editing may comprise deleting between two and ten genes.
  • the present invention is directed to a method of modulating gene expression of at least one target gene in a cell.
  • the method comprises contacting a cell with said modified lentiviral vector.
  • the gene expression of at least two genes may be modulated.
  • the gene expression of between two genes and ten genes may be modulated.
  • the gene expression of the at least one target gene may be modulated when gene expression levels of the at least one target gene are increased or decreased compared to normal gene expression levels for the at least one target gene.
  • FIGS. 1A-1F show RNA-guided activation of the human IL1RN gene by iCas9-VP64.
  • FIG. 1A , FIG. 1B An RNA-guided transcriptional activator was created by fusing the inactivated Cas9 (iCas9, D10A/H840A) to the VP64 transactivation domain.
  • iCas9-VP64 recognizes genomic target sites through the hybridization of a guide RNA (gRNA) to a 20 bp target sequence.
  • gRNA guide RNA
  • FIG. 1C Expression plasmids for four gRNAs or crRNA/tracrRNAs targeted to sequences in the IL1RN promoter were co-transfected with the iCas9-VP64 expression plasmid into HEK293T cells. Activation of IL1RN expression was assessed by qRT-PCR.
  • FIG. 1D The four gRNA expression plasmids were co-transfected with iCas9-VP64 individually or in combination. Robust gene activation was observed by qRT-PCR only in response to the combination of gRNAs.
  • FIG. 1E Activation of IL1RN expression was confirmed by assessing secretion of the IL-1ra gene product into the media by ELISA.
  • IL-1ra was only detected in three of the six samples treated with the combination of gRNAs.
  • FIGS. 2A-2H show RNA-guided activation of human genes relevant to cell and gene therapy, genetic reprogramming, and regenerative medicine.
  • HEK293T cells were transfected with the iCas9-VP64 expression plasmid and four gRNAs individually or in combination.
  • FIG. 3 shows expression of iCas9-VP64. Expression of iCas9-VP64 in transfected HEK293 cells was confirmed by western blot for the N-terminal Flag epitope tag. The wt Cas9 expression plasmid does not contain the epitope tag.
  • FIG. 4 shows positions of gRNA target sites and DNAse hypersensitivity of human target genes.
  • the four gRNA target sites for each locus are designated as custom tracks above each gene and DNase-seq data indicating DNAse-hypersensitive open chromatin regions is shown below each gene.
  • DNase-seq was performed in HEK293T cells to identify DNase hypersensitive regions, as previously described (Song et al., Cold Spring Harbor protocols 2010, pdb prot5384 (2010); Song et al. Genome Res 21, 1757-1767 (2011)). The results show that open chromatin was not a requirement for gene activation by combinations of gRNAs with iCas9-VP64.
  • FIG. 5 shows the absence of nuclease activity by iCas9-VP64.
  • Wild-type Cas9 or inactivated (D10A, H840A) iCas9-VP64 expression plasmids were co-transfected with expression plasmids for four different guide RNAs targeting the IL1RN promoter.
  • Nuclease activity was determined by the Surveyor assay (Guschin et al., Methods Mol Biol 649, 247-256 (2010)).
  • the lower molecular weight bands indicative of nuclease activity and DNA repair by non-homologous end joining are only present following treatment with wild-type Cas9, supporting abrogation of nuclease activity by iCas9-VP64.
  • FIG. 6 shows RNA-seq for samples treated with gRNAs targeting HBG1 and HBG2.
  • FIG. 7 shows upregulation of Ascl1 and ⁇ -globin by iCas9-VP64.
  • HEK293T cells were transfected with iCas9-VP64 and four gRNAs targeting the ASCL1 or HBG1 promoter.
  • Levels of corresponding Ascl1 and ⁇ -globin protein production were assessed by western blot. Low levels of these proteins were detectable in HEK293T cells and increases in expression were detectable following iCas9-VP64 treatment in two independent experiments.
  • FIGS. 8A-8H show activation of downstream targets of Ascl1 in iCas9-VP64-treated murine embryonic fibroblasts.
  • Mouse embryonic fibroblasts (MEFs) were transfected with a control GFP expression plasmid or the iCas9-VP64 expression plasmid and a combination of four gRNA expression plasmids targeting ASCL1 at a ratio of 50:50 or 75:25.
  • FIG. 8A The gRNA target sites in the human ASCL1 promoter (SEQ ID NO: 3) are conserved in the mouse ASCL1 promoter (SEQ ID NO: 4). Target sites are indicated by solid lines and the transcribed region is indicated by dashed line.
  • FIG. 8A The gRNA target sites in the human ASCL1 promoter (SEQ ID NO: 3) are conserved in the mouse ASCL1 promoter (SEQ ID NO: 4). Target sites are indicated by solid lines and the transcribed region is indicated by dashed line. ( FIG
  • FIGS. 8C-8H After 10 days in neural induction media, cells were stained for Ascl1 and Tuj1, an early marker of neuronal differentiation ( FIGS. 8C-8D ), or for Tuj1 and MAP2, a marker of more mature neuronal differentiation ( FIGS. 8D-8F ).
  • Some Tuj1-positive cells adopted neuronal morphologies ( FIGS. 8F-8G ) and a single cell was found to be positive for Tuj1 and MAP2 ( FIG. 8G ).
  • FIG. 9A shows the iCas9-VP64 protein sequence (SEQ ID NO: 1) and FIG. 9B shows the sequence of the gRNA expression cassette with U6 promoter (SEQ ID NO: 2).
  • FIG. 10 shows the standard curves for qRT-PCR.
  • the experimental sample with the highest expression level was diluted to create a standard curve that was assayed by qRT-PCR to ensure efficient amplification over an appropriate dynamic range.
  • the efficiencies of all amplification reactions were within 90-115%.
  • FIGS. 11A-11C show the validation of RNA-guided repair.
  • FIG. 11A shows the Surveyor assay results of genomic DNA harvested from HEK 293T cells two days after Cas9 was co-transfected into the cells with empty vector (negative control) or gRNA.
  • FIG. 11B shows the location of the gRNA target.
  • FIG. 11C shows the expected cleavage sizes for each gRNA.
  • FIG. 12 shows RNA-guided repair in DMD 8036 (del48-50) cells as shown by Surveyor assay.
  • FIG. 13 shows RNA-guided repair in DMD 8036 (del48-50) cells as shown by PCR across the entire locus.
  • the PCR of a wild-type dystrophin gene generates a fragment of 1447 bp in size, whereas PCR of the mutant gene in the DMD 8036 cell line shows a deletion of approximately 817 bp.
  • the deletion band after introduction of the CRISPR/Cas9-based system was approximately 630 bp.
  • FIG. 14 shows RNA-guided repair in DMD 8036 (del48-50) cells as shown by Western blot with MANDYS8 (anti-dystrophin antibody) and GAPDH antibody (positive control).
  • FIG. 15 shows ChIP sequencing data illustrating the specific binding of iCas9-VP64 targeting the IL1RN promoter.
  • HEK 293T cells were transfected with iCas9-VP64 targeting the IL1RN promoter.
  • FIGS. 16A-16D CRISPR/Cas9 targeting of the dystrophin gene.
  • FIG. 16A sgRNA sequences were designed to bind sequences in the exon 45-55 mutational hotspot region of the dystrophin gene, such that gene editing could restore dystrophin expression from a wide variety of patient-specific mutations. Arrows within introns indicate sgRNA targets designed to delete entire exons from the genome. Arrows within exons indicate sgRNA targets designed to create targeted frameshifts in the dystrophin gene.
  • FIG. 16B Example of frame correction following introduction of small insertions or deletions by NHEJ DNA repair in exon 51 using the CR3 sgRNA.
  • FIG. 16B discloses SEQ ID NOS 633-636, respectively, in order of appearance.
  • FIG. 16C Schematic of multiplex sgRNA targets designed to delete exon 51 and restore the dystrophin reading frame in a patient mutation with the deletion of exons 48-50.
  • FIG. 16D Schematic of multiplex sgRNA targets designed to delete the entire exon 45-55 region to address a variety of DMD patient mutations.
  • FIG. 17 shows images of TBE-PAGE gels used to quantify Surveyor assay results to measure day 3 gene modification in Table 7.
  • Asterisks mark expected sizes of bands indicative of nuclease activity.
  • FIG. 18 shows images of TBE-PAGE gels used to quantify Surveyor assay results to measure day 10 gene modification in Table 7.
  • Asterisks mark expected sizes of bands indicative of nuclease activity.
  • FIGS. 19A-19D show fluorescence-activated flow sorting to enrich genetically modified DMD myoblasts.
  • FIG. 19A A plasmid expressing a human-codon optimized SpCas9 protein linked to a GFP marker using a T2A ribosomal skipping peptide sequence was co-electroporated into human DMD myoblasts with one or two plasmids carrying sgRNA expression cassettes.
  • FIG. 19B The indicated sgRNA expression cassettes were independently co-transfected into HEK293 Ts with a separate plasmid expressing SpCas9 with (bottom) or without (top) a GFP marker linked to SpCas9 by a T2A ribosomal skipping peptide sequence. Gene modification frequencies were assessed at 3 days post-transfection by the Surveyor assay.
  • FIG. 19C DMD myoblasts with deletions of exons 48-50 in the dystrophin gene were treated with sgRNAs that correct the dystrophin reading frame in these patient cells. Gene modification was assessed at 20 days post-electroporation in unsorted (bulk) or GFP+ sorted cells.
  • FIG. 19D GFP expression in DMD myoblasts 3 days after electroporation with indicated expression plasmids. Transfection efficiencies and sorted cell populations are indicated by the gated region.
  • FIGS. 20A-20D show targeted frameshifts to restore the dystrophin reading frame using CRISPR/Cas9.
  • FIG. 20A The 5′ region of exon 51 was targeted using a sgRNA (SEQ ID NO: 637), CR3, that binds immediately upstream of the first out-of-frame stop codon. PAM: protospacer-adjacent motif.
  • FIG. 20B The exon 51 locus was PCR amplified from HEK293T cells treated with SpCas9 and CR3 expression cassettes. Sequences of individual clones were determined by Sanger sequencing. The top sequence (bolded, exon in red) is the native, unmodified sequence. The number of clones for each sequence is indicated in parentheses.
  • FIG. 20C Summary of total gene editing efficiency and reading frame conversions resulting from gene modification shown in FIG. 20B .
  • FIG. 20D Western blot for dystrophin expression in human DMD myoblasts treated with SpCas9 and the CR3 sgRNA expression cassette ( FIG. 19C ) to create targeted frameshifts to restore the dystrophin reading frame. Dystrophin expression was probed using an antibody against the rod-domain of the dystrophin protein after 6 days of differentiation.
  • FIGS. 21A-21D show deletion of exon 51 from the human genome using multiplex CRISPR/Cas9 gene editing.
  • FIG. 21A End-point genomic PCR across the exon 51 locus in human DMD myoblasts with a deletion of exons 48-50. The top arrow indicates the expected position of full-length PCR amplicons and the two lower arrows indicate the expected position of PCR amplicons with deletions caused by the indicated sgRNA combinations.
  • FIG. 21B PCR products from FIG. 21A were cloned and individual clones were sequenced to determine insertions and deletions present at the targeted locus (SEQ ID NOS 424, 638, 425-428, 639 and 429-431, respectively, in order of appearance).
  • FIG. 21C End-point RT-PCR analysis of dystrophin mRNA transcripts in CRISPR/Cas9-modified human ⁇ 48-50 DMD myoblasts treated with the indicated sgRNAs. A representative chromatogram of the expected deletion PCR product is shown at the right. Asterisk: band resulting from hybridization of the deletion product strand to the unmodified strand.
  • FIG. 21D Rescue of dystrophin protein expression by CRISPR/Cas9 genome editing was assessed by western blot for the dystrophin protein with GAPDH as a loading control. The arrow indicates the expected restored dystrophin protein band.
  • FIGS. 22A-22D show deletion of the entire exon 45-55 region in human DMD myoblasts by multiplex CRISPR/Cas9 gene editing.
  • FIG. 22A End-point genomic PCR of genomic DNA to detect deletion of the region between intron 44 and intron 55 after treating HEK293 Ts or DMD myoblasts with the indicated sgRNAs.
  • FIG. 22B Individual clones of PCR products (SEQ ID NOS 432, 643 and 433, respectively, in order of appearance) of the expected size for the deletions from DMD myoblasts in FIG. 22A were analyzed by Sanger sequencing to determine the sequences of genomic deletions present at the targeted locus.
  • FIG. 22C End-point RT-PCR analysis of dystrophin mRNA transcripts in CRISPR/Cas9-modified human ⁇ 48-50 DMD myoblasts treated with the indicated sgRNAs. A representative chromatogram of the expected deletion PCR product is shown at the right (SEQ ID NO: 645).
  • FIG. 22D Analysis of restored dystrophin protein expression by western blot following electroporation of DMD myoblasts with sgRNAs targeted to intron 44 and/or intron 55.
  • FIG. 23 shows verification of flow cytometry-based enrichment of gene-modified DMD myoblasts used for in vivo cell transplantation experiment.
  • DMD myoblasts were treated with Cas9 with or without sgRNA expression vectors for CR1 and CR5 and sorted for GFP+ cells by flow cytometry. Deletions at the exon 51 locus were detected by end-point PCR using primers flanking the locus.
  • Neg ctrl DMD myoblasts treated with Cas9 only and sorted for GFP+ cells.
  • FIG. 24 shows expression of restored human dystrophin in vivo following transplantation of CRISPR/Cas9-treated human DMD myoblasts into immunodeficient mice.
  • Human ⁇ 48-50 DMD myoblasts were treated with SpCas9, CR1, and CR5 to delete exon 51 and sorted for GFP expression as shown in FIGS. 19A-19D .
  • These sorted cells and untreated control cells were injected into the hind limbs of immunodeficient mice and assessed for human-specific protein expression in muscle fibers after 4 weeks post-transplantation.
  • Cryosections were stained with anti-human spectrin, which is expressed by both uncorrected and corrected myoblasts that have fused into mouse myofibers, or anti-human dystrophin antibodies as indicated.
  • White arrows indicate muscle fibers positive for human dystrophin.
  • FIGS. 25A-25F show additional immunofluorescence images probing human dystrophin expression. Serial sections from regions stained with anti-human spectrin are shown inset in top left.
  • FIG. 25A - FIG. 25C Sections from muscles injected with untreated human DMD myoblasts.
  • FIG. 25D - FIG. 25F Sections from muscles injected with CR1/5 treated human DMD myoblasts enriched by flow cytometry. White arrows indicate dystrophin positive fibers.
  • FIGS. 26A-26D shows evaluation of CRISPR/Cas9 toxicity and off-target effects for CR1/CR5-mediated deletion of exon 51 in human cells.
  • FIG. 26A Results of a cytotoxicity assay in HEK293T cells treated with human-optimized SpCas9 and the indicated sgRNA constructs. Cytotoxicity is based on survival of GFP-positive cells that are co-transfected with the indicated nuclease. I-SceI is a well-characterized non-toxic meganuclease and GZF3 is a known toxic zinc finger nuclease.
  • FIG. 26A Results of a cytotoxicity assay in HEK293T cells treated with human-optimized SpCas9 and the indicated sgRNA constructs. Cytotoxicity is based on survival of GFP-positive cells that are co-transfected with the indicated nuclease. I-SceI is a well-characterized non-toxic meganuclease and
  • FIG. 26B Surveyor analysis at off-target sites in sorted hDMD cells treated with expression cassettes encoding Cas9 the indicated sgRNAs. These three off-target sites tested in hDMD cells were identified from a panel of 50 predicted sites tested in HEK293T cells ( FIG. 27 and Table 4). TGT: on-target locus for indicated sgRNA. OT:off-target locus.
  • FIG. 26C , FIG. 26D End-point nested PCR to detect chromosomal translocations in ( FIG. 26C ) HEK293T cells treated with Cas9 and CR1 or ( FIG. 26D ) sorted hDMD cells treated with Cas9, CR1, and CR5.
  • the schematic depicts the relative location of nested primer pairs customized for each translocation event.
  • the expected size of each band was estimated based on the primer size and the location of the predicted sgRNA cut site at each locus. Asterisks indicate bands detected at the expected size.
  • the identities of the bands in FIG. 26C were verified by Sanger sequencing from each end ( FIG. 30 ).
  • a representative chromatogram for the P2/P5 translocation in HEK293T cells is shown (SEQ ID NO: 646).
  • FIG. 27 shows images of TBE-PAGE gels used to quantify Surveyor assay results to measure on-target and off-target gene modification in Table 4.
  • Asterisks mark expected sizes of bands indicative of nuclease activity.
  • FIGS. 28A-28C show end-point nested PCR to detect chromosomal translocations caused by CRISPR/Cas9 off-target activity for CR3 and CR6/CR36 in human cells. Nested end-point PCR analysis was used to detect translocations in ( FIG. 28A ) HEK293T or sorted hDMD cells treated with Cas9 and CR3 as indicated, ( FIG. 28B ) HEK293T cells treated with Cas9 and CR36 alone, or ( FIG. 28C ) sorted hDMD cells treated with Cas9, CR6, and CR36 expression cassettes.
  • the second nested PCR reaction for translocation was amplified using custom primers for each predicted translocation locus to maximize specificity (See Table 4).
  • the schematic depicts the relative location of nested primer pairs used to probe for the presence of translocations.
  • Each possible translocation event was first amplified from genomic DNA isolated from cells treated with or without the indicated sgRNA(s).
  • a second nested PCR reaction was performed using primers within the predicted PCR amplicons that would result from translocations. Expected size was estimated based on the indicated primer binding site and the predicted sgRNA cut site at each locus. *indicates bands detected at the expected size and verified by Sanger sequencing from each end. # indicates amplicons in which Sanger sequencing showed sequences other than the predicted translocation, likely a result of mispriming during the nested PCR.
  • FIG. 29 shows Sanger sequencing chromatograms (SEQ ID NOS 647-654, respectively, in order of appearance) for bands detected in FIGS. 28A-28C resulting from translocations between CR3 and CR3-OT1, on chromosomes X and 1, respectively, in HEK293T cells treated with Cas9 and CR3 gene cassettes. Arrows show regions of homology to the indicated chromosome nearby the expected break points caused by the appropriate sgRNAs. Note that sequencing reads become out of phase near the break point due to the error-prone nature of DNA repair by non-homologous end-joining.
  • FIG. 30 shows Sanger sequencing chromatograms (SEQ ID NOS 655-660, respectively, in order of appearance) for bands detected in FIG. 26C resulting from translocations between CR1 and CR1-OT1, on chromosomes X and 16, respectively, in HEK293T cells treated with Cas9 and CR1 gene cassettes. Arrows show regions of homology to the indicated chromosome nearby the expected break points caused by the appropriate sgRNAs. Note that sequencing reads become out of phase near the break point due to the error-prone nature of DNA repair by non-homologous end-joining.
  • FIG. 31 shows an overview of in vivo AAV injections and tissue harvest.
  • FIGS. 32A-32C show Surveyor analysis of Rosa26 ZFN activities in skeletal muscle in vitro and in vivo following delivery of AAV-SASTG-ROSA. Arrows indicate expected bands resulting from Surveyor cleavage. n.d.: not detected.
  • FIG. 32A Proliferating C2C12s were transduced with the indicated amount of virus and harvested at 4 days post-infection. Arrows indicate expected bands sizes resulting from Surveyor cleavage.
  • FIG. 32B C2C12s were incubated in differentiation medium for 5 days and then transduced with the indicated amount of AAV-SASTG-ROSA virus in 24 well plates. Samples were collected at 10 days post-transduction.
  • FIG. 32A Proliferating C2C12s were transduced with the indicated amount of virus and harvested at 4 days post-infection. Arrows indicate expected bands sizes resulting from Surveyor cleavage.
  • FIG. 32B C2C12s were incubated in differentiation medium for 5 days and then transduced with
  • FIG. 33 shows Rosa T2A opt DNA sequence (SEQ ID NO: 434) and Rosa T2A opt protein sequence (SEQ ID NO: 435).
  • FIG. 34 shows SASTG capsid DNA sequence (SEQ ID NO:436) and SASTG capsid peptide sequence (SEQ ID NO: 437).
  • FIG. 35 shows DZF16 ZFN target site sequence (SEQ ID NO: 442), DZF16-L6 left full amino acid sequence (SEQ ID NO: 443) and DZF16-R6 right full amino acid sequence (SEQ ID NO: 444).
  • FIG. 36 shows E51C3 ZFN target site sequence (SEQ ID NO: 445), E51C3-3L left full amino acid sequence (SEQ ID NO: 446) and E51C3-3R right full amino acid sequence (SEQ ID NO: 447).
  • FIG. 37 shows DZF15 ZFN target site sequence (SEQ ID NO: 448), DZF15-L6 left full amino acid sequence (SEQ ID NO: 449), DZF15-R6 right full amino acid sequence (SEQ ID NO: 450), DZF15-L5 left full amino acid sequence (SEQ ID NO: 451), DZF15-R5 right full amino acid sequence (SEQ ID NO: 452).
  • FIG. 38 shows E51C4 ZFN target site sequence (SEQ ID NO: 453), E51C4-4L left full amino acid sequence (SEQ ID NO: 454) and E51C4-4R right full amino acid sequence (SEQ ID NO: 455).
  • FIG. 39 shows schematic diagrams of a “Single vector, multiplex CRISPR system,” Dual vector, multiplex CRISPR system,” and “Single vector, single gRNA system.”
  • FIG. 40 shows the nucleotide sequences of SaCas9-NLS (with the NLS underlined) (SEQ ID NO: 459) and SaCas9 gRNA (SEQ ID NO: 460).
  • FIG. 41 shows the nucleotide sequences of NmCas9 (with the NLS 1 underlined, the NLS 2 underlined and bolded, and the HA tag bolded), NmCas9 short hairpin from Thomson PNAS 2013 (SEQ ID NO: 462), and NmCas9 long hairpin from Church Nature Biotech 2013 (SEQ ID NO: 463).
  • FIGS. 42A-42C show validation of sgRNA and lentiviral Cas9 expression constructs.
  • FIG. 42A Constructs encoding unique Pol III promoters expressing sgRNAs targeting the AAVS1 locus or a construct containing the hU6 promoter immediately followed by poly-thymidine to terminate expression (“PolyT”) were transfected into HEK293T cells. End-point RT-PCR was used to probe for expression of each indicated promoter/sgRNA construct two days post-transfection. -RT: no reverse transcriptase control.
  • FIG. 42A Constructs encoding unique Pol III promoters expressing sgRNAs targeting the AAVS1 locus or a construct containing the hU6 promoter immediately followed by poly-thymidine to terminate expression (“PolyT”) were transfected into HEK293T cells. End-point RT-PCR was used to probe for expression of each indicated promoter/sgRNA construct two days post-transfection.
  • HEK293 Ts were transfected with expression vectors encoding the AAVS1 zinc-finger nuclease or Cas9-T2A-GFP and the indicated promoter/sgRNA expression cassettes and assessed for gene modification levels 3 days post-transfection using the Surveyor assay.
  • FIG. 42C HEK293T cells were transduced with lentiviral constructs encoding the indicated Cas9-T2A-GFP constructs without sgRNAs and assessed for Cas9 expression by western blot 7 days post-transduction by probing for a FLAG epitope tag on the N-terminus of the Cas9 protein.
  • FIG. 43 shows Golden Gate assembly of single lentiviral CRISPR/Cas9 expression cassettes.
  • FIG. 43 discloses SEQ ID NOS 661-672, respectively, in order of appearance.
  • FIGS. 44A-44B show single lentiviral delivery of a multiplex CRISPR/Cas9 system.
  • FIG. 44A Four sgRNAs targeting distinct genomic loci were cloned into a lentiviral vector expressing the active Cas9 nuclease.
  • FIG. 44B HEK293 Ts and primary human dermal fibroblasts were transduced with lentivirus expressing the indicated sgRNAs and assayed for cleavage events using the Surveyor assay.
  • HEK293 Ts were assayed 7 days post transduction.
  • the human fibroblasts were assayed 10 days post transduction.
  • FIGS. 45A-45D show transient gene activation in HEK293 Ts stably expressing dCas9-VP64.
  • HEK293 Ts were transduced with lentivirus to stably express dCas9-VP64 and were subsequently transfected with plasmid expressing the indicated sgRNA combinations.
  • tunable endogenous gene activation of the endogenous IL1RN ( FIG. 45A ) and HBG1 ( FIG. 45B ) loci was achieved 3 days post transfection. Peak levels of endogenous IL1RN ( FIG. 45C ) and HBG1 ( FIG. 45D ) were observed 3-6 days post transfection and the level of activation returned to background levels between days 15-20.
  • the cell lines were able to reactive following a second transfection on day 20 albeit at a lower level than previously observed.
  • FIGS. 46A-46D show stable gene activation in HEK293 Ts using a single lentiviral multiplex dCas9-VP64 vector.
  • HEK293 Ts were transduced with lentivirus to stably express dCas9-VP64 and the indicated combinations of gRNAs.
  • tunable endogenous gene activation of the endogenous IL1RN ( FIG. 46A ) and HBG1 ( FIG. 46B ) loci was achieved 7 days post transduction. Peak levels of endogenous IL1RN ( FIG. 46C ) and HBG1 ( FIG. 46D ) were observed 6 days post transduction and the level of activation was sustained out to day 21.
  • FIG. 47 shows IL1RN mRNA expression levels.
  • FIG. 48 shows a schematic representing the direct conversion of fibroblasts to neurons through ectopic expression of the BAM neuronal transcription factors.
  • FIGS. 49A-49C show ( FIG. 49A ) Schematic of the dCas9-VP64 construct.
  • dCas9-VP64 is a catalytically inactive form of the Cas9 protein fused to a tetramer of the VP16 transcriptional activation domain.
  • FIG. 49B Schematic showing the mechanism of RNA-guided recruitment of dCas9-VP64 to a genomic target.
  • FIG. 49C Schematic of the experimental protocol to generate iNs with CRISPR/Cas9 transcription factors.
  • FIGS. 50A-50B show endogenous ASCL1 expression at day 3 determined by ( FIG. 50A ) qRT-PCR or total ASCL1 protein detected by ( FIG. 50B ) immunofluorescence in MEFs transduced with dCas9-VP64 and transfected with either gRNAs targeted to the ASCL1 promoter, ASCL1 cDNA, or luciferase.
  • Asterisk (*) indicates significant (p ⁇ 0.05) increase in ASCL1 expression with the co-delivery of 8 gRNAs compared to 4 gRNAs.
  • Ectopic expression of ASCL1 produced more protein than induced by dCas9-VP64 and 8 gRNAs targeted to the Ascl1 promoter, but did not activate the endogenous locus by day 3 in culture.
  • FIG. 51A shows TUJ1 and MAP2-positive cells generated by ectopic BAM factors or by dCas9-VP64 and gRNAs targeted to the BRN2 and ASCL1 promoters.
  • FIG. 51B shows cells with neuronal morphology expressing a hSyn-RFP reporter at day 11 in N3 medium.
  • FIG. 52A shows a cell with neuronal morphology positive for the GCaMP5 calcium indicator in the presence (bottom) or absence (top) of KCl in the culture medium.
  • FIG. 52B shows a trace of normalized fluorescent intensity over time showing depolarization of the cell in response to KCl addition.
  • FIGS. 53A-53C show the CRISPR/Cas9 platform for control of mammalian gene regulation.
  • FIG. 53A Cas9-based effectors bind genomic sequences in the presence of a chimeric gRNA molecule consisting of a constant region that complexes with Cas9 preceded by an exchangeable 20 bp protospacer that confers target site specificity.
  • FIG. 53A discloses SEQ ID NO: 673.
  • FIG. 53B Cas9-based synthetic transcription factors repress transcription of a target gene by interfering with RNA polymerase activity or by binding within the promoter and blocking the binding sites of endogenous transcription factors.
  • FIG. 53C Targeting regulatory elements such as enhancers could also potentially block the expression of multiple distal genes.
  • FIG. 54 shows targeting the HS2 enhancer using CRISPR/dCas9-KRAB.
  • the HS2 region is a potent enhancer that distally regulates the expression of globin genes >10 kb downstream.
  • a panel of single gRNAs was designed to target sites along the enhancer region.
  • FIGS. 55A-55E show that single gRNAs targeting the HS2 enhancer effect potent transcriptional repression of globin genes.
  • FIG. 55A dCas9 and dCas9-KRAB repressors were delivered on a lentiviral vector. Single gRNAs were transiently transfected for screening. When assayed by quantitative RT-PCR at 3 days post-transfection, K562s expressing dCas9-KRAB achieve up to 80% repression of ( FIG. 55B ) ⁇ -globin, ( FIG. 55C ) ⁇ -globin, and ( FIG. 55D ) ⁇ -globin genes, as compared to control cells that received no gRNA treatment.
  • FIG. 55E Protein expression in cells expressing dCas9 or dCas9-KRAB and treated with Cr4 or Cr8 show mild repression of ⁇ -globin expression at day 3, compared to ⁇ -actin controls.
  • FIGS. 56A-56C show expression of globin locus genes with varying doses of gRNA plasmid delivered to cells treated with ( FIG. 56A ) no lentivirus, ( FIG. 56B ) dCas9 lentivirus, or ( FIG. 56C ) dCas9-KRAB lentivirus.
  • FIG. 56A no lentivirus
  • FIG. 56B dCas9 lentivirus
  • FIG. 56C dCas9-KRAB lentivirus.
  • Increasing the dose of Cr4 gRNA plasmid delivered enhanced repression in dCas9-KRAB treated cells, indicating that both the dCas9-KRAB effector and targeted gRNA play a role in achieving repression.
  • FIGS. 57A-57D show that stably delivering single gRNAs with dCas9-KRAB silences expression of the globin genes.
  • FIG. 57A dCas9 and dCas9-KRAB repressors were co-expressed on a lentiviral vector with single gRNAs.
  • K562s expressing dCas9-KRAB achieve up to 95% repression of (FIG. 57 B) ⁇ -globin, ( FIG. 57C ) ⁇ -globin, and ( FIG. 57D ) ⁇ -globin genes, as compared to control cells that received no lentiviral treatment.
  • FIG. 58 shows that isolating the p300 HAT “Core” for targeted epigenetic modification of histones only via dCas9 fusion.
  • FIG. 59 shows a simplified schematic of S. pyogenes dCas9-VP64 fusion (top) and dCas9-p300 core fusion (bottom).
  • the Protospacer Adjacent Motifs (PAM) are shown with arrows at target gene loci and synthetic guide RNA (gRNA) is shown with hatched arrows.
  • FIGS. 60A-60C show representative data at three human loci demonstrating the efficacy of activation using dCas9-p300 in relation to dCas9-VP64 and dCas9 without any fused effector domain in the human 293T cell culture line.
  • FIGS. 61A-61C show the amino acid sequences of the dCas9 constructs. The legend for all FIGS. 61A-61C is shown in FIG. 61A .
  • FIGS. 61A-61C disclose SEQ ID NOS 674-676, respectively, in order of appearance.
  • FIG. 62 shows that HAT-dCase9-p300 fusion proteins fail to activate gene expression.
  • FIGS. 63A-63B show that gRNA's also act synergistically with dCas9-p300 Core.
  • FIGS. 64A-64C show TALEN mediated integration of minidystrophin at the 5′UTR of the Dp427m skeletal muscle isoform of dystrophin in skeletal myoblast cell lines derived from human DMD patients carrying different deletions in the dystrophin gene.
  • DMD patient cells were electroporated with constructs encoding a TALEN pair active at the 5′UTR locus and a donor template carrying the minidystrophin gene.
  • FIG. 64A Schematic showing how minidystrophin is integrated into the 5′UTR.
  • FIG. 64B Hygromycin-resistant clonal cell lines were isolated and screened by PCR for successful site-specific integrations at the 5′UTR using the primers shown in FIG.
  • FIG. 64A Clonally isolated DMD myoblasts with detected integration events were differentiated for 6 days and assessed for expression of an HA tag fused to the C terminus of minidystrophin.
  • CRISPR/CRISPR-associated (Cas) 9-based system compositions have been discovered to be useful for altering the expression of genes, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases.
  • the CRISPR/Cas9-based system involves a Cas9 protein and at least one guide RNA, which provide the DNA targeting specificity for the system.
  • the present disclosure describes a Cas9 fusion protein that combines the DNA sequence targeting function of the CRISPR/Cas9-based system with an additional activity, thus allowing changes in gene expression and/or epigenetic status.
  • the system may also be used in genome engineering and correcting or reducing the effects of gene mutations.
  • the present disclosure also provides certain compositions and methods for delivering CRISPR/CRISPR-associated (Cas) 9-based system and multiple gRNAs to target one or more endogenous genes.
  • Co-transfection of multiple sgRNAs targeted to a single promoter allow for synergistic activation, however, co-transfection of multiple plasmids leads to variable expression levels in each cell due to differences in copy number. Additionally, gene activation following transfection is transient due to dilution of plasmid DNA over time. Moreover, many cell types are not easily transfected and transient gene expression may not be sufficient for inducing a therapeutic effect.
  • a single lentiviral system was developed to express Cas9 and up to four sgRNAs from independent promoters.
  • a platform is disclosed that expresses Cas9 or dCas9 fusion proteins and up to four gRNAs from a single lentiviral vector.
  • the lentiviral vector expresses a constitutive or inducible Cas9 or dCas9-VP64 in addition to one, two, three, or four gRNAs expressed from independent promoters.
  • This system enables control of both the magnitude and timing of CRISPR/Cas9-based gene regulation.
  • the lentiviral platform provides the potent and sustained levels of gene expression that will facilitate therapeutic applications of the CRISPR/Cas9 system in primary cells.
  • this system may be used for editing multiple genes simultaneously, such as the concurrent knockout of several oncogenes.
  • the present disclosure also provides certain compositions and methods for delivering site-specific nucleases to skeletal muscle and cardiac muscle using modified adeno-associated virus (AAV) vectors.
  • the site-specific nucleases which may be engineered, are useful for altering the expression of genes, genome engineering, correcting or reducing the effects of mutations in genes involved in genetic diseases, or manipulating genes involved in other conditions affecting skeletal muscle or cardiac muscle or muscle regeneration.
  • the engineered site-specific nucleases may include a zinc finger nuclease (ZFN), a TAL effector nuclease (TALEN), and/or a CRISPR/Cas9 system for genome editing.
  • ZFN zinc finger nuclease
  • TALEN TAL effector nuclease
  • CRISPR/Cas9 CRISPR/Cas9
  • Gene editing is highly dependent on cell cycle and complex DNA repair pathways that vary from tissue to tissue.
  • Skeletal muscle is a very complex environment, consisting of large myofibers with more than 100 nuclei per cell.
  • Gene therapy and biologics in general have been limited for decades by in vivo delivery hurdles. These challenges include stability of the carrier in vivo, targeting the right tissue, getting sufficient gene expression and active gene product, and avoiding toxicity that might overcome activity, which is common with gene editing tools.
  • Other delivery vehicles such as direct injection of plasmid DNA, work to express genes in skeletal muscle and cardiac muscle in other contexts, but do not work well with these site-specific nucleases for achieving detectable levels of genome editing.
  • the protein stability and activity of the site-specific nucleases are highly tissue type- and cell type-dependent. These active and stable nucleases are able to modify gene sequences in the complex environment of skeletal muscle.
  • the current invention describes a way to deliver active forms of this class of therapeutics to skeletal muscle or cardiac muscle that is effective, efficient and facilitates successful genome modification.
  • the present disclosure also provides certain fusion epigenetic effector molecules, a dCas9-p300 fusion protein, which provides a robust and potentially more widely applicable tool for synthetic transcriptional modulation compared to the dCas9-VP64 fusion.
  • the activated target genes to a substantially greater extent than the dCas9-VP64 fusion protein at all loci tested.
  • the p300 has intrinsic endogenous activity at enhancers within the human genome.
  • the dCas9-p300 fusion protein may be able to activate endogenous target gene promoters and enhancer regions.
  • the dCas9-p300 fusion protein can be used in human tissue culture cell lines to activate gene expression.
  • This fusion protein may be used to direct the epigenetic state of target loci within human cells with precision and predictability in order to control differentiation, modulate cellular regulation, and apply innovative potential therapies.
  • Current technologies are limited in the strength of activation and the extent and sustainability of epigenetic modulation; obstacles which may be obviated via utilization of this new fusion protein.
  • each intervening number there between with the same degree of precision is explicitly contemplated.
  • the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
  • Adeno-associated virus or “AAV” as used interchangeably herein refers to a small virus belonging to the genus Dependovirus of the Parvoviridae family that infects humans and some other primate species. AAV is not currently known to cause disease and consequently the virus causes a very mild immune response.
  • Binding region refers to the region within a nuclease target region that is recognized and bound by the nuclease.
  • Cardiac muscle or “heart muscle” as used interchangeably herein means a type of involuntary striated muscle found in the walls and histological foundation of the heart, the myocardium. Cardiac muscle is made of cardiomyocytes or myocardiocytes. Myocardiocytes show striations similar to those on skeletal muscle cells but contain only one, unique nucleus, unlike the multinucleated skeletal cells.
  • Cardiac muscle condition refers to a condition related to the cardiac muscle, such as cardiomyopathy, heart failure, arrhythmia, and inflammatory heart disease.
  • Coding sequence or “encoding nucleic acid” as used herein means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes a protein.
  • the coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.
  • the coding sequence may be codon optimize.
  • “Complement” or “complementary” as used herein means a nucleic acid can mean Watson-Crick (e.g., A-T/U and C-G) or Hoogsteen base pairing between nucleotides or nucleotide analogs of nucleic acid molecules. “Complementarity” refers to a property shared between two nucleic acid sequences, such that when they are aligned antiparallel to each other, the nucleotide bases at each position will be complementary.
  • “Correcting”, “genome editing” and “restoring” as used herein refers to changing a mutant gene that encodes a truncated protein or no protein at all, such that a full-length functional or partially full-length functional protein expression is obtained. Correcting or restoring a mutant gene may include replacing the region of the gene that has the mutation or replacing the entire mutant gene with a copy of the gene that does not have the mutation with a repair mechanism such as homology-directed repair (HDR).
  • HDR homology-directed repair
  • Correcting or restoring a mutant gene may also include repairing a frameshift mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, by generating a double stranded break in the gene that is then repaired using non-homologous end joining (NHEJ). NHEJ may add or delete at least one base pair during repair which may restore the proper reading frame and eliminate the premature stop codon. Correcting or restoring a mutant gene may also include disrupting an aberrant splice acceptor site or splice donor sequence.
  • NHEJ non-homologous end joining
  • Correcting or restoring a mutant gene may also include deleting a non-essential gene segment by the simultaneous action of two nucleases on the same DNA strand in order to restore the proper reading frame by removing the DNA between the two nuclease target sites and repairing the DNA break by NHEJ.
  • Donor DNA refers to a double-stranded DNA fragment or molecule that includes at least a portion of the gene of interest.
  • the donor DNA may encode a full-functional protein or a partially-functional protein.
  • DMD Duchenne Muscular Dystrophy
  • DMD is a common hereditary monogenic disease and occurs in 1 in 3500 males.
  • DMD is the result of inherited or spontaneous mutations that cause nonsense or frame shift mutations in the dystrophin gene.
  • the majority of dystrophin mutations that cause DMD are deletions of exons that disrupt the reading frame and cause premature translation termination in the dystrophin gene.
  • DMD patients typically lose the ability to physically support themselves during childhood, become progressively weaker during the teenage years, and die in their twenties.
  • Dystrophin refers to a rod-shaped cytoplasmic protein which is a part of a protein complex that connects the cytoskeleton of a muscle fiber to the surrounding extracellular matrix through the cell membrane. Dystrophin provides structural stability to the dystroglycan complex of the cell membrane that is responsible for regulating muscle cell integrity and function.
  • the dystrophin gene or “DMD gene” as used interchangeably herein is 2.2 megabases at locus Xp21. The primary transcription measures about 2,400 kb with the mature mRNA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids.
  • Exon 51 refers to the 51 st exon of the dystrophin gene. Exon 51 is frequently adjacent to frame-disrupting deletions in DMD patients and has been targeted in clinical trials for oligonucleotide-based exon skipping. A clinical trial for the exon 51 skipping compound eteplirsen recently reported a significant functional benefit across 48 weeks, with an average of 47% dystrophin positive fibers compared to baseline. Mutations in exon 51 are ideally suited for permanent correction by NHEJ-based genome editing.
  • “Frameshift” or “frameshift mutation” as used interchangeably herein refers to a type of gene mutation wherein the addition or deletion of one or more nucleotides causes a shift in the reading frame of the codons in the mRNA.
  • the shift in reading frame may lead to the alteration in the amino acid sequence at protein translation, such as a missense mutation or a premature stop codon.
  • “Functional” and “full-functional” as used herein describes protein that has biological activity.
  • a “functional gene” refers to a gene transcribed to mRNA, which is translated to a functional protein.
  • Fusion protein refers to a chimeric protein created through the joining of two or more genes that originally coded for separate proteins. The translation of the fusion gene results in a single polypeptide with functional properties derived from each of the original proteins.
  • Geneetic construct refers to the DNA or RNA molecules that comprise a nucleotide sequence that encodes a protein.
  • the coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered.
  • the term “expressible form” refers to gene constructs that contain the necessary regulatory elements operable linked to a coding sequence that encodes a protein such that when present in the cell of the individual, the coding sequence will be expressed.
  • Genetic disease refers to a disease, partially or completely, directly or indirectly, caused by one or more abnormalities in the genome, especially a condition that is present from birth.
  • the abnormality may be a mutation, an insertion or a deletion.
  • the abnormality may affect the coding sequence of the gene or its regulatory sequence.
  • the genetic disease may be, but not limited to DMD, hemophilia, cystic fibrosis, Huntington's chorea, familial hypercholesterolemia (LDL receptor defect), hepatoblastoma, Wilson's disease, congenital hepatic porphyria, inherited disorders of hepatic metabolism, Lesch Nyhan syndrome, sickle cell anemia, thalassaemias, xeroderma pigmentosum, Fanconi's anemia, retinitis pigmentosa, ataxia telangiectasia, Bloom's syndrome, retinoblastoma, and Tay-Sachs disease.
  • DMD hemophilia
  • cystic fibrosis Huntington's chorea
  • hepatoblastoma Wilson's disease
  • congenital hepatic porphyria congenital hepatic porphyria
  • inherited disorders of hepatic metabolism Lesch Nyhan
  • “Homology-directed repair” or “HDR” as used interchangeably herein refers to a mechanism in cells to repair double strand DNA lesions when a homologous piece of DNA is present in the nucleus, mostly in G2 and S phase of the cell cycle.
  • HDR uses a donor DNA template to guide repair and may be used to create specific sequence changes to the genome, including the targeted addition of whole genes. If a donor template is provided along with the site specific nuclease, such as with a CRISPR/Cas9-based systems, then the cellular machinery will repair the break by homologous recombination, which is enhanced several orders of magnitude in the presence of DNA cleavage. When the homologous DNA piece is absent, non-homologous end joining may take place instead.
  • Genome editing refers to changing a gene. Genome editing may include correcting or restoring a mutant gene. Genome editing may include knocking out a gene, such as a mutant gene or a normal gene. Genome editing may be used to treat disease or enhance muscle repair by changing the gene of interest.
  • nucleic acids or polypeptide sequences means that the sequences have a specified percentage of residues that are the same over a specified region. The percentage may be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity.
  • the residues of single sequence are included in the denominator but not the numerator of the calculation.
  • thymine (T) and uracil (U) may be considered equivalent.
  • Identity may be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.
  • mutant gene or “mutated gene” as used interchangeably herein refers to a gene that has undergone a detectable mutation.
  • a mutant gene has undergone a change, such as the loss, gain, or exchange of genetic material, which affects the normal transmission and expression of the gene.
  • a “disrupted gene” as used herein refers to a mutant gene that has a mutation that causes a premature stop codon. The disrupted gene product is truncated relative to a full-length undisrupted gene product.
  • Non-homologous end joining (NHEJ) pathway refers to a pathway that repairs double-strand breaks in DNA by directly ligating the break ends without the need for a homologous template.
  • the template-independent re-ligation of DNA ends by NHEJ is a stochastic, error-prone repair process that introduces random micro-insertions and micro-deletions (indels) at the DNA breakpoint. This method may be used to intentionally disrupt, delete, or alter the reading frame of targeted gene sequences.
  • NHEJ typically uses short homologous DNA sequences called microhomologies to guide repair. These microhomologies are often present in single-stranded overhangs on the end of double-strand breaks. When the overhangs are perfectly compatible, NHEJ usually repairs the break accurately, yet imprecise repair leading to loss of nucleotides may also occur, but is much more common when the overhangs are not compatible.
  • Normal gene refers to a gene that has not undergone a change, such as a loss, gain, or exchange of genetic material. The normal gene undergoes normal gene transmission and gene expression.
  • Nuclease mediated NHEJ refers to NHEJ that is initiated after a nuclease, such as a cas9, cuts double stranded DNA.
  • Nucleic acid or “oligonucleotide” or “polynucleotide” as used herein means at least two nucleotides covalently linked together.
  • the depiction of a single strand also defines the sequence of the complementary strand.
  • a nucleic acid also encompasses the complementary strand of a depicted single strand.
  • Many variants of a nucleic acid may be used for the same purpose as a given nucleic acid.
  • a nucleic acid also encompasses substantially identical nucleic acids and complements thereof.
  • a single strand provides a probe that may hybridize to a target sequence under stringent hybridization conditions.
  • a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.
  • Nucleic acids may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequence.
  • the nucleic acid may be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine.
  • Nucleic acids may be obtained by chemical synthesis methods or by recombinant methods.
  • “Operably linked” as used herein means that expression of a gene is under the control of a promoter with which it is spatially connected.
  • a promoter may be positioned 5′ (upstream) or 3′ (downstream) of a gene under its control.
  • the distance between the promoter and a gene may be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance may be accommodated without loss of promoter function.
  • Partially-functional as used herein describes a protein that is encoded by a mutant gene and has less biological activity than a functional protein but more than a non-functional protein.
  • Premature stop codon or “out-of-frame stop codon” as used interchangeably herein refers to nonsense mutation in a sequence of DNA, which results in a stop codon at location not normally found in the wild-type gene.
  • a premature stop codon may cause a protein to be truncated or shorter compared to the full-length version of the protein.
  • Promoter means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell.
  • a promoter may comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same.
  • a promoter may also comprise distal enhancer or repressor elements, which may be located as much as several thousand base pairs from the start site of transcription.
  • a promoter may be derived from sources including viral, bacterial, fungal, plants, insects, and animals.
  • a promoter may regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents.
  • promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.
  • RVD Repeat variable diresidue
  • RVD module DNA recognition motif
  • the RVD determines the nucleotide specificity of the RVD module.
  • RVD modules may be combined to produce an RVD array.
  • the “RVD array length” as used herein refers to the number of RVD modules that corresponds to the length of the nucleotide sequence within the TALEN target region that is recognized by a TALEN, i.e., the binding region.
  • Site-specific nuclease refers to an enzyme capable of specifically recognizing and cleaving DNA sequences.
  • the site-specific nuclease may be engineered.
  • engineered site-specific nucleases include zinc finger nucleases (ZFNs), TAL effector nucleases (TALENs), and CRISPR/Cas9-based systems.
  • Skeletal muscle refers to a type of striated muscle, which is under the control of the somatic nervous system and attached to bones by bundles of collagen fibers known as tendons. Skeletal muscle is made up of individual components known as myocytes, or “muscle cells”, sometimes colloquially called “muscle fibers.” Myocytes are formed from the fusion of developmental myoblasts (a type of embryonic progenitor cell that gives rise to a muscle cell) in a process known as myogenesis. These long, cylindrical, multinucleated cells are also called myofibers.
  • “Skeletal muscle condition” as used herein refers to a condition related to the skeletal muscle, such as muscular dystrophies, aging, muscle degeneration, wound healing, and muscle weakness or atrophy.
  • Spacers and “spacer region” as used interchangeably herein refers to the region within a TALEN or ZFN target region that is between, but not a part of, the binding regions for two TALENs or ZFNs.
  • a mammal e.g., cow, pig, camel, llama, horse, goat, rabbit, sheep, hamsters, guinea pig, cat, dog, rat, and mouse
  • a non-human primate for example, a monkey, such as a cynomolgous or rhesus monkey, chimpanzee, etc.
  • the subject may be a human or a non-human.
  • the subject or patient may be undergoing other
  • Target gene refers to any nucleotide sequence encoding a known or putative gene product.
  • the target gene may be a mutated gene involved in a genetic disease.
  • Target region refers to the region of the target gene to which the site-specific nuclease is designed to bind and cleave.
  • Transcription activator-like effector or “TALE” as used herein refers to a protein structure that recognizes and binds to a particular DNA sequence.
  • the “TALE DNA-binding domain” refers to a DNA-binding domain that includes an array of tandem 33-35 amino acid repeats, also known as RVD modules, each of which specifically recognizes a single base pair of DNA. RVD modules may be arranged in any order to assemble an array that recognizes a defined sequence.
  • a binding specificity of a TALE DNA-binding domain is determined by the RVD array followed by a single truncated repeat of 20 amino acids.
  • a TALE DNA-binding domain may have 12 to 27 RVD modules, each of which contains an RVD and recognizes a single base pair of DNA. Specific RVDs have been identified that recognize each of the four possible DNA nucleotides (A, T, C, and G). Because the TALE DNA-binding domains are modular, repeats that recognize the four different DNA nucleotides may be linked together to recognize any particular DNA sequence. These targeted DNA-binding domains may then be combined with catalytic domains to create functional enzymes, including artificial transcription factors, methyltransferases, integrases, nucleases, and recombinases.
  • Transcription activator-like effector nucleases or “TALENs” as used interchangeably herein refers to engineered fusion proteins of the catalytic domain of a nuclease, such as endonuclease FokI, and a designed TALE DNA-binding domain that may be targeted to a custom DNA sequence.
  • a “TALEN monomer” refers to an engineered fusion protein with a catalytic nuclease domain and a designed TALE DNA-binding domain. Two TALEN monomers may be designed to target and cleave a TALEN target region.
  • Transgene refers to a gene or genetic material containing a gene sequence that has been isolated from one organism and is introduced into a different organism. This non-native segment of DNA may retain the ability to produce RNA or protein in the transgenic organism, or it may alter the normal function of the transgenic organism's genetic code. The introduction of a transgene has the potential to change the phenotype of an organism.
  • “Variant” used herein with respect to a nucleic acid means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.
  • Variant with respect to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity.
  • Variant may also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity.
  • a conservative substitution of an amino acid i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes may be identified, in part, by considering the hydropathic index of amino acids, as understood in the art. Kyte et al., J. Mol. Biol.
  • the hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes may be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ⁇ 2 are substituted.
  • the hydrophilicity of amino acids may also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide. Substitutions may be performed with amino acids having hydrophilicity values within ⁇ 2 of each other.
  • hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
  • Vector as used herein means a nucleic acid sequence containing an origin of replication.
  • a vector may be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome.
  • a vector may be a DNA or RNA vector.
  • a vector may be a self-replicating extrachromosomal vector, and preferably, is a DNA plasmid.
  • the vector may encode an iCas9-VP64 fusion protein comprising the amino acid sequence of SEQ ID NO: 1 or at least one gRNA nucleotide sequence of any one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the vector may encode Cas9 and at least one gRNA nucleotide sequence of any one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • Zinc finger refers to a protein structure that recognizes and binds to DNA sequences.
  • the zinc finger domain is the most common DNA-binding motif in the human proteome.
  • a single zinc finger contains approximately 30 amino acids and the domain typically functions by binding 3 consecutive base pairs of DNA via interactions of a single amino acid side chain per base pair.
  • Zinc finger nuclease or “ZFN” as used interchangeably herein refers to a chimeric protein molecule comprising at least one zinc finger DNA binding domain effectively linked to at least one nuclease or part of a nuclease capable of cleaving DNA when fully assembled.
  • compositions for genome editing, genomic alteration or altering gene expression of a target gene may include a may include viral vector and fusion protein such as a site-specific nuclease or CRISPR/Cas9-system with at least one gRNA.
  • the present invention is directed to a composition for genome editing a target gene in skeletal muscle or cardiac muscle of a subject.
  • the composition includes a modified AAV vector and a nucleotide sequence encoding a site-specific nuclease.
  • the composition delivers active forms of site-specific nucleases to skeletal muscle or cardiac muscle.
  • the composition may further comprise a donor DNA or a transgene.
  • the target gene may be involved in differentiation of a cell or any other process in which activation, repression, or disruption of a gene may be desired, or may have a mutation such as a deletion, frameshift mutation, or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, the site-specific nucleases may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon, the aberrant splice acceptor site or the aberrant splice donor site.
  • the site-specific nucleases may also be used to disrupt normal gene splicing by targeting splice acceptors and donors to induce skipping of premature stop codons or restore a disrupted reading frame.
  • the site-specific nucleases may or may not mediate off-target changes to protein-coding regions of the genome.
  • CRISPRs Clustering Regularly Interspaced Short Palindromic Repeats
  • CRISPRs refers to loci containing multiple short direct repeats that are found in the genomes of approximately 40% of sequenced bacteria and 90% of sequenced archaea.
  • the CRISPR system is a microbial nuclease system involved in defense against invading phages and plasmids that provides a form of acquired immunity.
  • the CRISPR loci in microbial hosts contain a combination of CRISPR-associated (Cas) genes as well as non-coding RNA elements capable of programming the specificity of the CRISPR-mediated nucleic acid cleavage.
  • Cas9 forms a complex with the 3′ end of the sgRNA, and the protein-RNA pair recognizes its genomic target by complementary base pairing between the 5′ end of the sgRNA sequence and a predefined 20 bp DNA sequence, known as the protospacer.
  • This complex is directed to homologous loci of pathogen DNA via regions encoded within the crRNA, i.e., the protospacers, and protospacer-adjacent motifs (PAMs) within the pathogen genome.
  • PAMs protospacer-adjacent motifs
  • the non-coding CRISPR array is transcribed and cleaved within direct repeats into short crRNAs containing individual spacer sequences, which direct Cas nucleases to the target site (protospacer).
  • the Cas9 nuclease can be directed to new genomic targets.
  • CRISPR spacers are used to recognize and silence exogenous genetic elements in a manner analogous to RNAi in eukaryotic organisms.
  • Type II effector system carries out targeted DNA double-strand break in four sequential steps, using a single effector enzyme, Cas9, to cleave dsDNA.
  • Cas9 effector enzyme
  • the Type II effector system may function in alternative contexts such as eukaryotic cells.
  • the Type II effector system consists of a long pre-crRNA, which is transcribed from the spacer-containing CRISPR locus, the Cas9 protein, and a tracrRNA, which is involved in pre-crRNA processing.
  • the tracrRNAs hybridize to the repeat regions separating the spacers of the pre-crRNA, thus initiating dsRNA cleavage by endogenous RNase III. This cleavage is followed by a second cleavage event within each spacer by Cas9, producing mature crRNAs that remain associated with the tracrRNA and Cas9, forming a Cas9:crRNA-tracrRNA complex.
  • the Cas9:crRNA-tracrRNA complex unwinds the DNA duplex and searches for sequences matching the crRNA to cleave.
  • Target recognition occurs upon detection of complementarity between a “protospacer” sequence in the target DNA and the remaining spacer sequence in the crRNA.
  • Cas9 mediates cleavage of target DNA if a correct protospacer-adjacent motif (PAM) is also present at the 3′ end of the protospacer.
  • PAM protospacer-adjacent motif
  • the sequence must be immediately followed by the protospacer-adjacent motif (PAM), a short sequence recognized by the Cas9 nuclease that is required for DNA cleavage.
  • PAM protospacer-adjacent motif
  • Different Type II systems have differing PAM requirements. The S.
  • pyogenes CRISPR system may have the PAM sequence for this Cas9 (SpCas9) as 5′-NRG-3′, where R is either A or G, and characterized the specificity of this system in human cells.
  • SpCas9 the PAM sequence for this Cas9
  • a unique capability of the CRISPR/Cas9 system is the straightforward ability to simultaneously target multiple distinct genomic loci by co-expressing a single Cas9 protein with two or more sgRNAs.
  • the Streptococcuspyogenes Type II system naturally prefers to use an “NGG” sequence, where “N” can be any nucleotide, but also accepts other PAM sequences, such as “NAG” in engineered systems (Hsu et al., Nature Biotechnology (2013) doi:10.1038/nbt.2647).
  • NmCas9 derived from Neisseria meningitidis
  • NmCas9 normally has a native PAM of NNNNGATT, but has activity across a variety of PAMs, including a highly degenerate NNNNGNNN PAM (Esvelt et al. Nature Methods (2013) doi:10.1038/nmeth.2681).
  • gRNA guide RNA
  • sgRNA chimeric single guide RNA
  • the CRISPR/Cas9-based engineered systems may be designed to target any gene, including genes involved in a genetic disease, aging, tissue regeneration, or wound healing.
  • the CRISPR/Cas9-based systems may include a Cas9 protein or Cas9 fusion protein and at least one gRNA.
  • the Cas9 fusion protein may, for example, include a domain that has a different activity that what is endogenous to Cas9, such as a transactivation domain.
  • the target gene may be involved in differentiation of a cell or any other process in which activation of a gene may be desired, or may have a mutation such as a frameshift mutation or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, the CRISPR/Cas9-based system may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon, the aberrant splice acceptor site or the aberrant splice donor site.
  • the CRISPR-Cas9-based system may also be used to disrupt normal gene splicing by targeting splice acceptors and donors to induce skipping of premature stop codons or restore a disrupted reading frame.
  • the CRISPR/Cas9-based system may or may not mediate off-target changes to protein-coding regions of the genome.
  • the CRISPR/Cas9-based system may include a Cas9 protein or a Cas9 fusion protein.
  • Cas9 protein is an endonuclease that cleaves nucleic acid and is encoded by the CRISPR loci and is involved in the Type II CRISPR system.
  • the Cas9 protein may be from any bacterial or archaea species, such as Streptococcuspyogenes.
  • the Cas9 protein may be mutated so that the nuclease activity is inactivated.
  • iCas9 an inactivated Cas9 protein from Streptococcuspyogenes (iCas9, also referred to as “dCas9”) with no endonuclease activity has been recently targeted to genes in bacteria, yeast, and human cells by gRNAs to silence gene expression through steric hindrance.
  • iCas9 and dCas9 both refer to a Cas9 protein that has the amino acid substitutions D10A and H840A and has its nuclease activity inactivated.
  • the CRISPR/Cas9-based system may include a Cas9 of SEQ ID NO: 459 or 461.
  • the CRISPR/Cas9-based system may include a fusion protein.
  • the fusion protein may comprise two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein and the second polypeptide domain has an activity such as transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, or demethylase activity.
  • the fusion protein may include a Cas9 protein or a mutated Cas9 protein, as described above, fused to a second polypeptide domain that has an activity such as transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, or demethylase activity.
  • the second polypeptide domain may have transcription activation activity, i.e., a transactivation domain.
  • gene expression of endogenous mammalian genes such as human genes, may be achieved by targeting a fusion protein of iCas9 and a transactivation domain to mammalian promoters via combinations of gRNAs.
  • the transactivation domain may include a VP16 protein, multiple VP16 proteins, such as a VP48 domain or VP64 domain, or p65 domain of NF kappa B transcription activator activity.
  • the fusion protein may be iCas9-VP64.
  • the second polypeptide domain may have transcription repression activity.
  • the second polypeptide domain may have a Kruppel associated box activity, such as a KRAB domain, ERF repressor domain activity, Mxi1 repressor domain activity, SID4X repressor domain activity, Mad-SID repressor domain activity or TATA box binding protein activity.
  • the fusion protein may be dCas9-KRAB.
  • the second polypeptide domain may have transcription release factor activity.
  • the second polypeptide domain may have eukaryotic release factor 1 (ERF1) activity or eukaryotic release factor 3 (ERF3) activity.
  • the second polypeptide domain may have histone modification activity.
  • the second polypeptide domain may have histone deacetylase, histone acetyltransferase, histone demethylase, or histone methyltransferase activity.
  • the histone acetyltransferase may be p300 or CREB-binding protein (CBP) protein, or fragments thereof.
  • the fusion protein may be dCas9-p300.
  • the second polypeptide domain may have nuclease activity that is different from the nuclease activity of the Cas9 protein.
  • a nuclease, or a protein having nuclease activity is an enzyme capable of cleaving the phosphodiester bonds between the nucleotide subunits of nucleic acids.
  • Nucleases are usually further divided into endonucleases and exonucleases, although some of the enzymes may fall in both categories.
  • Well known nucleases are deoxyribonuclease and ribonuclease.
  • the second polypeptide domain may have nucleic acid association activity or nucleic acid binding protein-DNA-binding domain (DBD) is an independently folded protein domain that contains at least one motif that recognizes double- or single-stranded DNA.
  • a DBD can recognize a specific DNA sequence (a recognition sequence) or have a general affinity to DNA.
  • nucleic acid association region selected from the group consisting of helix-turn-helix region, leucine zipper region, winged helix region, winged helix-turn-helix region, helix-loop-helix region, immunoglobulin fold, B3 domain, Zinc finger, HMG-box, Wor3 domain, TAL effector DNA-binding domain.
  • the second polypeptide domain may have methylase activity, which involves transferring a methyl group to DNA, RNA, protein, small molecule, cytosine or adenine.
  • the second polypeptide domain may include a DNA methyltransferase.
  • the second polypeptide domain may have demethylase activity.
  • the second polypeptide domain may include an enzyme that remove methyl (CH3-) groups from nucleic acids, proteins (in particular histones), and other molecules.
  • the second polypeptide may covert the methyl group to hydroxymethylcytosine in a mechanism for demethylating DNA.
  • the second polypeptide may catalyze this reaction.
  • the second polypeptide that catalyzes this reaction may be Tet1.
  • the gRNA provides the targeting of the CRISPR/Cas9-based system.
  • the gRNA is a fusion of two noncoding RNAs: a crRNA and a tracrRNA.
  • the sgRNA may target any desired DNA sequence by exchanging the sequence encoding a 20 bp protospacer which confers targeting specificity through complementary base pairing with the desired DNA target.
  • gRNA mimics the naturally occurring crRNA:tracrRNA duplex involved in the Type II Effector system. This duplex, which may include, for example, a 42-nucleotide crRNA and a 75-nucleotide tracrRNA, acts as a guide for the Cas9 to cleave the target nucleic acid.
  • target region refers to the region of the target gene to which the CRISPR/Cas9-based system targets.
  • the CRISPR/Cas9-based system may include at least one gRNA, wherein the gRNAs target different DNA sequences.
  • the target DNA sequences may be overlapping.
  • the target sequence or protospacer is followed by a PAM sequence at the 3′ end of the protospacer.
  • Different Type II systems have differing PAM requirements.
  • the Streptococcus pyogenes Type II system uses an “NGG” sequence, where “N” can be any nucleotide.
  • the number of gRNA administered to the cell may be at least 1 gRNA, at least 2 different gRNA, at least 3 different gRNA at least 4 different gRNA, at least 5 different gRNA, at least 6 different gRNA, at least 7 different gRNA, at least 8 different gRNA, at least 9 different gRNA, at least 10 different gRNAs, at least 11 different gRNAs, at least 12 different gRNAs, at least 13 different gRNAs, at least 14 different gRNAs, at least 15 different gRNAs, at least 16 different gRNAs, at least 17 different gRNAs, at least 18 different gRNAs, at least 18 different gRNAs, at least 20 different gRNAs, at least 25 different gRNAs, at least 30 different gRNAs, at least 35 different gRNAs, at least 40 different gRNAs, at least 45 different gRNAs, or at least 50 different gRNAs.
  • the number of gRNA administered to the cell may be between at least 1 gRNA to at least 50 different gRNAs, at least 1 gRNA to at least 45 different gRNAs, at least 1 gRNA to at least 40 different gRNAs, at least 1 gRNA to at least 35 different gRNAs, at least 1 gRNA to at least 30 different gRNAs, at least 1 gRNA to at least 25 different gRNAs, at least 1 gRNA to at least 20 different gRNAs, at least 1 gRNA to at least 16 different gRNAs, at least 1 gRNA to at least 12 different gRNAs, at least 1 gRNA to at least 8 different gRNAs, at least 1 gRNA to at least 4 different gRNAs, at least 4 gRNAs to at least 50 different gRNAs, at least 4 different gRNAs to at least 45 different gRNAs, at least 4 different gRNAs to at least 40 different gRNAs, at least 4 different gRNAs to at least 35
  • the gRNA may comprise a complementary polynucleotide sequence of the target DNA sequence followed by a PAM sequence.
  • the gRNA may comprise a “G” at the 5′ end of the complementary polynucleotide sequence.
  • the gRNA may comprise at least a 10 base pair, at least a 11 base pair, at least a 12 base pair, at least a 13 base pair, at least a 14 base pair, at least a 15 base pair, at least a 16 base pair, at least a 17 base pair, at least a 18 base pair, at least a 19 base pair, at least a 20 base pair, at least a 21 base pair, at least a 22 base pair, at least a 23 base pair, at least a 24 base pair, at least a 25 base pair, at least a 30 base pair, or at least a 35 base pair complementary polynucleotide sequence of the target DNA sequence followed by a PAM sequence.
  • the PAM sequence may be “NGG”, where “N” can be any nucleotide.
  • the gRNA may target at least one of the promoter region, the enhancer region or the transcribed region of the target gene.
  • the gRNA may include a nucleic acid sequence of at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, 585-625, 462 ( FIG. 40 ), 464 ( FIG. 41 ), and 465 ( FIG. 41 ).
  • the gRNA may target any nucleic acid sequence.
  • the nucleic acid sequence target may be DNA.
  • the DNA may be any gene.
  • the gRNA may target a gene, such as BRN2, MYT1L, ASCL1, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, MYOD1, OCT4, and DMD.
  • Dystrophin is a rod-shaped cytoplasmic protein which is a part of a protein complex that connects the cytoskeleton of a muscle fiber to the surrounding extracellular matrix through the cell membrane.
  • Dystrophin provides structural stability to the dystroglycan complex of the cell membrane.
  • the dystrophin gene is 2.2 megabases at locus Xp21. The primary transcription measures about 2,400 kb with the mature mRNA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids.
  • Normal skeleton muscle tissue contains only small amounts of dystrophin but its absence of abnormal expression leads to the development of severe and incurable symptoms.
  • Some mutations in the dystrophin gene lead to the production of defective dystrophin and severe dystrophic phenotype in affected patients.
  • Some mutations in the dystrophin gene lead to partially-functional dystrophin protein and a much milder dystrophic phenotype in affected patients.
  • DMD is the result of inherited or spontaneous mutations that cause nonsense or frame shift mutations in the dystrophin gene.
  • Naturally occurring mutations and their consequences are relatively well understood for DMD. It is known that in-frame deletions that occur in the exon 45-55 region contained within the rod domain can produce highly functional dystrophin proteins, and many carriers are asymptomatic or display mild symptoms. Furthermore, more than 60% of patients may theoretically be treated by targeting exons in this region of the dystrophin gene. Efforts have been made to restore the disrupted dystrophin reading frame in DMD patients by skipping non-essential exons during mRNA splicing to produce internally deleted but functional dystrophin proteins. The deletion of internal dystrophin exons retain the proper reading frame but cause the less severe Becker muscular dystrophy.
  • a CRISPR/Cas9-based system specific for dystrophin gene are disclosed herein.
  • the CRISPR/Cas9-based system may include Cas9 and at least one gRNA to target the dystrophin gene.
  • the CRISPR/Cas9-based system may bind and recognize a target region.
  • the target regions may be chosen immediately upstream of possible out-of-frame stop codons such that insertions or deletions during the repair process restore the dystrophin reading frame by frame conversion.
  • Target regions may also be splice acceptor sites or splice donor sites, such that insertions or deletions during the repair process disrupt splicing and restore the dystrophin reading frame by splice site disruption and exon exclusion.
  • Target regions may also be aberrant stop codons such that insertions or deletions during the repair process restore the dystrophin reading frame by eliminating or disrupting the stop codon.
  • Single or multiplexed sgRNAs may be designed to restore the dystrophin reading frame by targeting the mutational hotspot at exons 45-55 and introducing either intraexonic small insertions and deletions, or large deletions of one or more exons.
  • dystrophin expression may be restored in Duchenne patient muscle cells in vitro. Human dystrophin was detected in vivo following transplantation of genetically corrected patient cells into immunodeficient mice.
  • the unique multiplex gene editing capabilities of the CRISPR/Cas9 system enable efficiently generating large deletions of this mutational hotspot region that can correct up to 62% of patient mutations by universal or patient-specific gene editing approaches.
  • the CRISPR/Cas9-based system may use gRNA of varying sequences and lengths. Examples of gRNAs may be found in Table 6.
  • the CRISPR/Cas9-based system may target a nucleic acid sequence of SEQ ID NOs: 65-144, or a complement thereof.
  • the gRNA may include a nucleotide sequence selected from the group consisting of SEQ ID NO: 65-144, or a complement thereof.
  • the disclosed CRISPR/Cas9-based systems were engineered to mediate highly efficient gene editing at exon 51 of the dystrophin gene. These CRISPR/Cas9-based systems restored dystrophin protein expression in cells from DMD patients.
  • Exon 51 is frequently adjacent to frame-disrupting deletions in DMD. Elimination of exon 51 from the dystrophin transcript by exon skipping can be used to treat approximately 15% of all DMD patients.
  • This class of DMD mutations is ideally suited for permanent correction by NIEJ-based genome editing and HDR.
  • the CRISPR/Cas9-based systems described herein have been developed for targeted modification of exon 51 in the human dystrophin gene. These CRISPR/Cas9-based systems were transfected into human DMD cells and mediated efficient gene modification and conversion to the correct reading frame. Protein restoration was concomitant with frame restoration and detected in a bulk population of CRISPR/Cas9-based system-treated cells. Similarly, the elimination of exons 45-55 of the dystrophin transcript can be used to treat approximately 62% of all DMD patients.
  • AAV may be used to deliver CRISPRs using various construct configurations (see FIG. 39 ).
  • AAV may deliver Cas9 and gRNA expression cassettes on separate vectors.
  • the small Cas9 proteins derived from species such as Staphylococcus aureus or Neisseria meningitidis , are used then both the Cas9 and up to two gRNA expression cassettes may be combined in a single AAV vector within the 4.7 kb packaging limit (see FIG. 39 ).
  • the present disclosure is directed to a multiplex CRISPR/Cas9-Based System which includes a CRISPR/CRISPR-associated (Cas) 9-based system, such as Cas9 or dCas9, and multiple gRNAs to target one or more endogenous genes.
  • a CRISPR/CRISPR-associated (Cas) 9-based system such as Cas9 or dCas9
  • This platform utilizes a convenient Golden Gate cloning method to rapidly incorporate up to four independent sgRNA expression cassettes into a single lentiviral vector.
  • Each sgRNA was efficiently expressed and could mediate multiplex gene editing at diverse loci in immortalized and primary human cell lines.
  • Transient transcriptional activation in cell lines stably expressing dCas9-VP64 was demonstrated to be tunable by synergistic activation with one to four sgRNAs.
  • the single lentiviral vector can induce sustained and long-term endogenous gene expression in immortalized and primary
  • the multiplex CRISPR/Cas9-Based System provides potency of transcriptional activation and tunable induction of transcriptional activation.
  • the final vector expresses a constitutive Cas9 or dCas9-VP64 in addition to one, two, three, or four sgRNAs expressed from independent promoters.
  • Each promoter is capable of efficiently expressing sgRNAs that direct similar levels of Cas9 nuclease activity.
  • lentiviral delivery of a single vector expressing Cas9 and four sgRNAs targeting independent loci resulted in simultaneous multiplex gene editing of all four loci.
  • Tunable transcriptional activation at two endogenous genes in both transient and stable contexts was achieved using lentiviral delivery of Cas9 with or without sgRNAs. Highly efficient and long-term gene activation in primary human cells is accomplished. This system is therefore an attractive and efficient method to generate multiplex gene editing and long-term transcriptional activation in human cells.
  • the multiplex CRISPR/Cas9-Based System allows efficient multiplex gene editing for simultaneously inactivating multiple genes.
  • the CRISPR/Cas9 system can simultaneously target multiple distinct genomic loci by co-expressing a single Cas9 protein with two or more sgRNAs, making this system uniquely suited for multiplex gene editing or synergistic activation applications.
  • the CRISPR/Cas9 system greatly expedites the process of molecular targeting to new sites by simply modifying the expressed sgRNA molecule.
  • the single lentiviral vector may be combined with methods for achieving inducible control of these components, either by chemical or optogenetic regulation, to facilitate investigation of the dynamics of gene regulation in both time and space.
  • the multiplex CRISPR/Cas9-based systems may transcriptionally activate two or more endogenous genes.
  • the multiplex CRISPR/Cas9-based systems may transcriptionally repress two or more endogenous genes.
  • at least two endogenous genes, at least three endogenous genes, at least four endogenous genes, at least five endogenous genes, or at least ten endogenous genes may be activated or repressed by the multiplex CRISPR/Cas9-based system.
  • Between two and fifteen genes, between two and ten genes, between two and five genes, between five and fifteen genes, or between five and ten genes may be activated or repressed by the multiplex CRISPR/Cas9-based system.
  • the multiplex CRISPR/Cas9-based system includes a modified lentiviral vector.
  • the modified lentiviral vector includes a first polynucleotide sequence encoding a fusion protein and a second polynucleotide sequence encoding at least one sgRNA.
  • the fusion protein may be the fusion protein of the CRISPR/Cas9-based system, as described above.
  • the first polynucleotide sequence may be operably linked to a promoter.
  • the promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter.
  • the second polynucleotide sequence encodes at least 1 sgRNA.
  • the second polynucleotide sequence may encode at least 1 sgRNA, at least 2 sgRNAs, at least 3 sgRNAs, at least 4 sgRNAs, at least 5 sgRNAs, at least 6 sgRNAs, at least 7 sgRNAs, at least 8 sgRNAs, at least 9 sgRNAs, at least 10 sgRNAs, at least 11 sgRNA, at least 12 sgRNAs, at least 13 sgRNAs, at least 14 sgRNAs, at least 15 sgRNAs, at least 16 sgRNAs, at least 17 sgRNAs, at least 18 sgRNAs, at least 19 sgRNAs, at least 20 sgRNAs, at least 25 sgRNA, at least 30 sgRNAs, at least 35 sgRNAs, at least 40 sgRNAs, at least 45 sgRNA
  • the second polynucleotide sequence may encode between 1 sgRNA and 50 sgRNAs, between 1 sgRNA and 45 sgRNAs, between 1 sgRNA and 40 sgRNAs, between 1 sgRNA and 35 sgRNAs, between 1 sgRNA and 30 sgRNAs, between 1 sgRNA and 25 different sgRNAs, between 1 sgRNA and 20 sgRNAs, between 1 sgRNA and 16 sgRNAs, between 1 sgRNA and 8 different sgRNAs, between 4 different sgRNAs and 50 different sgRNAs, between 4 different sgRNAs and 45 different sgRNAs, between 4 different sgRNAs and 40 different sgRNAs, between 4 different sgRNAs and 35 different sgRNAs, between 4 different sgRNAs and 30 different sgRNAs, between 4 different sgRNAs and 25 different sgRNAs, between 4 different sgRNAs and 20 different
  • Each of the polynucleotide sequences encoding the different sgRNAs may be operably linked to a promoter.
  • the promoters that are operably linked to the different sgRNAs may be the same promoter.
  • the promoters that are operably linked to the different sgRNAs may be different promoters.
  • the promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter.
  • the at least one sgRNA may bind to a target gene or loci. If more than one sgRNA is included, each of the sgRNAs binds to a different target region within one target loci or each of the sgRNA binds to a different target region within different gene loci.
  • the fusion protein may include Cas9 protein or iCas9-VP64 protein.
  • the fusion protein may include a VP64 domain, a p300 domain, or a KRAB domain.
  • the composition includes a nucleotide sequence encoding a site-specific nuclease that binds and cleaves a target region.
  • the site-specific nuclease may be engineered.
  • an engineered site-specific nuclease may be a CRISPR/Cas9-based system, a ZFN, or a TALEN.
  • the site-specific nuclease may bind and cleave a gene or locus in the genome of a cell in the skeletal muscle or cardiac muscle.
  • the gene or locus may be the Rosa26 locus or the dystrophin gene.
  • the CRISPR/Cas9-based system may be used to introduce site-specific double strand breaks at targeted genomic loci.
  • the site-specific nuclease may be a ZFN.
  • a single zinc finger contains approximately 30 amino acids and the domain functions by binding 3 consecutive base pairs of DNA via interactions of a single amino acid side chain per base pair.
  • the modular structure of the zinc finger motif permits the conjunction of several domains in series, allowing for the recognition and targeting of extended sequences in multiples of 3 nucleotides.
  • These targeted DNA-binding domains can be combined with a nuclease domain, such as FokI, to generate a site-specific nuclease, called a“zinc finger nuclease” (ZFNs) that can be used to introduce site-specific double strand breaks at targeted genomic loci.
  • ZFNs a“zinc finger nuclease”
  • the ZFN may target the Rosa26 locus (Perez-Pinera et al. Nucleic Acids Research (2012) 40:3741-3752) or a dystrophin gene. Examples of ZFNs are shown in Table 1and FIGS. 35-38 .
  • Table 1 the DNA recognition helices are underlined and “Fok ELD-S” and “Fok KKR-S” refers to the FokI nuclease domain that is fused to the zinc finger protein DNA-binding domains.
  • the target DNA sequence in the target sites i.e., in SEQ ID NOs: 442, 445, 448, and 453
  • the DNA recognition helices in the ZFN amino acid sequences i.e., in SEQ ID NOs: 443, 444, 446, 447, 449-452, 454, and 455 are underlined, respectively.
  • ZFN B left Fok ELD-S full amino acid sequence (SEQ ID NO: 438) MDYKDHDGDYKDHDIDYKDDDDKMAPKKKRKVGRLEPGEKPYKCPECGK SFS RKDALRG HQRTHTGEKPYKCPECGKSFS HRTTLTN HQRTHTGEKPY KCPECGKSFS QRNALAG HQRTHTGEKPYKCPECGKSFS HKNALQN HQRT HTGEKPYKCPECGKSFS DPGHLVR HQRTHTGEKPYKCPECGKSFS TSGN LVR HQRTHTGAAARALVKSELEEKKSELRHKLKYVPHEYIELIEIARNP TQDRILEMKVMEFFMKVYGYRGEHLGGSRKPDGAIYTVGSPIDYGVIVD TKAYSGGYNLPIGQADEMERYVEENQTRDKHLNPNEWWKVYPSSVTEFK FLF
  • TALENs TAL Effector Nucleases
  • TALENs may be used to introduce site-specific double strand breaks at targeted genomic loci. Site-specific double-strand breaks are created when two independent TALENs bind to nearby DNA sequences, thereby permitting dimerization of FokI and cleavage of the target DNA. TALENs have advanced genome editing due to their high rate of successful and efficient genetic modification. This DNA cleavage may stimulate the natural DNA-repair machinery, leading to one of two possible repair pathways: homology-directed repair (HDR) or the non-homologous end joining (NHEJ) pathway.
  • HDR homology-directed repair
  • NHEJ non-homologous end joining
  • the TALENs may be designed to target any gene involved in a genetic disease.
  • the TALENs may include a nuclease and a TALE DNA-binding domain that binds to the target gene in a TALEN target region.
  • the target gene may have a mutation such as a frameshift mutation or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, the TALEN may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon.
  • a “TALEN target region” includes the binding regions for two TALENs and the spacer region, which occurs between the binding regions. The two TALENs bind to different binding regions within the TALEN target region, after which the TALEN target region is cleaved. Examples of TALENs are described in International Patent Application No. PCT/US2013/038536, which is incorporated by reference in its entirety.
  • the composition includes a nucleotide sequence encoding a transcriptional activator that activates a target gene.
  • the transcriptional activator may be engineered.
  • an engineered transcriptional activator may be a CRISPR/Cas9-based system, a zinc finger fusion protein, or a TALE fusion protein.
  • the CRISPR/Cas9-based system may be used to activate transcription of a target gene with RNA.
  • the CRISPR/Cas9-based system may include a fusion protein, as described above, wherein the second polypeptide domain has transcription activation activity or histone modification activity.
  • the second polypeptide domain may include VP64 or p300.
  • the transcriptional activator may be a zinc finger fusion protein.
  • the zinc finger targeted DNA-binding domains as described above, can be combined with a domain that has transcription activation activity or histone modification activity.
  • the domain may include VP64 or p300.
  • TALE fusion proteins may be used to activate transcription of a target gene.
  • the TALE fusion protein may include a TALE DNA-binding domain and a domain that has transcription activation activity or histone modification activity.
  • the domain may include VP64 or p300.
  • the present invention is directed to a composition for altering gene expression and engineering or altering genomic DNA in a cell or subject.
  • the composition may also include a viral delivery system.
  • the present invention is directed to a composition for genome editing a target gene in skeletal muscle or cardiac muscle of a subject.
  • the composition includes a modified AAV vector and a nucleotide sequence encoding a site-specific nuclease.
  • the composition delivers active forms of site-specific nucleases to skeletal muscle or cardiac muscle.
  • the composition may further comprise a donor DNA or a transgene.
  • the target gene may be involved in differentiation of a cell or any other process in which activation, repression, or disruption of a gene may be desired, or may have a mutation such as a deletion, frameshift mutation, or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, the site-specific nucleases may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon, the aberrant splice acceptor site or the aberrant splice donor site.
  • the site-specific nucleases may also be used to disrupt normal gene splicing by targeting splice acceptors and donors to induce skipping of premature stop codons or restore a disrupted reading frame.
  • the site-specific nucleases may or may not mediate off-target changes to protein-coding regions of the genome.
  • the composition includes a modified adeno-associated virus (AAV) vector.
  • the modified AAV vector may have enhanced cardiac and skeletal muscle tissue tropism.
  • the modified AAV vector may be capable of delivering and expressing the site-specific nuclease in the cell of a mammal.
  • the modified AAV vector may be an AAV-SASTG vector (Piacentino et al. (2012) Human Gene Therapy 23:635-646).
  • the modified AAV vector may deliver nucleases to skeletal and cardiac muscle in vivo.
  • the modified AAV vector may be based on one or more of several capsid types, including AAV1, AAV2, AAV5, AAV6, AAV8, and AAV9.
  • the modified AAV vector may be based on AAV2 pseudotype with alternative muscle-tropic AAV capsids, such as AAV2/1, AAV2/6, AAV2/7, AAV2/8, AAV2/9, AAV2.5 and AAV/SASTG vectors that efficiently transduce skeletal muscle or cardiac muscle by systemic and local delivery (Seto et al. Current Gene Therapy (2012) 12:139-151).
  • AAV2 pseudotype with alternative muscle-tropic AAV capsids such as AAV2/1, AAV2/6, AAV2/7, AAV2/8, AAV2/9, AAV2.5 and AAV/SASTG vectors that efficiently transduce skeletal muscle or cardiac muscle by systemic and local delivery (Seto et al. Current Gene Therapy (2012) 12:139-151).
  • the present disclosure also provides DNA targeting systems or compositions of at least one CRISPR/Cas9-based system, as described above. These compositions may be used in genome editing, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases.
  • the composition includes a CRISPR/Cas9-based system that includes a Cas9 protein or Cas9 fusion protein, as described above.
  • the CRISPR/Cas9-based system may also include at least one gRNA, as described above.
  • the present disclosure also provides multiplex CRISPR/Cas9-based systems, as described above. These compositions may be used in genome editing, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases. These compositions may be used to target more than one gene.
  • the composition includes a modified lentiviral vector comprising a CRISPR/Cas9-based system that includes a Cas9 protein or Cas9 fusion protein, as described above and more than one gRNA, as described above.
  • compositions may be used to repair genetic mutations that cause disease.
  • the disclosed compositions may be used to disrupt genes such that gene disruption leads to increases in muscle regeneration or muscle strength, or decreases in muscle aging.
  • the disclosed compositions may be used to introduce therapeutic genes to be expressed systemically from skeletal muscle or cardiac muscle, such as clotting factors or monoclonal antibodies.
  • the disclosed compositions may be used to modulate mammalian gene expression.
  • the disclosed compositions may be used to transdifferentiate or induce the differentiation of a cell or correct a mutant gene in a cell. Examples of activation of genes related to cell and gene therapy, genetic reprogramming, and regenerative medicine are provided.
  • RNA-guided transcriptional activators may be used to reprogram cell lineage specification. Activation of endogenous genes encoding the key regulators of cell fate, rather than forced overexpression of these factors, may potentially lead to more rapid, efficient, stable, or specific methods for genetic reprogramming, transdifferentiation, and/or induced differentiation.
  • the present disclosure is directed to a method of genome editing in a skeletal muscle or cardiac muscle of a subject.
  • the method comprises administering to the skeletal muscle or cardiac muscle of the subject the composition for genome editing in skeletal muscle or cardiac muscle, as described above.
  • the genome editing may include correcting a mutant gene or inserting a transgene. Correcting the mutant gene may include deleting, rearranging, or replacing the mutant gene. Correcting the mutant gene may include nuclease-mediated NHEJ or HDR.
  • CRISPR/Cas9-based systems may be used to modulate mammalian gene expression.
  • the disclosed CRISPR/Cas9-based systems may be used to transdifferentiate or induce differentiation of a cell or correct a mutant gene in a cell. Examples of activation of genes related to cell and gene therapy, genetic reprogramming, and regenerative medicine are provided.
  • RNA-guided transcriptional activators may be used to reprogram cell lineage specification.
  • the present disclosure provides a mechanism for activating the expression of endogenous genes, such as mammalian genes, based on targeting a transcriptional activator to promoters via RNA using a CRISPR/Cas9 based system, as described above.
  • endogenous genes such as mammalian genes
  • CRISPR/Cas9 based system as described above.
  • This is fundamentally different from previously described methods based on engineering sequence-specific DNA-binding proteins and may provide opportunities for targeted gene regulation.
  • the gRNAs can also be transfected directly to cells following in vitro transcription. Multiple gRNAs targeted to single promoters were shown, but simultaneous targeting of multiple promoters could also be possible. Recognition of genomic target sites with RNAs, rather than proteins, may also circumvent limitations of targeting epigenetically modified sites, such as methylated DNA.
  • Cas9 fused to a transcriptional activation domain can be targeted by combinations of guide RNA molecules to induce the expression of endogenous human genes. This straightforward and versatile approach for targeted gene activation circumvents the need for engineering new proteins and allows for widespread synthetic gene regulation.
  • the method may include administering to a cell or subject a CRISPR/Cas9-based system, a polynucleotide or vector encoding said CRISPR/Cas9-based system, or DNA targeting systems or compositions of at least one CRISPR/Cas9-based system, as described above.
  • the method may include administering a CRISPR/Cas9-based system, such as administering a Cas9 fusion protein containing transcription activation domain or a nucleotide sequence encoding said Cas9 fusion protein.
  • the Cas9 fusion protein may include a transcription activation domain such as aVP16 protein or a transcription co-activator such as a p300 protein.
  • the Cas9 fusion protein may include a transcription activation domain such as aVP16 protein.
  • the transcription activation domain may contain at least 1 VP16 protein, at least 2 VP16 proteins, at least 3 VP16 proteins, at least 4 VP16 proteins (i.e., a VP64 activator domain), at least 5 VP16 proteins, at least 6 VP16 proteins, at least 6 VP16 proteins, or at least 10 VP16 proteins.
  • the Cas9 protein may be a Cas9 protein in which the nuclease activity is inactivated.
  • the Cas9 protein in the fusion protein may be iCas9 (amino acids 36-1403 of SEQ ID NO: 1), which includes the amino acid substitutions of D10A and H840A.
  • the Cas9 fusion protein may be iCas9-VP64.
  • the Cas9 fusion protein may include a transcription co-activation domain such as a p300 protein.
  • the p300 protein also known as EP300 or E1A binding protein p300
  • EP300 or E1A binding protein p300 is encoded by the EP300 gene and regulates the activity of many genes in tissues throughout the body.
  • the p300 protein plays a role in regulating cell growth and division, prompting cells to mature and assume specialized functions (differentiate) and preventing the growth of cancerous tumors.
  • the p300 protein activates transcription by connecting transcription factors with a complex of proteins that carry out transcription in the cell's nucleus.
  • the p300 interaction with transcription factors is managed by one or more of p300 domains: the nuclear receptor interaction domain (RID), the CREB and MYB interaction domain (KIX), the cysteine/histidine regions (TAZ1/CH and TAZ2/CH3) and the interferon response binding domain (IBiD).
  • the last four domains, KIX, TAZ1, TAZ2 and IBiD of p300 each bind tightly to a sequence spanning both transactivation domains 9aaTADs of transcription factor p53.
  • the protein functions as histone acetyltransferase that regulates transcription via chromatin remodeling, and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein.
  • the p300 protein may activate Mothers against decapentaplegic homolog 7, MAF, TSG101, Peroxisome proliferator-activated receptor alpha, NPAS2, PAX6, DDX5, MYBL2, Mothers against decapentaplegic homolog 1, Mothers against decapentaplegic homolog 2, Lymphoid enhancer-binding factor 1, SNIP1, TRERF1, STAT3, EID1, RAR-related orphan receptor alpha, ELK1, HIF1A, ING5, Peroxisome proliferator-activated receptor gamma, SS18, TCF3, Zif268, Estrogen receptor alpha, GPS2, MyoD, YY1, ING4, PROX1, CITED1, HNF1A, MEF2C, MEF2D, MAML1, Twist transcription factor, PTMA, IRF2, DTX1, Flap structure-specific endonuclease 1, Myocyte-specific enhancer factor 2A, CDX2, BRCA1, HNRPU, STAT6, CITED
  • the transcription co-activation domain may include a human p300 protein or a fragment thereof.
  • the transcription co-activation domain may include a wild-type human p300 protein or a mutant human p300 protein, or fragments thereof.
  • the transcription co-activation domain may include the core lysine-acetyltranserase domain of the human p300 protein, i.e., the p300 HAT Core (also known as “p300 WT Core”; see FIG. 58 ).
  • the Cas9 protein may be a Cas9 protein in which the nuclease activity is inactivated.
  • the Cas9 protein in the fusion protein may be iCas9 (amino acids 36-1403 of SEQ ID NO: 1), which includes the amino acid substitutions of D10A and H840A.
  • the Cas9 fusion protein may be iCas9-p300 WT Core.
  • the method may also include administering to a cell or subject a CRISPR/Cas9-based system at least one gRNA, wherein the gRNAs target different DNA sequences.
  • the target DNA sequences may be overlapping.
  • the number of gRNA administered to the cell may be at least 1 gRNA, at least 2 different gRNAs, at least 3 different gRNAs at least 4 different gRNAs, at least 5 different gRNAs, at least 6 different gRNAs, at least 7 different gRNAs, at least 8 different gRNAs, at least 9 different gRNAs, at least 10 different gRNAs, at least 11 different gRNAs, at least 12 different gRNAs, at least 13 different gRNAs, at least 14 different gRNAs, at least 15 different gRNAs, at least 16 different gRNAs, at least 17 different gRNAs, at least 18 different gRNAs, at least 18 different gRNAs, at least 20 different gRNAs, at least 25 different
  • the number of gRNA administered to the cell may be between at least 1 gRNA to at least 50 different gRNAs, at least 1 gRNA to at least 45 different gRNAs, at least 1 gRNA to at least 40 different gRNAs, at least 1 gRNA to at least 35 different gRNAs, at least 1 gRNA to at least 30 different gRNAs, at least 1 gRNA to at least 25 different gRNAs, at least 1 gRNA to at least 20 different gRNAs, at least 1 gRNA to at least 16 different gRNAs, at least 1 gRNA to at least 12 different gRNAs, at least 1 gRNA to at least 8 different gRNAs, at least 1 gRNA to at least 4 different gRNAs, at least 4 gRNAs to at least 50 different gRNAs, at least 4 different gRNAs to at least 45 different gRNAs, at least 4 different gRNAs to at least 40 different gRNAs, at least 4 different gRNAs to at least 35
  • the gRNA may comprise a complementary polynucleotide sequence of the target DNA sequence followed by NGG.
  • the gRNA may comprise a “G” at the 5′ end of the complementary polynucleotide sequence.
  • the gRNA may comprise at least a 10 base pair, at least a 11 base pair, at least a 12 base pair, at least a 13 base pair, at least a 14 base pair, at least a 15 base pair, at least a 16 base pair, at least a 17 base pair, at least a 18 base pair, at least a 19 base pair, at least a 20 base pair, at least a 21 base pair, at least a 22 base pair, at least a 23 base pair, at least a 24 base pair, at least a 25 base pair, at least a 30 base pair, or at least a 35 base pair complementary polynucleotide sequence of the target DNA sequence followed by NGG.
  • the gRNA may target at least one of the promoter region, the enhancer region or the transcribed region of the target gene.
  • the gRNA may include a nucleic acid sequence of at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the present disclosure provides a mechanism for repressing the expression of endogenous genes, such as mammalian genes, based on targeting genomic regulatory elements, such as distal enhancers, via RNA using a CRISPR/Cas9 based system, as described above.
  • the Cas9 fusion protein may include a transcriptional repressor, such as the KRAB repressor.
  • the Cas9 fusion protein may be dCas9-KRAB.
  • the dCas9-KRAB may additionally affect epigenetic gene regulation by recruiting heterochromatin-forming factors to the targeted locus.
  • the CRISPR/dCas9-KRAB system may be used to repress the transcription of genes, but can also be used to target genomic regulatory elements which were previously inaccessible by traditional repression methods such as RNA interference ( FIG. 53B ).
  • Delivering dCas9-KRAB with gRNAs targeted to a distal enhancer may disrupt expression of multiple genes regulated by the targeted enhancer (see FIG. 53C ).
  • the targeted enhancer may be any enhancer for a gene such as the HS2 enhancer.
  • the present disclosure provides a mechanism for transdifferentiating or inducing differentiation of cells by activating endogenous genes via RNA using a CRISPR/Cas9-based system, as described above.
  • the CRISPR/Cas9-based system may be used to transdifferentiate cells.
  • Transdifferentiation also known as lineage reprogramming or direct conversion, is a process where cells convert from one differentiated cell type to another without undergoing an intermediate pluripotent state or progenitor cell type. It is a type of metaplasia, which includes all cell fate switches, including the interconversion of stem cells. Transdifferentiation of cells has potential uses for disease modeling, drug discovery, gene therapy and regenerative medicine.
  • Activation of endogenous genes such as BRN2, MYT1L, ASCL1, NANOG, and/or MYOD1, using the CRISPR/Cas9 based system described above may lead to transdifferentiation of several cell types, such as fibroblasts, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, or smooth muscle cells, into neuronal and myogenic phenotypes, respectively.
  • endogenous genes such as BRN2, MYT1L, ASCL1, NANOG, and/or MYOD1
  • CRISPR/Cas9 based system described above may lead to transdifferentiation of several cell types, such as fibroblasts, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, or smooth muscle cells, into neuronal and myogenic phenotypes, respectively.
  • the CRISPR/Cas9-based system may be used to induce differentiation of cells, such as stem cells, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, or smooth muscle cells.
  • stem cells such as embryonic stem cells or pluripotent stem cells, may be induced to differentiate into muscle cells or vascular endothelial cell, i.e., induce neuronal or myogenic differentiation.
  • the multiplex CRISPR/Cas9-Based System takes advantage of the simplicity and low cost of sgRNA design and may be helpful in exploiting advances in high-throughput genomic research using CRISPR/Cas9 technology.
  • the single lentiviral vectors described here are useful in expressing Cas9 and numerous sgRNAs in difficult cell lines, such as primary fibroblasts described here ( FIG. 47 ).
  • the multiplex CRISPR/Cas9-Based System may be used in the same ways as the CRISPR/Cas9-Based System described above.
  • this system will be useful for expressing other novel Cas9-based effectors that control epigenetic modifications for diverse purposes, including interrogation of genome architecture and pathways of endogenous gene regulation.
  • endogenous gene regulation is a delicate balance between multiple enzymes, multiplexing Cas9 systems with different functionalities will allow for examining the complex interplay among different regulatory signals.
  • the vector described here should be compatible with aptamer-modified sgRNAs and orthogonal Cas9s to enable independent genetic manipulations using a single set of sgRNAs.
  • the multiplex CRISPR/Cas9-Based System may be used to activate at least one endogenous gene in a cell.
  • the method includes contacting a cell with the modified lentiviral vector.
  • the endogenous gene may be transiently activated or stably activated.
  • the endogenous gene may be transiently repressed or stably repressed.
  • the fusion protein may be expressed at similar levels to the sgRNAs.
  • the fusion protein may be expressed at different levels compared to the sgRNAs.
  • the cell may be a primary human cell.
  • the multiplex CRISPR/Cas9-Based System may be used in a method of multiplex gene editing in a cell.
  • the method includes contacting a cell with the modified lentiviral vector.
  • the multiplex gene editing may include correcting a mutant gene or inserting a transgene. Correcting a mutant gene may include deleting, rearranging or replacing the mutant gene. Correcting the mutant gene may include nuclease-mediated non-homologous end joining or homology-directed repair.
  • the multiplex gene editing may include deleting or correcting at least one gene, wherein the gene is an endogenous normal gene or a mutant gene.
  • the multiplex gene editing may include deleting or correcting at least two genes. For example, at least two genes, at least three genes, at least four genes, at least five genes, at least six genes, at least seven genes, at least eight genes, at least nine genes, or at least ten genes may be deleted or corrected.
  • the multiplex CRISPR/Cas9-Based System may be used in a method of multiplex modulation of gene expression in a cell.
  • the method includes contacting a cell with the modified lentiviral vector.
  • the method may include modulating the gene expression levels of at least one gene.
  • the gene expression of the at least one target gene is modulated when gene expression levels of the at least one target gene are increased or decreased compared to normal gene expression levels for the at least one target gene.
  • the gene expression levels may be RNA or protein levels.
  • the present disclosure is also directed to a method of correcting a mutant gene in a subject.
  • the method comprises administering to the skeletal muscle or cardiac muscle of the subject the composition for genome editing in skeletal muscle or cardiac muscle, as described above.
  • Use of the composition to deliver the site-specific nuclease to the skeletal muscle or cardiac muscle may restore the expression of a full-functional or partially-functional protein with a repair template or donor DNA, which can replace the entire gene or the region containing the mutation.
  • the site-specific nuclease may be used to introduce site-specific double strand breaks at targeted genomic loci. Site-specific double-strand breaks are created when the site-specific nuclease binds to a target DNA sequences, thereby permitting cleavage of the target DNA. This DNA cleavage may stimulate the natural DNA-repair machinery, leading to one of two possible repair pathways: homology-directed repair (HDR) or the non-homologous end joining (NHEJ) pathway.
  • HDR homology-directed repair
  • the present disclosure is directed to genome editing with a site-specific nuclease without a repair template, which can efficiently correct the reading frame and restore the expression of a functional protein involved in a genetic disease.
  • the disclosed site-specific nucleases may involve using homology-directed repair or nuclease-mediated non-homologous end joining (NHEJ)-based correction approaches, which enable efficient correction in proliferation-limited primary cell lines that may not be amenable to homologous recombination or selection-based gene correction.
  • NHEJ non-homologous end joining
  • This strategy integrates the rapid and robust assembly of active site-specific nucleases with an efficient gene editing method for the treatment of genetic diseases caused by mutations in nonessential coding regions that cause frameshifts, premature stop codons, aberrant splice donor sites or aberrant splice acceptor sites.
  • Restoration of protein expression from an endogenous mutated gene may be through template-free NHEJ-mediated DNA repair.
  • the correction of the target gene reading frame in the genome by a transiently expressed site-specific nuclease may lead to permanently restored target gene expression by each modified cell and all of its progeny.
  • Nuclease mediated NHEJ gene correction may correct the mutated target gene and offers several potential advantages over the HDR pathway.
  • NHEJ does not require a donor template, which may cause nonspecific insertional mutagenesis.
  • NHEJ operates efficiently in all stages of the cell cycle and therefore may be effectively exploited in both cycling and post-mitotic cells, such as muscle fibers. This provides a robust, permanent gene restoration alternative to oligonucleotide-based exon skipping or pharmacologic forced read-through of stop codons and could theoretically require as few as one drug treatment.
  • NHEJ-based gene correction using a CRISPR/Cas9-based system may be combined with other existing ex vivo and in vivo platforms for cell- and gene-based therapies, in addition to the plasmid electroporation approach described here.
  • delivery of a CRISPR/Cas9-based system by mRNA-based gene transfer or as purified cell permeable proteins could enable a DNA-free genome editing approach that would circumvent any possibility of insertional mutagenesis.
  • the method as described above further includes administrating a donor template to the cell.
  • the donor template may include a nucleotide sequence encoding a full-functional protein or a partially-functional protein.
  • the donor template may include a miniaturized dystrophin construct, termed minidystrophin (“minidys”), a full-functional dystrophin construct for restoring a mutant dystrophin gene, or a fragment of the dystrophin gene that after homology-directed repair leads to restoration of the mutant dystrophin gene.
  • minidystrophin minidystrophin
  • the present disclosure is also directed to genome editing with the CRISPR/Cas9-based system to restore the expression of a full-functional or partially-functional protein with a repair template or donor DNA, which can replace the entire gene or the region containing the mutation.
  • the CRISPR/Cas9-based system may be used to introduce site-specific double strand breaks at targeted genomic loci. Site-specific double-strand breaks are created when the CRISPR/Cas9-based system binds to a target DNA sequences using the gRNA, thereby permitting cleavage of the target DNA.
  • the CRISPR/Cas9-based system has the advantage of advanced genome editing due to their high rate of successful and efficient genetic modification.
  • a CRISPR/Cas9-based system directed towards the dystrophin gene may include a gRNA having a nucleic acid sequence of any one of SEQ ID NOs: 65-115.
  • the present disclosure is directed to genome editing with CRISPR/Cas9-based system without a repair template, which can efficiently correct the reading frame and restore the expression of a functional protein involved in a genetic disease.
  • the disclosed CRISPR/Cas9-based system and methods may involve using homology-directed repair or nuclease-mediated non-homologous end joining (NHEJ)-based correction approaches, which enable efficient correction in proliferation-limited primary cell lines that may not be amenable to homologous recombination or selection-based gene correction.
  • NHEJ nuclease-mediated non-homologous end joining
  • This strategy integrates the rapid and robust assembly of active CRISPR/Cas9-based system with an efficient gene editing method for the treatment of genetic diseases caused by mutations in nonessential coding regions that cause frameshifts, premature stop codons, aberrant splice donor sites or aberrant splice acceptor sites.
  • the present disclosure provides methods of correcting a mutant gene in a cell and treating a subject suffering from a genetic disease, such as DMD.
  • the method may include administering to a cell or subject a CRISPR/Cas9-based system, a polynucleotide or vector encoding said CRISPR/Cas9-based system, or composition of said CRISPR/Cas9-based system as described above.
  • the method may include administering a CRISPR/Cas9-based system, such as administering a Cas9 protein or Cas9 fusion protein containing a second domain having nuclease activity, a nucleotide sequence encoding said Cas9 protein or Cas9 fusion protein, and/or at least one gRNA, wherein the gRNAs target different DNA sequences.
  • the target DNA sequences may be overlapping.
  • the number of gRNA administered to the cell may be at least 1 gRNA, at least 2 different gRNA, at least 3 different gRNA at least 4 different gRNA, at least 5 different gRNA, at least 6 different gRNA, at least 7 different gRNA, at least 8 different gRNA, at least 9 different gRNA, at least 10 different gRNA, at least 15 different gRNA, at least 20 different gRNA, at least 30 different gRNA, or at least 50 different gRNA, as described above.
  • the gRNA may include a nucleic acid sequence of at least one of SEQ ID NOs: 65-115.
  • the method may involve homology-directed repair or non-homologous end joining.
  • the present disclosure is directed to a method of treating a subject in need thereof.
  • the method comprises administering to a tissue of a subject the composition for altering gene expression and engineering or altering genomic DNA in a cell or subject genome editing, as described above.
  • the method may comprises administering to the skeletal muscle or cardiac muscle of the subject the composition for genome editing in skeletal muscle or cardiac muscle, as described above.
  • the subject may be suffering from a skeletal muscle or cardiac muscle condition causing degeneration or weakness or a genetic disease.
  • the subject may be suffering from Duchenne muscular dystrophy, as described above.
  • the method may be used for correcting the dystrophin gene and recovering full-functional or partially-functional protein expression of said mutated dystrophin gene.
  • the disclosure provides a method for reducing the effects (e.g., clinical symptoms/indications) of DMD in a patient.
  • the disclosure provides a method for treating DMD in a patient.
  • the disclosure provides a method for preventing DMD in a patient.
  • the disclosure provides a method for preventing further progression of DMD in a patient.
  • compositions may comprise genetic constructs that encodes the CRISPR/Cas9-based system, as disclosed herein.
  • the genetic construct such as a plasmid, may comprise a nucleic acid that encodes the CRISPR/Cas9-based system, such as the Cas9 protein and Cas9 fusion proteins and/or at least one of the gRNAs.
  • the compositions, as described above may comprise genetic constructs that encodes the modified AAV vector and a nucleic acid sequence that encodes the site-specific nuclease, as disclosed herein.
  • the genetic construct, such as a plasmid may comprise a nucleic acid that encodes the site-specific nuclease.
  • compositions may comprise genetic constructs that encodes the modified lentiviral vector, as disclosed herein.
  • the genetic construct such as a plasmid, may comprise a nucleic acid that encodes the Cas9-fusion protein and at least one sgRNA.
  • the genetic construct may be present in the cell as a functioning extrachromosomal molecule.
  • the genetic construct may be a linear minichromosome including centromere, telomeres or plasmids or cosmids.
  • the genetic construct may also be part of a genome of a recombinant viral vector, including recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus.
  • the genetic construct may be part of the genetic material in attenuated live microorganisms or recombinant microbial vectors which live in cells.
  • the genetic constructs may comprise regulatory elements for gene expression of the coding sequences of the nucleic acid.
  • the regulatory elements may be a promoter, an enhancer, an initiation codon, a stop codon, or a polyadenylation signal.
  • the nucleic acid sequences may make up a genetic construct that may be a vector.
  • the vector may be capable of expressing the fusion protein, such as the Cas9-fusion protein or site-specific nuclease, in the cell of a mammal.
  • the vector may be recombinant.
  • the vector may comprise heterologous nucleic acid encoding the fusion protein, such as the Cas9-fusion protein or site-specific nuclease.
  • the vector may be a plasmid.
  • the vector may be useful for transfecting cells with nucleic acid encoding the Cas9-fusion protein or site-specific nuclease, which the transformed host cell is cultured and maintained under conditions wherein expression of the Cas9-fusion protein or the site-specific nuclease system takes place.
  • Coding sequences may be optimized for stability and high levels of expression. In some instances, codons are selected to reduce secondary structure formation of the RNA such as that formed due to intramolecular bonding.
  • the vector may comprise heterologous nucleic acid encoding the CRISPR/Cas9-based system or the site-specific nuclease and may further comprise an initiation codon, which may be upstream of the CRISPR/Cas9-based system or the site-specific nuclease coding sequence, and a stop codon, which may be downstream of the CRISPR/Cas9-based system or the site-specific nuclease coding sequence.
  • the initiation and termination codon may be in frame with the CRISPR/Cas9-based system or the site-specific nuclease coding sequence.
  • the vector may also comprise a promoter that is operably linked to the CRISPR/Cas9-based system or the site-specific nuclease coding sequence.
  • the promoter operably linked to the CRISPR/Cas9-based system or the site-specific nuclease coding sequence may be a promoter from simian virus 40 (SV40), a mouse mammary tumor virus (MMTV) promoter, a human immunodeficiency virus (HIV) promoter such as the bovine immunodeficiency virus (BIV) long terminal repeat (LTR) promoter, a Moloney virus promoter, an avian leukosis virus (ALV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter, Epstein Barr virus (EBV) promoter, or a Rous sarcoma virus (RSV) promoter.
  • SV40 simian virus 40
  • MMTV mouse mammary tumor virus
  • HSV human immunode
  • the promoter may also be a promoter from a human gene such as human ubiquitin C (hUbC), human actin, human myosin, human hemoglobin, human muscle creatine, or human metalothionein.
  • the promoter may also be a tissue specific promoter, such as a muscle or skin specific promoter, natural or synthetic. Examples of such promoters are described in US Patent Application Publication No. US20040175727, the contents of which are incorporated herein in its entirety.
  • the vector may also comprise a polyadenylation signal, which may be downstream of the CRISPR/Cas9-based system or the site-specific nuclease.
  • the polyadenylation signal may be a SV40 polyadenylation signal, LTR polyadenylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human ⁇ -globin polyadenylation signal.
  • the SV40 polyadenylation signal may be a polyadenylation signal from a pCEP4 vector (Invitrogen, San Diego, Calif.).
  • the vector may also comprise an enhancer upstream of the CRISPR/Cas9-based system, i.e., the Cas9 protein or Cas9 fusion protein coding sequence or sgRNAs, or the site-specific nuclease.
  • the enhancer may be necessary for DNA expression.
  • the enhancer may be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, HA, RSV or EBV.
  • Polynucleotide function enhancers are described in U.S. Pat. Nos. 5,593,972, 5,962,428, and WO94/016737, the contents of each are fully incorporated by reference.
  • the vector may also comprise a mammalian origin of replication in order to maintain the vector extrachromosomally and produce multiple copies of the vector in a cell.
  • the vector may also comprise a regulatory sequence, which may be well suited for gene expression in a mammalian or human cell into which the vector is administered.
  • the vector may also comprise a reporter gene, such as green fluorescent protein (“GFP”) and/or a selectable marker, such as hygromycin (“Hygro”).
  • the vector may be expression vectors or systems to produce protein by routine techniques and readily available starting materials including Sambrook et al., Molecular Cloning and Laboratory Manual, Second Ed., Cold Spring Harbor (1989), which is incorporated fully by reference.
  • the vector may comprise the nucleic acid sequence encoding the CRISPR/Cas9-based system, including the nucleic acid sequence encoding the Cas9 protein or Cas9 fusion protein and the nucleic acid sequence encoding the at least one gRNA comprising the nucleic acid sequence of at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • the composition may be in a pharmaceutical composition.
  • the pharmaceutical composition may comprise about 1 ng to about 10 mg of DNA encoding the CRISPR/Cas9-based system or CRISPR/Cas9-based system protein component, i.e., the Cas9 protein or Cas9 fusion protein.
  • the pharmaceutical composition may comprise about 1 ng to about 10 mg of the DNA of the modified AAV vector and nucleotide sequence encoding the site-specific nuclease.
  • the pharmaceutical composition may comprise about 1 ng to about 10 mg of the DNA of the modified lentiviral vector.
  • the pharmaceutical compositions according to the present invention are formulated according to the mode of administration to be used. In cases where pharmaceutical compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free and particulate free.
  • An isotonic formulation is preferably used.
  • additives for isotonicity may include sodium chloride, dextrose, mannitol, sorbitol and lactose.
  • isotonic solutions such as phosphate buffered saline are preferred.
  • Stabilizers include gelatin and albumin.
  • a vasoconstriction agent is added to the formulation.
  • the composition may further comprise a pharmaceutically acceptable excipient.
  • the pharmaceutically acceptable excipient may be functional molecules as vehicles, adjuvants, carriers, or diluents.
  • the pharmaceutically acceptable excipient may be a transfection facilitating agent, which may include surface active agents, such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.
  • ISCOMS immune-stimulating complexes
  • LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid,
  • the transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid.
  • the transfection facilitating agent is poly-L-glutamate, and more preferably, the poly-L-glutamate is present in the composition for genome editing in skeletal muscle or cardiac muscle at a concentration less than 6 mg/ml.
  • the transfection facilitating agent may also include surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalene, and hyaluronic acid may also be used administered in conjunction with the genetic construct.
  • ISCOMS immune-stimulating complexes
  • LPS analog including monophosphoryl lipid A
  • muramyl peptides muramyl peptides
  • quinone analogs and vesicles such as squalene
  • the DNA vector encoding the composition may also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA-liposome mixture (see for example WO9324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.
  • the transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid.
  • the delivery of the compositions may be the transfection or electroporation of the composition as a nucleic acid molecule that is expressed in the cell and delivered to the surface of the cell.
  • the nucleic acid molecules may be electroporated using BioRad Gene Pulser Xcell or Amaxa Nucleofector IIb devices.
  • Several different buffers may be used, including BioRad electroporation solution, Sigma phosphate-buffered saline product #D8537 (PBS), Invitrogen OptiMM I (OM), or Amaxa Nucleofector solution V (N.V.).
  • Transfections may include a transfection reagent, such as Lipofectamine 2000.
  • the transfected cells Upon delivery of the composition to the tissue, and thereupon the vector into the cells of the mammal, the transfected cells will express the fusion protein, such as a CRISPR/Cas9-based system and/or a site-specific nuclease.
  • the composition may be administered to a mammal to alter gene expression or to re-engineer or alter the genome.
  • the composition may be administered to a mammal to correct the dystrophin gene in a mammal.
  • the mammal may be human, non-human primate, cow, pig, sheep, goat, antelope, bison, water buffalo, bovids, deer, hedgehogs, elephants, llama, alpaca, mice, rats, or chicken, and preferably human, cow, pig, or chicken.
  • the vector encoding a CRISPR/Cas9-based system protein component i.e., the Cas9 protein or Cas9 fusion protein
  • a CRISPR/Cas9-based system protein component i.e., the Cas9 protein or Cas9 fusion protein
  • the recombinant vector may be delivered by any viral mode.
  • the viral mode may be recombinant lentivirus, recombinant adenovirus, and/or recombinant adeno-associated virus.
  • the nucleotide encoding a CRISPR/Cas9-based system protein component may be introduced into a cell to genetically correct the target gene or alter gene expression of a gene, such as activate or repress endogenous genes.
  • a nucleotide encoding a CRISPR/Cas9-based system protein component, i.e., the Cas9 protein or Cas9 fusion protein, directed towards a mutant dystrophin gene by the gRNA may be introduced into a myoblast cell from a DMD patient.
  • the genetically corrected fibroblast cell may be treated with MyoD to induce differentiation into myoblasts, which may be implanted into subjects, such as the damaged muscles of a subject to verify that the corrected dystrophin protein was functional and/or to treat the subject.
  • the modified cells may also be stem cells, such as induced pluripotent stem cells, bone marrow-derived progenitors, skeletal muscle progenitors, human skeletal myoblasts from DMD patients, CD133+ cells, mesoangioblasts, and MyoD- or Pax7-transduced cells, or other myogenic progenitor cells.
  • the CRISPR/Cas9-based system may cause neuronal or myogenic differentiation of an induced pluripotent stem cell.
  • compositions may be administered to a subject by different routes including orally, parenterally, sublingually, transdermally, rectally, transmucosally, topically, via inhalation, via buccal administration, intrapleurally, intravenous, intraarterial, intraperitoneal, subcutaneous, intramuscular, intranasal intrathecal, and intraarticular or combinations thereof.
  • the composition may be administered as a suitably acceptable formulation in accordance with normal veterinary practice. The veterinarian may readily determine the dosing regimen and route of administration that is most appropriate for a particular animal.
  • the compositions may be administered by traditional syringes, needleless injection devices, “microprojectile bombardment gone guns”, or other physical methods such as electroporation (“EP”), “hydrodynamic method”, or ultrasound.
  • the composition may be delivered to the mammal by several technologies including DNA injection (also referred to as DNA vaccination) with and without in vivo electroporation, liposome mediated, nanoparticle facilitated, recombinant vectors such as recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus.
  • DNA injection also referred to as DNA vaccination
  • liposome mediated such as recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus.
  • the composition may be injected into the skeletal muscle or cardiac muscle.
  • the composition may be injected into the tibialis anterior muscle.
  • Cell types may be fibroblasts, pluripotent stem cells, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, smooth muscle cells, or K562 human erythroid leukemia cell line.
  • DMD human skeletal myoblasts from DMD patients
  • CD133+ cells mesoangioblasts, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, smooth muscle cells, and MyoD- or Pax7-transduced cells, or other myogenic progenitor cells.
  • Immortalization of human myogenic cells may be used for clonal derivation of genetically corrected myogenic cells.
  • Cells may be modified ex vivo to isolate and expand clonal populations of immortalized DMD myoblasts that contain a genetically corrected dystrophin gene and are free of other nuclease-introduced mutations in protein coding regions of the genome.
  • transient in vivo delivery of nucleases by non-viral or non-integrating viral gene transfer, or by direct delivery of purified proteins and gRNAs containing cell-penetrating motifs may enable highly specific correction in situ with minimal or no risk of exogenous DNA integration.
  • kits which may be used to edit a genome in skeletal muscle or cardiac muscle, such as correcting a mutant gene.
  • the kit comprises a composition for genome editing in skeletal muscle or cardiac muscle, as described above, and instructions for using said composition.
  • Instructions included in kits may be affixed to packaging material or may be included as a package insert. While the instructions are typically written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this disclosure. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like.
  • the term “instructions” may include the address of an internet site that provides the instructions.
  • the composition for genome editing in skeletal muscle or cardiac muscle may include a modified AAV vector and a nucleotide sequence encoding a site-specific nuclease, as described above.
  • the site-specific nuclease may include a ZFN, a TALEN, or CRISPR/Cas9-based system, as described above, that specifically binds and cleaves a mutated gene.
  • the site-specific nuclease, as described above may be included in the kit to specifically bind and target a particular region in the mutated gene.
  • the site-specific nuclease may be specific for a mutated dystrophin gene, as described above.
  • the kit may further include donor DNA, a gRNA, or a transgene, as described above.
  • kits which may be used to correct a mutated gene.
  • the kit comprises at least one component for correcting a mutated gene and instructions for using the CRISPR/Cas9-based system.
  • Instructions included in kits may be affixed to packaging material or may be included as a package insert. While the instructions are typically written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this disclosure. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like.
  • the term “instructions” may include the address of an internet site that provides the instructions.
  • At least one component may include at least one CRISPR/Cas9-based system, as described above, which specifically targets a gene.
  • the kit may include a Cas9 protein or Cas9 fusion protein, a nucleotide sequence encoding said Cas9 protein or Cas9 fusion protein, and/or at least one gRNA.
  • the CRISPR/Cas9-based system as described above, may be included in the kit to specifically bind and target a particular target region upstream, within or downstream of the coding region of the target gene.
  • a CRISPR/Cas9-based system may be specific for a promoter region of a target gene or a CRISPR/Cas9-based system may be specific for a mutated gene, for example a mutated dystrophin gene, as described above.
  • the kit may include donor DNA, as described above.
  • the present invention has multiple aspects, illustrated by the following non-limiting examples.
  • HEK293T cells were obtained from the American Tissue Collection Center (ATCC) through the Duke University Cancer Center Facilities and were maintained in DMEM supplemented with 10% fetal bovine serum and 1% penicillin/streptomycin at 37° C. with 5% C02.
  • HEK293T cells were transfected with Lipofectamine 2000 (Invitrogen) according to manufacturer's instructions. Transfection efficiencies were routinely higher than 80% as determined by fluorescence microscopy following delivery of a control eGFP expression plasmid.
  • Cas9 expression plasmid was transfected at a mass ratio of 3:1 to either the individual gRNA expression plasmids or the identical amount of gRNA expression plasmid consisting of a mixture of equal amounts of the four gRNAs.
  • PMEF-HL Primary mouse embryonic fibroblasts (PMEF-HL, Millipore, Billerica, Mass.) were seeded (75,000 per well) in 24-well TCPS plates (BD, Franklin Lakes, N.J.) and maintained at 37° C. and 5% CO 2 in complete MEF medium consisting of high glucose DMEM supplemented with 10% Premium Select FBS (Atlanta Biologicals, Lawrenceville, Ga.), 25 ⁇ g mL ⁇ 1 gentamicin (Invitrogen), 1 ⁇ GutaMAX, non-essential amino acids, sodium pyruvate, and ⁇ -mercaptoethanol (Invitrogen).
  • PMEF-HL Primary mouse embryonic fibroblasts
  • MEF transfections were performed with a single 1 ⁇ g cm ⁇ 2 dose of total plasmid DNA, delivered as cationic nanocomplexes following electrostatic condensation with poly(CBA-ABOL) in serum- and antibiotic-free OptiMEM, as described previously (Adler et al. Molecular therapy. Nucleic acids 1, e32 (2012)). OptiMEM was replaced with complete MEF medium 4 hrs after transfection.
  • MEFs were processed for qRT-PCR, or the complete MEF medium was replaced with N3 neural induction medium containing: DMEM/F-12 (Invitrogen), 1 ⁇ N-2 Supplement (Invitrogen), 10 ng mL ⁇ 1 human bFGF2 (Stemgent, Cambridge, Mass.), and 25 ⁇ g mL ⁇ 1 gentamicin (Invitrogen).
  • a GFP reporter vector pmax-GFP, 3486 bp, Amaxa, Cologne, Germany
  • Cas9 expression plasmid was transfected at a mass ratio of 3:1 or 1:1 to an equal mixture of four gRNA expression plasmids.
  • Plasmids The plasmids encoding wild-type and H840A Cas9 were obtained from Addgene (Plasmid #39312 and Plasmid #39316; Jinek, et al. Science 337, 816-821 (2012)). H840A Cas9 was cloned into the vector pcDNA3.1 in frame with a FLAG epitope tag and a nuclear localization sequence (NLS) at the N-terminus with a primer pair that introduced the D10A mutation. The VP64 domain, an NLS, and an HA epitope tag were cloned in frame with the Cas9 ORF at the C-terminus ( FIG. 1A , FIG. 9A ).
  • the tracrRNA and crRNA expression cassettes (Cong et al. Science 339, 819-823 (2013)) were ordered as gBlocks (Integrated DNA Technologies (IDT)) and cloned into a pZDonor plasmid (Sigma) with KpnI and SacII sites.
  • a chimeric guide RNA expression cassette (Mali et al. Science 339, 823-826 (2013)) was also ordered as gBlocks with modifications to include a BbsI restriction site to facilitate rapid cloning of new guide RNA spacer sequences ( FIG. 9B ).
  • the oligonucleotides containing the target sequences were obtained from IDT, hybridized, phosphorylated, and cloned in the appropriate plasmids using BbsI sites.
  • the target sequences are provided in Table 2.
  • the membranes were incubated with primary antibodies (HRP-conjugated anti-Flag (Cell Signaling, Cat #2044) in 5% BSA in TBS-T diluted 1:1000 overnight; anti-GAPDH (Cell Signaling, clone 14C10) in 5% milk in TBS-T diluted 1:5000 for 30 min; anti-ASCL1 (Santa Cruz, clone sc-48449) in 5% BSA diluted 1:500; or anti-g-globin (Santa Cruz, clone 51-7) in 5% milk diluted 1:500 and the membranes were washed with TBS-T for 30 min.
  • primary antibodies HRP-conjugated anti-Flag (Cell Signaling, Cat #2044) in 5% BSA in TBS-T diluted 1:1000 overnight
  • anti-GAPDH Cell Signaling, clone 14C10
  • anti-ASCL1 Sura Cruz, clone sc-48449
  • anti-g-globin Sura Cruz
  • Membranes labeled with primary antibodies were incubated with anti-rabbit HRP-conjugated antibody (Sigma-Aldrich) diluted 1:5000 for 30 min, anti-goat (1:3000) or anti-mouse (1:5000) and washed with TBS-T for 30 min.
  • Membranes were visualized using the Immun-Star WesternCTM Chemiluminescence Kit (Bio-Rad) and images were captured using a ChemiDocTM XRS+ System and processed using ImageLab software (Bio-Rad).
  • ELISA Serum-free culture media (OPTI-MEM) was collected and frozen at ⁇ 80° C. Human IL-1ra secretion into culture media was quantified via enzyme-linked immunosorbent assay (ELISA), according to the manufacturer's protocols (R&D Systems, Cat. No. DY280). The standard curve was prepared by diluting recombinant human IL-1ra in OPTI-MEM and the IL-1ra in culture media was measured undiluted. The samples were concentrated about 8 fold via centrifugation through 3 kDa MWCO filters for 20 min (Amicon Ultra, Cat # UFC500396). Reported values were corrected by the concentration factor for each sample.
  • RNA-Seq libraries were constructed. Briefly, first strand cDNA was synthesized from oligo dT Dynabead® (Invitrogen) captured mRNA using SuperScript® VILOTM cDNA Synthesis Kit (Invitrogen). Second strand cDNA was synthesized using DNA Polymerase I (New England Biolabs). cDNA was purified using Agencourt AMPure XP beads (Beckman Coulter) and Nextera transposase (Illumina; 5 min at 55° C.) was used to simultaneously fragment and insert sequencing primers into the double-stranded cDNA. Transposition reactions were halted using QG buffer (Qiagen) and fragmented cDNA was purified on AMPure XP beads. Indexed sequencing libraries were generated by 6 cycles of PCR.
  • mice anti-Ascl1 mouse anti-Ascl1 (BD clone 24B72D11.1, 1:100). The cells were then washed three times with PBS, incubated for 1 hr at room temperature in blocking buffer with Alexa Fluor 488 goat anti-mouse IgG and Alexa Fluor 594 goat anti-rabbit IgG (Invitrogen, 1:200), and washed three times with PBS. Stained MEFs were then scanned with a Nikon Eclipse TE2000-U inverted fluorescence microscope with a ProScanII motorized stage (Prior Scientific, Rockland, Mass.) to produce large mosaic images of each complete culture area. These mosaics were processed with a FIJI macro to automatically and uniformly threshold each image according to local contrast, exclude small debris, and to count the number of Tuj1 + cells in each well.
  • a FIJI macro to automatically and uniformly threshold each image according to local contrast, exclude small debris, and to count the number of Tuj1 + cells in each well.
  • the CRISPR system recognizes its target through base pairing of a 20 bp sequence in the gRNA to a complementary DNA target, which is followed by the NGG protospacer-adjacent motif (PAM) sequence, where N is any base pair.
  • PAM protospacer-adjacent motif
  • the four target site sequences were introduced into crRNA and gRNA expression plasmids 17 and co-transfected with the iCas9-VP64 expression plasmid into HEK293T cells. Although substantial induction of IL1RN expression was observed by qRT-PCR in samples treated with the combination of crRNAs, much higher levels were achieved with the combination of gRNAs ( FIG. 1C ). No changes to gene expression were observed in cells treated with gRNAs and an expression plasmid for iCas9 without VP64, demonstrating the critical role of the activation domain in modulating gene expression ( FIG. 1C ).
  • Nuclease activity at these target sites was confirmed to have been abrogated in the iCas9-VP64 system by performing the Surveyor assay to detect DNA repair events in samples treated with iCas9-VP64 and wild-type Cas9 ( FIG. 5 ).
  • By transfecting each of the four gRNAs individually or in combination, targeting multiple sites in the promoter with combinations of gRNAs showed robust increases in gene expression ( FIG. 1D ). High levels of IL1RN expression were observed only when the gRNA combinations were co-transfected with iCas9-VP64 ( FIG. 1D ), as seen with other classes of engineered transcription factors.
  • IL-1 receptor antagonist IL-1 receptor antagonist
  • FIG. 1E To examine the specificity of gene activation by iCas9-VP64, global gene expression of HEK293T cells treated with the combination of four gRNAs by RNA-seq was assessed ( FIG. 1F ). Notably, the only genes with significantly increased expression relative to control (false discovery rate ⁇ 3 ⁇ 10 ⁇ 4 ) were the four isoforms expressed from the IL1RN locus ( FIG. 4 ), indicating a high level of specificity of gene activation.
  • IL-1ra IL-1 receptor antagonist
  • gRNAs were designed to target each of the promoters of eight other genes relevant to medicine and biotechnology, including ASCL1, NANOG, HBG1/2, MYOD1, VEGFA, TERT, IL1B, and IL1R2 ( FIG. 4 , Table 2). Forced expression of ASCL1 and MYOD1 leads to transdifferentiation of several cell types into neuronal and myogenic phenotypes, respectively.
  • NANOG is a marker of pluripotency and that is also used in genetic reprogramming strategies.
  • Activation of the homologs HBG1 and HBG2, which encode ⁇ -globin during fetal development, can be used as a therapeutic strategy to compensate for ⁇ -globin mutations in sickle cell disease.
  • Up-regulation of VEGFA by synthetic transcription factors has been explored as a strategy to enhance tissue regeneration and wound healing.
  • the forced expression of telomerase, encoded by the TERT gene can be used to immortalize cell lines.
  • IL1B encodes the IL-1 ⁇ cytokine that mediates inflammation and autoimmunity.
  • IL-1 ⁇ signaling can be blocked by expression of IL-1ra or the decoy receptor encoded by IL1R2.
  • RNA-seq was performed on cells transfected with iCas9-VP64 and the four gRNAs targeting HBG1, three of which also target HBG2.
  • FIGS. 8A-8H show that the gRNA target sites are conserved in the human and mouse ASCL1 promoters.
  • FIG. 8A activation of ASCL1 expression was also observed in MEFs treated with plasmids encoding iCas9-VP64 and the four gRNAs ( FIG. 8B ). Furthermore, cells expressing Ascl1 and the neuronal marker Tuj1 were readily detected by immunofluorescence staining 12 days after transfection in the iCas9-VP64/gRNA-treated samples ( FIGS. 8C-8H ). No Tuj1-positive cells were observed in the cells treated with the control plasmid.
  • the IL32 gene was moderately downregulated (false discovery rate ⁇ 0.03) in both the samples treated with iCas9-VP64 and either the IL1RN- or HBG1/2-targeted gRNAs compared to control samples treated with only an empty expression plasmid ( FIG. 1F , FIG. 6 ). Because both the IL1RN and HBG1/2-targeted samples were similarly affected, it is unlikely that this is the result of off-target iCas9-VP64 activity related to the identity of the target sequences.
  • RNA sequencing experiments were performed with iCas9 EGEMs and found that only IL1RN gene isoforms increased in expression relative to control (FDR ⁇ 3 ⁇ 10.4).
  • Plasmid constructs The expression cassettes for the S. pyogenes sgRNA and human codon optimized Cas9 (hCas9) nuclease were used, as previously described (Perez-Pinera et al., Nat Methods 10:973-976 (2013)).
  • a GeneBlock IDT was synthesized containing a portion of the 3′ end of the Cas9 coding sequence fused to a T2A skipping peptide immediately upstream of a multiple cloning site and subsequently cloned into the hCas9 expression vector.
  • An eGFP reporter gene was then cloned into the T2A vector to allow co-translation of Cas9 and eGFP proteins from the same expression vector (hCas9-T2A-GFP, SEQ ID NO: 116).
  • HEK293T cells were obtained from the American Tissue Collection Center (ATCC) through the Duke Cell Culture Facility and were maintained in DMEM supplemented with 10% bovine calf serum and 1% penicillin/streptomycin. Immortalized myoblasts (Mamchaoui, K. et al.
  • Skelet Muscle 1, 1-11 (2011)) (one from a wild-type donor, and two ⁇ 48-50 DMD patient derived lines) were maintained in skeletal muscle media (PromoCell) supplemented with 20% bovine calf serum (Sigma), 50 ⁇ g/ml fetuin, 10 ng/ml human epidermal growth factor (Sigma), 1 ng/ml human basic fibroblast growth factor (Sigma), 10 ⁇ g/ml human insulin (Sigma), 1% GutaMAX (Invitrogen), and 1% penicillin/streptomycin (Invitrogen).
  • bovine calf serum Sigma
  • 50 ⁇ g/ml fetuin 10 ng/ml human epidermal growth factor
  • 1 ng/ml human basic fibroblast growth factor Sigma
  • 10 ⁇ g/ml human insulin Sigma
  • GutaMAX Invitrogen
  • penicillin/streptomycin Invitrogen
  • Primary DMD dermal fibroblasts were obtained from the Coriell Cell repository (GM05162A, A46-50) and maintained in DMEM supplemented with 10% fetal bovine serum, 1 ng/mL human basic fibroblast growth factor, and 1% penicillin/streptomycin. All cell lines were maintained at 37° C. and 5% C02.
  • HEK293T cells were transfected with Lipofectamine 2000 (Invitrogen) with 400 ng of each expression vector according to the manufacturer's protocol in 24 well plates.
  • Immortalized myoblasts and primary fibroblasts were transfected with 5 ⁇ g of each expression vector by electroporation using the Gene Pulser XCell (BioRad) with PBS as an electroporation buffer using optimized conditions for each line ( FIGS. 1A-1F ) (Ousterout et al. Mol Ther 21:1718-1726 (2013)).
  • Transfection efficiencies were measured by delivering an eGFP expression plasmid (pmaxGFP, Clontech) and using flow cytometry.
  • the indicated mass of electroporated plasmid corresponds to the amount used for each CRISPR/Cas9-based system.
  • CRISPR/Cas9-based system-induced lesions at the endogenous target site were quantified using the Surveyor nuclease assay (Guschin, D. Y. et al. Meth Mol Biol 649, 247-256 (2010)), which can detect mutations characteristic of nuclease-mediated NHEJ. After transfection, cells were incubated for 3 or 10 days at 37° C. and genomic DNA was extracted using the DNeasy Blood and Tissue kit (QIAGEN).
  • the target locus was amplified by 35 cycles of PCR with the AccuPrime High Fidelity PCR kit (Invitrogen) using primers specific to each locus (see Table 4), such as 5′-GAGTTTGGCTCAAATTGTTACTCTT-3′ (SEQ ID NO: 626) and 5′-GGGAAATGGTCTAGGAGAGTAAAGT-3′ (SEQ ID NO: 627).
  • the resulting PCR products were randomly melted and reannealed in a thermal cycler with the program: 95° C. for 240 s, followed by 85° C. for 60 s, 75° C. for 60 s, 65° C. for 60 s, 55° C. for 60 s, 45° C. for 60 s, 35° C. for 60 s, and 25° C. for 60 s with a ⁇ 0.3° C./s rate between steps.
  • 8 ⁇ L of PCR product was mixed with 1 ⁇ L of Surveyor Nuclease S and 1 ⁇ L of Enhancer S (Transgenomic) and incubated at 42° C. for 1 hr.
  • DMD myoblasts were electroporated with 5 micrograms each of hCas9-T2A-GFP and sgRNA expression vectors and incubated at 37° C. and 5% C02. Three days after electroporation, cells were trypsinized and collected for FACS sorting using a FACSvantage II sorting machine. GFP-positive cells were collected and grown for analysis.
  • PCR-based assay to detect genomic deletions.
  • the exon 51 or exon 45-55 loci were amplified from genomic DNA by PCR (Invitrogen AccuPrime High Fidelity PCR kit) using primers flanking each locus.
  • the flanking primers were CelI-CR1/2-F and CelI-CR5-R for exon 51 or CelI-CR6-F and CelI-CR36-R for exon 45-55 analysis (Table 4).
  • PCR products were separated on TAE-agarose gels and stained with ethidium bromide for analysis.
  • PCR-based detection of translocations Loci with predicted possible translocations were amplified by a two-step nested PCR (Invitrogen AccuPrime High Fidelity PCR kit for each step) of genomic DNA from cells transfected with Cas9 alone (control) or Cas9 with sgRNA.
  • translocations that may occur at each on-target and off-target sgRNA target site were amplified by 35 cycles of PCR using combinations of Surveyor primers for each locus that were modified to include restriction sites to facilitate cloning and sequencing analysis (Table 4).
  • PCR amplicons corresponding to the expected length of predicted translocations and only present in cells treated with sgRNA were purified (QIAGEN Gel Extraction kit) and analyzed by Sanger sequencing.
  • RNA analysis Immortalized myoblasts were differentiated into myofibers by replacing the growth medium with DMEM supplemented with 1% insulin-transferrin-selenium (Invitrogen #51500056) and 1% penicillin/streptomycin (Invitrogen #15140) for 5 days before the cells were trypsinized and collected. Total RNA was isolated from these cells using the RNeasy Plus Mini Kit (QIAGEN) according to the manufacturer's instructions. RNA was reverse transcribed to cDNA using the VILO cDNA synthesis kit (Life Technologies #11754) and 1.5 micrograms of RNA for 2 hrs at 42° C. according to the manufacturer's instructions.
  • the target loci were amplified by 35 cycles of PCR with the AccuPrime High Fidelity PCR kit (Invitrogen) using primers annealing to exons 44 and 52 to detect exon 51 deletion by CR1/5 or CR2/5 or primers annealing to exons 44 and 60 to detect exon 45-55 deletion by CR6/36 (Table 4).
  • PCR products were run on TAE-agarose gels and stained with ethidium bromide for analysis. The resolved PCR bands were cloned and analyzed by Sanger sequencing to verify the expected exon junctions.
  • Table 5 lists the sequences of primers used in Example 4.
  • Dystrophin expression was assessed at 3 days after transfecting HEK293T cells.
  • Cells were trypsinized, collected and lysed in RIPA buffer (Sigma) supplemented with a protease inhibitor cocktail (Sigma) and the total protein amount was quantified using the bicinchoninic acid assay according to the manufacturer's instructions (Pierce).
  • Samples were then mixed with NuPAGE loading buffer (Invitrogen) and 5% ⁇ -mercaptoethanol and heated to 85° C. for 10 minutes. Twenty-five micrograms of protein were separated on 4-12% NuPAGE Bis-Tris gels (Invitrogen) with MES buffer (Invitrogen).
  • Proteins were transferred to nitrocellulose membranes for 1-2 hrs in transfer buffer containing 10-20% methanol, such as 10% methanol, and 0.01% SDS. The blot was then blocked for 1 hr with 5% milk-TBST at room temperature. Blots were probed with the following primary antibodies: MANDYS8 to detect dystrophin (1:100, Sigma D8168) and rabbit anti-GAPDH (1:5000, Cell Signaling 2118S). Blots were then incubated with mouse or rabbit horseradish peroxidase-conjugated secondary antibodies (Santa Cruz) and visualized using the ChemiDoc chemilumescent system (BioRad) and Western-C ECL substrate (BioRad).
  • mice Transplantation into immunodeficient mice. All animal experiments were conducted under protocols approved by the Duke Institutional Animal Care & Use Committee. Cells were trypsinized, collected and washed in 1 ⁇ Hank's Balanced Salt Solution (HBSS, Sigma). Two million cells were pelleted and resuspended in five ⁇ L 1 ⁇ HBSS (Sigma) supplemented with cardiotoxin (Sigma #C9759) immediately prior to injection. These cells were transplanted into the hind limb tibialis anterior (TA) muscle of NOD.SCID.gamma (NSG) mice (Duke CCIF Breeding Core) by intramuscular injection. Four weeks after injection, mice were euthanized and the TA muscles were harvested.
  • HBSS Hank's Balanced Salt Solution
  • spectrin 1:20, Leica NCL-SPEC1
  • anti-dystrophin 1:2, Leica NCL-DYS3
  • spectrin or dystrophin expression was detected using a tyramide-based immunofluorescence signal amplification detection kit (Life Technologies, TSA Kit #22, catalog #T-20932,). Briefly, cryosections were incubated with 1:200 goat anti-mouse biotin-XX secondary (Life Technologies #B2763) in blocking buffer for 1 hr at room temperature. The signal was then amplified using streptavidin-HRP conjugates (1:100, from TSA Kit) in blocking buffer for 1 hr at room temperature.
  • cryosections were incubated with tyramide-AlexaFluor488 conjugates (1:100, TSA kit) in manufacturer-provided amplification buffer for 10 minutes at room temperature. Stained cryosections were then mounted in ProLong AntiFade (Life Technologies #P36934) and visualized with conventional fluorescence microscopy.
  • Cytotoxicity assay To quantitatively assess potential sgRNA or SpCas9 nuclease-associated cytotoxicity, HEK293T cells were transfected with 10 ng of a GFP reporter and 100 ng SpCas9 expression vector and 100 ng sgRNA expression vector using Lipofectamine 2000 according to the manufacturer's instructions (Invitrogen). The percentage of GFP positive cells was assessed at 2 and 5 days by flow cytometry. The survival rate was calculated as the decrease in GFP positive cells from days 2 to 5 and normalized to cells transfected with an empty nuclease expression vector as described (Cornu et al., Meth Mol Biol 649:237-245 (2010)).
  • the CRISPR/Cas9-based system was designed to target the dystrophin gene.
  • Various gRNAs were chosen to target different regions of the human and mouse dystrophin gene based on NNNNN NNNNN NNNNN NNNNN NGG (SEQ ID NO: 677) and GNNNN NNNNN NNNNN NNNNN NGG (SEQ ID NO: 678) (see Tables 6, 7 and 8).
  • Cas9 used DCR49 S. Aureus Frameshift in exon 51 SaCas9 (from Zhang pX441) (NNGRRT PAM) DCR50 S. Aureus Disrupt 5′ end of exon 51 SaCas9 (from Zhang pX441) (NNGRR PAM) DCR60 N. NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN Meningitidis 23 to bypass mdx mutation PAM) DCR61 N. NNNNGNNT Delete exon 23 and bypass NmCas9 (NNNNGNNT Meningitidis mdx mutation PAM) DCR62 N.
  • NNNNGANN Delete exon 23 and bypass NmCas9 (NNNNGANN Meningitidis mdx mutation PAM) DCR63 N.
  • NNNNGTTN Delete exon 23 and bypass NmCas9 (NNNNGTTN Meningitidis mdx mutation PAM) DCR64 N.
  • NNNNGNNT Delete exon 23 and bypass NmCas9 (NNNNGNNT Meningitidis mdx mutation PAM) DCR65 N.
  • NNNNGTTN Delete exon 23 and bypass NmCas9 (NNNNGTTN Meningitidis mdx mutation PAM) DCR66 N.
  • NNNNGANN Delete exon 23 and bypass NmCas9 (NNNNGANN Meningitidis mdx mutation PAM) DCR67 N.
  • NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN Meningitidis 51 to skip exon PAM) DCR68 N.
  • NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN Meningitidis 51 to skip exon PAM) DCR69 N.
  • NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN Meningitidis 51 to skip exon PAM) DCR70 N.
  • NNNNGANN Frameshift in exon 51 NmCas9 (NNNNGANN Meningitidis PAM) DCR71 N.
  • NNNNGNNT Frameshift in exon 51 NmCas9 (NNNNGNNT Meningitidis PAM) DCR72 N.
  • NNNNGNNT Target 3′ splice donor of exon NmCas9 (NNNNGNNT Meningitidis 51 to skip exon PAM) DCR73 N.
  • NNNNGNNT Delete exon 51 (bind as close NmCas9 (NNNNGNNT Meningitidis to DCR5 as possible) PAM) DCR74 N.
  • NNNNGANN Delete exon 51 (bind as close NmCas9 (NNNNGANN Meningitidis to DCR5 as possible) PAM) DCR75 N.
  • NNNNGTTN Delete exon 51 (bind as close NmCas9 (NNNNGTTN Meningitidis to DCR5 as possible) PAM) DCR76 N.
  • NNNNGNNT Delete exon 51 (bind as close NmCas9 (NNNNGNNT Meningitidis to DCR1/2 as possible) PAM) DCR77 N.
  • NNNNGTTN Delete exon 51 (bind as close NmCas9 (NNNNGTTN Meningitidis to DCR1/2 as possible) PAM) DCR78 N.
  • NNNNGANN Delete exon 51 (bind as close NmCas9 (NNNNGANN Meningitidis to DCR1/2 as possible) PAM) DCR79 N.
  • NNNNGANN Delete exons 45-55 bind as NmCas9 (NNNNGANN Meningitidis close to DCR6 as possible PAM) DCR81 N.
  • NNNNGTTN Delete exons 45-55 bind as NmCas9 (NNNNGTTN Meningitidis close to DCR6 as possible PAM) DCR82 N.
  • NNNNGNNT Delete exons 45-55 bind as NmCas9 (NNNNGNNT Meningitidis close to DCR36 as possible - PAM) overlaps NNNNGTTN PAM DCR83 N.
  • NNNNGTTN Delete exons 45-55 bind as NmCas9 (NNNNGTTN Meningitidis close to DCR36 as possible PAM) DCR84 N.
  • NNNNGANN Delete exons 45-55 bind as NmCas9 (NNNNGANN Meningitidis close to DCR36 as possible PAM) DCR85 S.
  • Aureus NNGRRT Delete exons 45-55 bind as SaCas9 (from Zhang pX441) close to DCR6 as possible (NNGRRT PAM) DCR86 S.
  • Aureus NNGRRT Delete exons 45-55 bind as SaCas9 (from Zhang pX441) close to DCR36 as possible (NNGRRT PAM)
  • the CRISPR/Cas9-based system was used in DMD 8036 (del148-50) cells to determine if the system could repair a mutant dystrophin gene.
  • 5 ⁇ g of Cas9 was co-transfected into DMD 8036 (del48-50) cells with either 7.5 ⁇ g of empty vector or gRNA.
  • 7.5 ⁇ g of CR1 (“DCR1”), 7.5 ⁇ g of CR5 (“DCR5”), 15 ⁇ g of CR3 (“DCR3”) or 7.5 ⁇ g of a combination of CR1 and CR5 (DCR1+DCR5) were used. Genomic DNA was harvested at 3 days post-transfection and analyzed using the Surveyor assay ( FIG.
  • This locus was amplified by PCR using primers flanking the region containing the genomic targets for CR1 and CR5 (the forward primer: 5′-gagaggttatgtggctttacca (SEQ ID NO:457), the reverse primer: 5′-ctgcgtagtgccaaaacaaa (SEQ ID NO:458)), resulting in a 1447 bp band for the wild-type locus or an expected size of approximately 630 bp for the deleted locus. After 7 days of differentiation, western blot of the treated cells shows expression of dystrophin protein (see FIG. 14 ).
  • FIGS. 16 A- 16 D To utilize the CRISPR/Cas9 gene editing platform for correcting a wide range of dystrophin mutations, dozens of sgRNAs targeted to the hotspot mutation region between exons 45-55 were created ( FIGS. 16 A- 16 D).
  • the S. pyogenes system that utilizes a human-codon optimized SpCas9 nuclease and a chimeric single-guide RNA (sgRNA) expression vector to guide efficient site-specific gene editing was used. Similar to Example 4 targeting exon 51 with TALENs, protospacers were selected to target the 5′ and 3′ ends of exons 45 through 55 which meet the 5′-NRG-3′ PAM requirement of SpCas9.
  • Small insertions or deletions created by NHEJ-based DNA repair within these exons can generate targeted frameshift mutations that address various dystrophin mutations surrounding each exon ( FIGS. 16A-16B ).
  • CR3 was designed to correct dystrophin mutations or deletions surrounding exon 51 by introducing small insertions or deletions in the 5′ end of exon 51 to restore the downstream dystrophin reading frame ( FIG. 16B ).
  • sgRNAs were designed to employ the multiplex capability of the CRISPR/Cas9 system and specifically delete individual exons or a series of exons to restore the dystrophin reading frame, similar to the methods of oligonucleotide-based exon skipping.
  • sgRNAs were targeted to the intronic regions surrounding exon 51 ( FIG. 16C ) or exons 45-55 ( FIG. 16D ). These sgRNAs were intentionally targeted to sites nearest to the downstream or upstream exon intended to be included in the resulting transcript to minimize the likelihood that the background patient deletion would include the intronic sgRNA target sites.
  • HEK293T cell line Gene editing frequency in the human HEK293T cell line was assessed to rapidly determine different sgRNA targeting efficiencies.
  • HEK293 Ts were transfected with constructs encoding human codon-optimized SpCas9 and the indicated sgRNA.
  • Each sgRNA was designed to modify the dystrophin gene as indicated.
  • the frequency of gene modification at day 3 or day 10 post-transfection was determined by the Surveyor assay.
  • the ratio of measured Surveyor signal at day 3 and day 10 was calculated to quantify the stability of gene editing frequencies for each sgRNA in human cells.
  • 29/32 As quantified by the Surveyor assay 3 days post-transfection, 29/32 ( ⁇ 90%) of the sgRNAs tested were able to mediate highly efficient gene modification at the intended locus (Table 9, FIG.
  • sgRNAs were selected to correct specific mutations in DMD patient myoblast cell lines. After transfection into DMD myoblasts, unexpectedly low or undetectable gene modification activity was observed as measured by the Surveyor assay ( FIG. 19C , bulk population). Flow cytometry was used to select for transfected cells co-expressing GFP through a 2A ribosomal skipping peptide linked to the SpCas9 protein ( FIG. 19A ). The addition of this fluorescent reporter to the SpCas9 expression vector did not seem to significantly impact gene editing activity in HEK293T cells ( FIG. 19B ).
  • a low percentage of transfected myoblasts ( ⁇ 0.5-2%) expressed the fluorescent reporter at 3 days after electroporation, despite high transfection efficiencies of control GFP expression plasmids (typically >70%, FIG. 19D , pmaxGFP).
  • control GFP expression plasmids typically >70%, FIG. 19D , pmaxGFP.
  • inefficient transgene expression after electroporation of SpCas9-T2A-GFP and sgRNA constructs into the DMD cells may explain the low observed gene editing efficiencies in unsorted cells.
  • a substantial increase was observed in detectable activity at most sgRNA target loci ( FIG. 19C ). Therefore, all subsequent experiments used cells sorted for SpCas9 expression by expression of this fluorescent reporter.
  • Small insertions and deletions created by NHEJ DNA repair may be used to create targeted frameshifts to correct aberrant reading frames.
  • a sgRNA, CR3 was designed to restore the dystrophin reading frame by introducing small insertions and deletions within exon 51 ( FIG. 16B and FIG. 20A ).
  • the types of insertions and deletions generated by CRISPR/Cas9 at this locus were assessed by Sanger sequencing of alleles from the genomic DNA of HEK293T cells co-transfected with expression plasmids for SpCas9 and the CR3 sgRNA ( FIG. 20B ). Notably, the insertions and deletions resulted in conversion to all three reading frames ( FIG. 20B , FIG. 20C ).
  • expression plasmids for SpCas9 and the CR3 sgRNA were electroporated into a DMD myoblast line with a deletion of exons 48-50 that is correctable by creating frameshifts in exon 51.
  • the treated cells were sorted, verified to have gene modification activity by the Surveyor assay (CR3, FIG. 19C sorted population), and differentiated into myotubes to test for restored dystrophin expression.
  • Expression of dystrophin protein was observed concomitant with the detectable nuclease activity ( FIG. 20D ).
  • the S. pyogenes CRISPR/Cas9 system presents a powerful method to quickly generate targeted frameshifts to address a variety of patient mutations and restore expression of the human dystrophin gene.
  • the multiplexing capability of the CRISPR/Cas9 system presents a novel method to efficiently generate genomic deletions of specific exons for targeted gene correction.
  • DMD patient myoblasts with background deletions correctable by exon 51 skipping were treated with two combinations of sgRNAs flanking exon 51 (CR1/CR5 or CR2/CR5) and sorted to enrich for gene-edited cells as in FIGS. 19A-19D .
  • the expected genomic deletions were only present when both sgRNAs were electroporated into the cells with SpCas9 ( FIG. 21A ).
  • Sanger sequencing confirmed the expected junction of the distal chromosomal segments ( FIG. 21B ) for both deletions.
  • this deletion was detected by PCR of the genomic DNA from SpCas9/sgRNA-treated DMD patient cells harboring a background deletion of exons 48-50 of unknown length ( FIG. 22A ).
  • Sanger sequencing of this deletion band from the genomic DNA of treated DMD cells revealed the expected junctions of intron 44 and intron 55 immediately adjacent to the sgRNA target sites ( FIG. 22B ).
  • the expected deletion of exons 45-55 was detected in the dystrophin mRNA transcript and verified to be a fusion of exons 44 and 56 by Sanger sequencing ( FIG. 22C ).
  • a promising method for DMD therapy is to correct a population of autologous patient muscle progenitor cells that can be engrafted into the patient's skeletal muscle tissue to rescue dystrophin expression.
  • muscle fibers positive for human spectrin which is expressed by both corrected and uncorrected cells, were detected in cryosections of injected muscle tissue ( FIG. 24 ).
  • FIG. 24 , FIGS. 25A-25F A number of these fibers were also positive for human dystrophin with expression localized to the sarcolemma, demonstrating functional gene correction in these cells.
  • FIG. 24 , FIGS. 25A-25F No fibers positive for human dystrophin were observed in sections from mice injected with the untreated DMD myoblasts ( FIG. 24 , FIGS. 25A-25F ), indicating that the CRISPR/Cas9-modified cells were the source of human dystrophin expression.
  • the relative cytotoxicity of the CRISPR/Cas9 system was assessed in human cells for select sgRNAs by adapting a flow cytometry-based GFP retention assay as previously described (Ousterout et al., Mol Ther 21:1718-1726 (2013)). Minimal cytotoxicity was observed for SpCas9 co-expressed with or without sgRNAs after transfection into human cells ( FIG. 26A ).
  • CR1, CR3 and CR36 each had one of these ten predicted off-target loci demonstrate significant levels of gene modification (Table 4 and FIG. 27 ).
  • the CR3 off-target sequence had substantial homology and similar modification frequencies to the intended on-target (9.3% at OT-1 vs. 13.3% at intended site (Table 4 and FIG. 27 ).
  • CR3-OT1 was the only one of these three off-target sites to show significant levels of activity in the sorted hDMD cells by the Surveyor assay ( FIG. 26B ).
  • Nuclease activity at off-target sites may cause unintended chromosomal rearrangements by distal re-ligation between cleaved target and off-target loci on distinct chromosomes. This presents a significant concern for deletion-based gene correction strategies due to the increased potential for off-target activity by using two or more nucleases, such as in multiplex CRISPR/Cas9 gene editing. Potential translocations were probed for using a highly sensitive nested genomic PCR assay to detect translocations at the validated off-target loci (Table 4) during both single and multiplex CRISPR/Cas9 editing strategies.
  • translocations were readily detected between on-target and off-target sites in the model HEK293T cell line that also shows high levels of off-target activity ( FIG. 26C and FIG. 28A, 28B ).
  • Sanger sequencing of the PCR amplicons confirmed the identity of the predicted translocation event for each primer pair ( FIGS. 29-30 ).
  • a subset of the translocations detected in the HEK293T cells were also detectable by nested PCR in the sorted hDMD myoblasts, although the signal was considerably weaker and the sequence identity was not confirmed due to low yield of product ( FIG. 26D , FIG. 28A , and FIG. 28C ).
  • Genome editing is a powerful tool for correcting genetic disease and the recent development of the CRISPR/Cas9 system is dramatically accelerating progress in this area.
  • the correction of DMD the most common genetic disease that also currently has no approved therapeutic options, was demonstrated.
  • Many gene- and cell-based therapies for DMD are in preclinical development and clinical trials, and genome editing methods are compatible with many of these approaches.
  • genome editing may be combined with patient-specific cell-based therapies for DMD.
  • the CRISPR/Cas9 system may function in human pluripotent stem cells and other human cell lines, as well as human skeletal myoblasts, as shown.
  • CRISPR/Cas9 gene editing did not have significant toxic effects in human myoblasts as observed by stable gene editing frequencies and minimal cytotoxicity of several sgRNAs. However, gene editing activity was confirmed at three out of 50 predicted off-target sites across five sgRNAs and CRISPR/Cas9-induced chromosomal translocations between on-target and off-target sites were detectable.
  • the CRISPR/Cas9 technology is an efficient and versatile method for correcting a significant fraction of dystrophin mutations and can serve as a general platform for treating genetic disease.
  • sgRNA and Cas9 mRNA in contrast to the plasmid-based delivery method used here, may be used to increase specificity and safety by reducing the duration of Cas9 expression and eliminating the possibility of random plasmid integration.
  • delivery of the CRISPR/Cas9 system directly to skeletal and/or cardiac muscle by viral, plasmid, or RNA delivery vectors may be used for in vivo genome editing and translation of this approach.
  • the large size of S. pyogenes Cas9 gene ( ⁇ 4.2 kilobases) presents a challenge to its use in size-restricted adeno-associated viral vectors.
  • Cas9 genes from other species, such as N. meningitidis and S. thermophilus are short enough to efficiently package both Cas9 and sgRNA expression cassettes into single AAV vectors for in vivo gene editing applications.
  • the CRISPR/Cas9 system enabled efficient modification of nearly 90% of tested targets, consistent with other reports of robust activity of this system at diverse loci.
  • the robustness and versatility of this technology is a significant advancement towards at-will creation of patient-specific gene editing.
  • Low levels of dystrophin, including as little as 4% of wild-type expression, may be sufficient to improve survival, motor function, and cardiac function in a mouse model.
  • the levels of CRISPR/Cas9 activity may be sufficient for therapeutic benefit.
  • sgRNAs tested were not associated with significant cytotoxic effects in human cells.
  • Three potential off-target sites out of 50 total tested sites for the five sgRNAs used were identified to restore dystrophin expression.
  • chromosomal translocations between the intended on-target sites and these off-target sites were detectable by highly sensitive nested PCR assays in HEK293T cells expressing high levels of Cas9 and sgRNAs.
  • the off-target activity and translocations identified in HEK293T cells which is an immortalized and aneuploid cell line that expresses very high levels of Cas9 and sgRNA, did not occur at as high a level and in some cases were undetectable in the hDMD myoblasts.
  • this level of specificity may be tolerable given the severity of DMD, the lack of an apparent cytotoxic effect in human cells
  • An engineered AAV capsid termed SASTG ( FIG. 34 ; SEQ ID NOs: 436 and 437), was developed for enhanced cardiac and skeletal muscle tissue tropism (Piacentino et al. (2012) Human Gene Therapy 23:635-646).
  • a ZFN targeting the Rosa26 locus (“Rosa26 ZFN”; FIG. 33 ; SEQ ID NO: 434 and 435) was shown to be highly active in mouse cells (Perez-Pinera et al. Nucleic Acids Research (2012) 40:3741-3752).
  • AAV-SASTG vectors encoding the Rosa26 ZFN protein were designed and subsequently generated and purified by the UNC Viral Vector Core.
  • the Surveyor assay (Guschin et al., Methods Mol Biol 649, 247-256 (2010)) was used to demonstrate NHEJ mutagenesis at the Rosa26 locus following delivery of AAV-SASTG Rosa26 ZFNs in cultured C2C12 myoblasts that were actively cycling or forced into differentiation by serum removal (not shown).
  • AAV-SASTG vectors encoding the Rosa26 ZFN were injected directly into the tibialis anterior (TA) muscle of 6 week old C57BL6/J mice at titers of 1e10 vector genomes (vg) or 2.5e10 vg per muscle. Mice were sacrificed 4 weeks after injection and the TA muscles were harvested and partitioned into several fragments for genomic DNA extraction and analysis ( FIG. 31 ). Genomic DNA was PCR amplified and subjected to the Surveyor assay to detect NHEJ mutations characteristic of ZFN mutagenesis at the Rosa26 target site ( FIGS. 32A-32C ). FIGS.
  • 32A-32C shows Surveyor analysis of Rosa26 ZFN activities in skeletal muscle in vitro and in vivo following delivery of AAV-SASTG-ROSA.
  • Proliferating C2C12s were transduced with the indicated amount of virus and harvested at 4 days post-infection ( FIG. 32A ).
  • C2C12s were incubated in differentiation medium for 5 days and then transduced with the indicated amount of AAV-SASTG-ROSA virus in 24 well plates ( FIG. 32B ). Samples were collected at 10 days post-transduction.
  • the indicated amount of AAV-SASTG-ROSA was injected directly into the tibialis anterior of C57BL/6J mice and muscles were harvested 4 weeks post-infection.
  • the harvested TA muscles were partitioned into 8 separate pieces for genomic DNA analysis, each shown in a separate lane ( FIG. 32C ).
  • high levels of gene modification were detected in all fragments at the highest dose (2.5e10 vg).
  • AAV constructs are designed to therapeutically correct mutations of the dystrophin gene that cause Duchenne muscular dystrophy and skeletal and cardiac muscle degeneration.
  • CRISPR/Cas9 systems can be delivered using the AAV to restore the dystrophin reading frame by deleting exon 51, deleting exons 45-55, disrupting splice donor or acceptor sites, or creating frameshifts within exon 51 (Ousterout et al., Molecular Therapy 2013) to restore the dystrophin reading frame and protein expression.
  • the CRISPR/Cas9 system will include a Cas9 having a sequence of SEQ ID NO: 64 or 114 (See FIGS. 40 and 41 ). gRNAs that could be combined with these Cas9s, targeting their respective PAM sequences, are provided (see FIGS. 40 and 41 ; see also Tables 2 and 3).
  • iNs induced neurons
  • BAM factors BAM factors, FIG. 48
  • Other methods may include additional factors to induce various neuronal subtypes.
  • These experiments require transcription factors to be delivered ectopically, and the activation of the corresponding endogenous loci to sustain the neuronal phenotype.
  • the CRISPR/Cas9 system was engineered as a versatile transcription factor to activate endogenous genes in mammalian cells with the capacity to target any promoter in the genome through an RNA-guided mechanism ( FIGS. 49A-49B ).
  • the CRISPR/Cas9-transcription factor was used to activate the endogenous genes encoding ASCL1 and BRN2 to directly reprogram MEFs to functional induced neurons.
  • MEFs were seeded in either 24-well TCPS plates or on poly-D-lysine/laminin-coated coverslips. Following transduction of dCas9-VP64 and transfection of the gRNAs (see Tables 10 and 11 for sequences of gRNAs), the cells were cultured in MEF medium (Adler et al. Mol Ther Nucleic Acids 1:e32 (2012)) for 24 hrs and then transferred to N3 neural induction medium (Vierbuchen et al. Nature 463:1035-1041 (2010)) for the duration of the experiment ( FIG. 49B ).
  • gRNAs for mouse ASCL1 SEQ 5′ ID Oligo (5′ to 3′) overhang ASCL1
  • gRNAs for mouse BRN2 SEQ 5′ ID Oligo (5′ to 3′) overhang BRN2 Target Sequence NO CR16-1_S: cacc G CGAGAGCGAGAGGAGGGAG (SEQ ID NO: 516) 540 CR16-1_AS: AAAC CTCCCTCCTCTCGCTCTCG (SEQ ID NO: 517) C 541 CR16-2_S: cacc G GAGAGAGCTTGAGAGCGCG (SEQ ID NO: 518) 542 CR16-2_AS: AAAC CGCGCTCTCAAGCTCTCTC (SEQ ID NO: 519) C 543 CR16-3_S: cacc G GGTGGAGGGGGCGGGGCCC (SEQ ID NO: 520) 544 CR16-3_AS: AAAC GGGCCCCGCCCCCTCCACC (SEQ ID NO: 521) C 545 CR16-4_S: cacc G GGTATCCACGTAAATCAAA (SEQ ID NO: 522) 546
  • qRT-PCR & IF Activation of endogenous ASCL1 was assessed by qRT-PCR and immunofluorescence in MEFs on day 3 following delivery of either dCas9-VP64 and gRNAs, ASCL1 cDNA, or a negative control vector encoding luciferase.
  • the generation of iNs was evaluated by TUJ1 and MAP2 co-staining and identification of cells with neuronal morphology and extended processes.
  • Live Cell Reporters After 7-8 days in N3 medium, MEFs cultured on poly-D-lysine/laminin-coated coverslips were transduced with viruses carrying hSyn-RFP and MAP2-GCamP5 reporters to identify the most mature iNs for functional characterization via calcium imaging and electrophysiology ( FIG. 49B ).
  • dCas9-VP64 and gRNAs targeted to the ASCL1 promoter activated the endogenous gene in MEFs.
  • Co-delivery of 8 gRNAs activated the endogenous gene 400-fold, a significant increase (p ⁇ 0.05) over the 100-fold activation induced by the co-delivery of 4 gRNAs ( FIG. 50A ).
  • Nuclear-localized Ascl1 protein was detected by immunofluorescence in MEFs.
  • Ectopic Ascl1 expression produced more Ascl1 protein than dCas9-VP64 with either gRNA cocktail, but did not activate the endogenous locus by day 3 ( FIGS. 50A-50B ).
  • FIGS. 52A-52B A cell expressing the MAP2-GCaMP5 calcium indicator exhibited KCl-induced depolarization detected with a fluorescent microscope.
  • dCas9-VP64 was able to penetrate heterochromatin and activated stably silenced endogenous genes, a characteristic of only a subset of “pioneer” transcription factors.
  • converting cell lineage with CRISPR/Cas9-transcription factors may better overcome epigenetic barriers to reprogramming than ectopic expression of transcription factors, particularly in hard-to-reprogram cell-types, such as adult human cells. This may have clinical importance in the field of regenerative medicine, as it is often desired to use autologous sources in cell replacement therapies.
  • Plasmid constructs The expression cassettes for the S. pyogenes sgRNA and human codon optimized Cas9 (hCas9) nuclease were used, as described above. Additional promoters for mU6 (Ohshima et al., Nucleic Acids Res 9:5145-5158 (1981)), H1 (Myslinski et al., Nucleic Acids Res 29:2502-2509 (2001)), and 7SK (Murphy et al., Cell 51:81-87 (1987)) pol-III promoters were synthesized using GeneBlocks (IDT) and cloned in place of the hU6 sgRNA expression cassette.
  • IDT GeneBlocks
  • a GeneBlock (IDT) was cloned onto the 3′ end of the Cas9 coding sequence to fuse a T2A skipping peptide and eGFP gene immediately after Cas9 to monitor vector expression.
  • the coding region for hCas9-T2A-GFP (SEQ ID NO: 145) was then transferred into a lentiviral expression vector containing the human ubiquitin C (hUbC) promoter to drive expression of hCas9-T2A-GFP, as well as restriction sites to facilitate Golden Gate cloning of sgRNA expression cassettes immediately upstream of the hUbC promoter ( FIG. 42A ).
  • Protocol for assembly of custom lentiviral vectors Assembly of custom lentiviral vectors expressing up to four sgRNAs of choice and active Cas9, dCas9, or dCas9-VP64 was accomplished in less than five days.
  • the cloning method used the Golden Gate cloning and type IIS restriction enzymes that cleave outside their recognition sequence to create unique overhangs.
  • Golden Gate assembly expedited cloning as all four expression cassettes were ligated into the final lentiviral vector in one step.
  • the lentiviral vector expressed active Cas9, cCas9, or dCas9-VP64 in addition to one, two, three, or four sgRNAs expressed from independent promoters.
  • Step 1 Single stranded oligos containing each 20 bp protospacer were annealed in such a fashion to create sticky ends and were ligated into the desired pZDonor-promoter vector. Order two single stranded oligos for each desired genomic target. To anneal the complimentary oligos, mix 8 ⁇ L sense oligo+8 ⁇ L antisense oligo (both at 10 mM)+2 ⁇ L 10 ⁇ ligase buffer. The oligos are melted and reannealed in a PCR machine with the program: 96° C. for 300 seconds, followed by 85° C. for 20 seconds, 75° C. for 20 seconds, 65° C. for 20 seconds, 55° C.
  • Step 2 Construct the four promoter-gRNA cassettes into a lentiviral destination vector using Golden Gate assembly.
  • step 1 there are four independent plasmids each expressing a different sgRNA from a different promoter.
  • To assemble the four different promoter-sgRNA constructs into the desired destination vector combine 200 ng of each sgRNA expression plasmid and desired lentiviral destination vector with 1 ⁇ L of T4 DNA ligase (NEB), 1 ⁇ L BsmBI FastDigest (Fisher Scientific), and 2 ⁇ L 10 ⁇ T4 ligase buffer (NEB) in a 20 ⁇ L reaction volume. Incubate the reaction as follows: 37° C. for 10 minutes, 16° C.
  • the final constructs may be unstable and thus we recommend maintaining these plasmids in the SURE 2 cell line and screening the final plasmid with a test PCR using the sense primer 5′-TCGGGTTTATTACAGGGACAGCAG-3′ (SEQ ID NO:464) and antisense primer 5′-TCTAAGGCCGAGTCTTATGAGCAG-3′ (SEQ ID NO:465). These primers amplify across the four promoter-gRNA region. Due to the repetitive nature, a distinct banding pattern should be observed with the largest product approximately 1800 bp in size.
  • HEK293T cells were obtained from the American Tissue Collection Center (ATCC, Manassas, Va.) through the Duke University Cancer Center Facilities and were maintained in DMEM supplemented with 10% FBS and 1% penicillin streptomycin.
  • Primary human dermal fibroblasts (Catalog ID: GM03348) were obtained from Coriell Institute (Camden, N.J.) and were maintained in DMEM supplemented with 10% FBS and 1% penicillin streptomycin. All cells were cultured at 37° C. with 5% CO 2 .
  • HEK293T cells were transfected with Lipofectamine 2000 (Life Technologies) with 200 ng of each sgRNA expression vector (800 ng total pDNA) according to the manufacturer's protocol in 24 well plates.
  • lentiviral production and transduction All lentiviral vectors used is this study are second generation and were produced using standard viral production methods. Briefly, 3.5 million HEK293 Ts were plated per 10 cm dish. The following day, cells were transfected by the calcium phosphate transfection method with 20 ⁇ g of transfer vector, 6 ⁇ g of pMD2G, and 10 ⁇ g psPAX2. The media was changed 12-14 hrs post transfection. The viral supernatant was collected 24 and 48 hrs after this media change, passed through a 0.45 micron filter and pooled. For transduction, the cell medium was replaced with viral supernatant supplemented with 4 ⁇ g/mL polybrene. The viral supernatant was exchanged for fresh medium 12-24 hrs later.
  • RNA was isolated using the RNeasy Plus RNA isolation kit (Qiagen). cDNA synthesis was performed using the SuperScript VILO cDNA Synthesis Kit (Invitrogen). Real-time PCR using PerfeCTa SYBR Green FastMix (Quanta Biosciences) was performed with the CFX96 Real-Time PCR Detection System (Bio-Rad). Primer specificity was confirmed by agarose gel electrophoresis and melting curve analysis. Reaction efficiencies over the appropriate dynamic range were calculated to ensure linearity of the standard curve. The results are expressed as fold-increase mRNA expression of the gene of interest normalized to ⁇ -Actin expression using the ⁇ Ct method. Reported values are the mean and S.E.M. from two independent experiments (n 2) where technical replicates were averaged for each experiment.
  • the membranes were incubated with primary antibodies: (anti-MyoD (1:250, Santa Cruz Sc-32758) in 5% BSA in TBST overnight at 4° C.; anti-Myogenin (1:250, Santa Cruz Sc-12732) in 5% BSA overnight at 4° C.; anti-FLAG-HRP (1:1000, Cell Signaling 2044) in 5% milk in TBST for 60 min at room temperature; anti-GAPDH (1:5000, Cell Signaling, clone 14C10) in 5% milk in TBST for 30 min at room temperature. Membranes were then washed three times with TBST for 15 minutes total.
  • Membranes were incubated with anti-rabbit HRP-conjugated antibody (Sigma, A 6154) or anti-mouse HRP-conjugated antibody (Santa Cruz, SC-2005) diluted 1:5,000 for 30 min and washed with TBST three times for 15 min each. Membranes were visualized using the ImmunStar WesternC Chemiluminescence Kit (Bio-Rad) and images were captured using a ChemiDoc XRS+ System and processed using ImageLab software (Bio-Rad).
  • CRISPR/Cas9 nuclease lesions at the endogenous target site were quantified using the Surveyor nuclease assay, which can detect mutations characteristic of nuclease-mediated NHEJ. After transfection or transduction, cells were incubated for 3-10 days at 37° C. and genomic DNA was extracted using the DNeasy Blood and Tissue kit (Qiagen). The target locus was amplified by 35 cycles of PCR with the AccuPrime High Fidelity PCR kit (Invitrogen). The resulting PCR products were randomly melted and reannealed in a PCR machine with the program: 95° C. for 240 seconds, followed by 85° C. for 60 seconds, 75° C.
  • PCR product was mixed with 1 ⁇ L of Surveyor Nuclease S and 1 ⁇ L of Enhancer S (Transgenomic, Omaha, Nebr.) and incubated at 42° C. for 1 hr. After incubation, 6 ⁇ L of digestion product was loaded onto a 10% TBE polyacrylamide gel and run at 200 V for 30 minutes. The gels were stained with ethidium bromide and quantified using ImageLab (Bio-Rad) by densitometry (Perez-Pinera et al., Nucleic Acids Res 40:3741-3751 (2012)).
  • a single lentiviral vector that efficiently expresses Cas9 and up to four sgRNAs.
  • this vector expresses four sgRNAs from four independent pol III promoters (human U6 promoter, mouse U6 promoter, 7SK, and H1).
  • sgRNA expression from each promoter using end-point RT-PCR to detect a sgRNA targeting the AAVS1 locus ( FIG.
  • each promoter construct expressing an sgRNA targeting AAVS1 independently with an active Cas9 expression construct into human HEK293T cells.
  • lentiviral delivery of different Cas9-based constructs including an active Cas9 nuclease, dead Cas9, and dead Cas9 fused to the VP64 transactivator domain, resulted in expression of full-length Cas9 protein in HEK293T cells as determined by western blot ( FIG. 42C ).
  • oligonucleotides encoding sgRNA protospacer sequences are cloned independently into different expression vectors, each with a distinct promoter driving sgRNA expression.
  • each sgRNA expression construct is subcloned into a lentiviral Cas9 expression vector of choice by Golden Gate assembly. This strategy allows for robust and rapid cloning of up to four sgRNAs into a single lentiviral vector for gene editing or activation applications.
  • a PolyT terminator sequence is cloned down-stream of unused promoters to prevent transcription from the unused promoters.
  • Each vector co-expresses the choice Cas9 with eGFP via a 2A skipping peptide to enable fluorescence-activated flow sorting and enrichment of cells with a high multiplicity of infection.
  • the entire region containing the sgRNA and Cas9 expression cassettes is flanked by loxP sites to mediate removal by Cre-lox excision.
  • each sgRNA To validate the independent activity of each sgRNA, we assembled a single lentiviral vector expressing active Cas9 and four sgRNAs, each targeting an independent loci ( FIG. 44A ). As control vectors, we assembled constructs expressing only one sgRNA along with polyT protospacers in the other three positions. We transduced HEK293 Ts and primary fibroblasts with lentiviral vectors expressing the indicated sgRNAs and monitored gene modification frequencies at 7 or 10 days post-transduction, respectively ( FIG. 44B ). In both cell types, the single lentiviral vector mediated highly efficient multiplex editing at all four loci ( FIG. 44B ).
  • HEK293 Ts were transduced with different Cas9-T2A-GFP and GFP expression was monitored using flow cytometry. Following normal passaging every 2-3 days, each cell line exhibited stable GFP expression for up to 35 days post transduction. Transduced HEK293 Ts were then transfected with one to four separate sgRNA expression constructs targeting either the IL1RN or HBG1 promoter. Transient transfection of these sgRNA constructs in stable dCas9-VP64 expressing cells lines resulted in tunable endogenous gene activation ( FIGS. 45A-45B ).
  • Lentiviral delivery may enable stable, long-term gene activation by CRISPR/Cas9 transactivation.
  • HEK293 Ts were transduced using a single lentiviral vector encoding dCas9-VP64 and one to four sgRNA expression cassettes. Similar to our transient transfection results ( FIGS. 45A-45D ), we were able to tunably and robustly activate expression of endogenous IL1RN and HBG1 genes ( FIGS. 46A-46B ).
  • the HS2 enhancer is a well-characterized distal regulatory element necessary for activation of the globin gene locus.
  • dCas9-KRAB with gRNAs targeted to the HS2 enhancer were delivered to determine if this system would repress ⁇ -, ⁇ -, and ⁇ -globin expression in the K562 human erythroid leukemia cell line ( FIG. 54 ).
  • a panel of gRNAs was created targeting different sites along the core region of the HS2 enhancer SEQ ID NO: 467). See Table 12.
  • dCas9 and dCas9-KRAB effectors were delivered lentivirally 5-8 days prior to electroporation with 5 ⁇ g of a plasmid encoding the U6-sgRNA expression ( FIG. 55A ).
  • Cells that were not electroporated with gRNA (no gRNA) and cells treated with a gRNA targeting a different locus (IL1RN) were included as controls.
  • Multiple gRNAs effected potent repression of ⁇ -, ⁇ -, and ⁇ -globin genes when assayed 3 days post-transfection, with up to 80% knockdown achieved ( FIGS.
  • dCas9/dCas9-KRAB Stable silencing of globin genes by dCas9-KRAB.
  • dCas9/dCas9-KRAB were co-expressed with single gRNAs lentivirally in K562s ( FIG. 57A ).
  • Cells that were not treated with lentivirus (NT), treated with dCas9/dCas9-KRAB without a gRNA (no gRNA), and with dCas9/dCas9-KRAB and gRNA targeting a different locus (IL1RN) were included as controls.
  • Cells treated with lentivirus were selected from days 4 to 7.
  • FIGS. 57B, 57C, 57D Multiple gRNAs effected potent transcriptional repression of ⁇ -, ⁇ -, and ⁇ -globin genes when assayed 7 days after transduction, with up to 95% knockdown achieved.
  • Expression of ⁇ -globin was silenced the most in response gRNAs targeted to the HS2 enhancer.
  • Treatment with dCas9-KRAB with a gRNA resulted in dramatically more repression than treatment with dCas9 and gRNA.
  • a dCas9-p300 fusion protein was designed and compared to dCas9-VP64 fusion protein (see FIG. 59 ).
  • the amino acid constructs of dCas9 constructions are shown in FIGS. 61A-61C .
  • Cells from the Human Embryonic Kidney tissue culture line HEK293T (ATCC; CRL-11268) were seeded at a density of 1.5e5 cells per well in 24-well tissue culture dishes one day prior to transfection with Lipofectamine 2000 transfection reagent (Life Technologies).
  • the 3 days post-transfection cells were harvested and assayed by RT-QPCR for mRNA expression.
  • the RT-QPCR primer sequences are listed in Table 14.
  • RT-QPCR was normalized to GAPDH expression using the ⁇ C t method. Results are expressed as fold-increase expression of the gene of interest relative to cells treated with Lipofectamine only without DNA transfected (“No DNA”) (See FIGS. 60A-60C ).
  • FIG. 62 shows that mutating residues in the p300 HAT domain causes a loss of its ability to activate gene expression.
  • FIGS. 63A-63B shows that multiple gRNAs work synergistically with dCas-9-p300, as showed with dCas-9-VP64.
  • FIGS. 64A-64C shows TALEN mediated integration of minidystrophin at the 5′UTR of the Dp427m skeletal muscle isoform of dystrophin in skeletal myoblast cell lines derived from human DMD patients carrying different deletions in the dystrophin gene.
  • DMD patient cells were electroporated with constructs encoding a TALEN pair active at the 5′UTR locus and a donor template carrying the minidystrophin gene.
  • FIG. 64A shows a schematic of how minidystrophin was integrated into the 5′UTR.
  • FIG. 64B shows that hygromycin-resistant clonal cell lines were isolated and screened by PCR for successful site-specific integrations at the 5′UTR using the primers shown in FIG.
  • FIG. 64A shows that clonally isolated DMD myoblasts with detected integration events were differentiated for 6 days and assessed for expression of an HA tag fused to the C terminus of minidystrophin.
  • hCas9-T2A-GFP DNA sequence SEQ ID NO: 145 (SpCas9 human optimized sequence, , T2A peptide, eGFP sequence) gccaccATGGACAAGAAGTACTCCATTGGGCTCGATATCGGCACAAACAGCGTCGGCTGGGCCGTCATTACGGACGAGTA CAAGGTGCCGAGCAAAAAATTCAAAGTTCTGGGCAATACCGATCGCCACAGCATAAAGAAGAACCTCATTGGCGCCCTCC TGTTCGACTCCGGGGAGACGGCCGAAGCCACGCGGCTCAAAAGAACAGCACGGCGCAGATATACCCGCAGAAAGAATCGG ATCTGCTACCTGCAGGAGATCTTTAGTAATGAGATGGCTAAGGTGGATGACTCTTTCTTCCATAGGCTGGAGGAGTCCTT TTTGGTGGAGGAGGATAAAAAGCGAGCGCCACCCAATCTTTGGCAATATCGTGGACGAGGTGGCGTACCATGAAAAGT ACCATGAAAAGCTGG

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Virology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Developmental Biology & Embryology (AREA)
  • Transplantation (AREA)
  • Rheumatology (AREA)

Abstract

Disclosed herein are Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/CRISPR-associated (Cas) 9-based system related compositions and methods of using said CRISPR/Cas9-based system related compositions for altering gene expression and genome engineering. Also disclosed herein are compositions and methods of using said compositions for altering gene expression and genome engineering in muscle, such as skeletal muscle and cardiac muscle.

Description

    CROSS REFERENCE TO RELATED APPLICATIONS
  • This application is a continuation of U.S. patent application Ser. No. 14/895,316, filed Dec. 2, 2015, which is the national stage filing under 35 U.S.C. 371 of International Patent Application No. PCT/US2014/041190, filed Jun. 5, 2014, which claims the benefit of priority to U.S. Provisional Application No. 61/831,481, filed Jun. 5, 2013, U.S. Provisional Application No. 61/839,127, filed Jun. 25, 2013, U.S. Provisional Application No. 61/904,911, filed Nov. 15, 2013, U.S. Provisional Application No. 61/967,466, filed Mar. 19, 2014, and U.S. Provisional Application No. 61/981,575, filed Apr. 18, 2014, the entire contents of each of which are hereby incorporated by reference.
  • STATEMENT OF GOVERNMENT INTEREST
  • This invention was made with government support under federal grant numbers DP2-OD008586 and R01DA036865 awarded by NIH and CBET-1151035 awarded by the National Science Foundation. The U.S. Government has certain rights to this invention.
  • SEQUENCE LISTING
  • The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Feb. 27, 2018, is named 028193-9164-US03_Subt_Seq_List.txt and is 331,614 bytes in size.
  • TECHNICAL FIELD
  • The present disclosure relates to the field of gene expression alteration, genome engineering and genomic alteration of genes using Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/CRISPR-associated (Cas) 9-based systems and viral delivery systems. The present disclosure also relates to the field of genome engineering and genomic alteration of genes in muscle, such as skeletal muscle and cardiac muscle.
  • BACKGROUND
  • Synthetic transcription factors have been engineered to control gene expression for many different medical and scientific applications in mammalian systems, including stimulating tissue regeneration, drug screening, compensating for genetic defects, activating silenced tumor suppressors, controlling stem cell differentiation, performing genetic screens, and creating synthetic gene circuits. These transcription factors can target promoters or enhancers of endogenous genes, or be purposefully designed to recognize sequences orthogonal to mammalian genomes for transgene regulation. The most common strategies for engineering novel transcription factors targeted to user-defined sequences have been based on the programmable DNA-binding domains of zinc finger proteins and transcription-activator like effectors (TALEs). Both of these approaches involve applying the principles of protein-DNA interactions of these domains to engineer new proteins with unique DNA-binding specificity. Although these methods have been widely successful for many applications, the protein engineering necessary for manipulating protein-DNA interactions can be laborious and require specialized expertise.
  • Additionally, these new proteins are not always effective. The reasons for this are not yet known but may be related to the effects of epigenetic modifications and chromatin state on protein binding to the genomic target site. In addition, there are challenges in ensuring that these new proteins, as well as other components, are delivered to each cell. Existing methods for delivering these new proteins and their multiple components include delivery to cells on separate plasmids or vectors which leads to highly variable expression levels in each cell due to differences in copy number. Additionally, gene activation following transfection is transient due to dilution of plasmid DNA, and temporary gene expression may not be sufficient for inducing therapeutic effects. Furthermore, this approach is not amenable to cell types that are not easily transfected. Thus another limitation of these new proteins is the potency of transcriptional activation.
  • Site-specific nucleases can be used to introduce site-specific double strand breaks at targeted genomic loci. This DNA cleavage stimulates the natural DNA-repair machinery, leading to one of two possible repair pathways. In the absence of a donor template, the break will be repaired by non-homologous end joining (NHEJ), an error-prone repair pathway that leads to small insertions or deletions of DNA. This method can be used to intentionally disrupt, delete, or alter the reading frame of targeted gene sequences. However, if a donor template is provided along with the nucleases, then the cellular machinery will repair the break by homologous recombination, which is enhanced several orders of magnitude in the presence of DNA cleavage. This method can be used to introduce specific changes in the DNA sequence at target sites. Engineered nucleases have been used for gene editing in a variety of human stem cells and cell lines, and for gene editing in the mouse liver. However, the major hurdle for implementation of these technologies is delivery to particular tissues in vivo in a way that is effective, efficient, and facilitates successful genome modification.
  • Hereditary genetic diseases have devastating effects on children in the United States. These diseases currently have no cure and can only be managed by attempts to alleviate the symptoms. For decades, the field of gene therapy has promised a cure to these diseases. However technical hurdles regarding the safe and efficient delivery of therapeutic genes to cells and patients have limited this approach. Duchenne Muscular Dystrophy (DMD) is the most common hereditary monogenic disease and occurs in 1 in 3500 males. DMD is the result of inherited or spontaneous mutations in the dystrophin gene. Dystrophin is a key component of a protein complex that is responsible for regulating muscle cell integrity and function. DMD patients typically lose the ability to physically support themselves during childhood, become progressively weaker during the teenage years, and die in their twenties. Current experimental gene therapy strategies for DMD require repeated administration of transient gene delivery vehicles or rely on permanent integration of foreign genetic material into the genomic DNA. Both of these methods have serious safety concerns. Furthermore, these strategies have been limited by an inability to deliver the large and complex dystrophin gene sequence.
  • SUMMARY
  • The present invention is directed to a fusion protein comprising two heterologous polypeptide domains. The first polypeptide domain comprises a Clustered Regularly Interspaced Short Palindromic Repeats associated (Cas) protein and the second polypeptide domain has an activity selected from the group consisting of transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, and demethylase activity. The Cas protein may comprise Cas9. The Cas9 may comprise at least one amino acid mutation which knocks out nuclease activity of Cas9. The at least one amino acid mutation may be at least one of D10A and H840A. The Cas protein may comprise iCas9 (amino acids 36-1403 of SEQ ID NO: 1). The second polypeptide domain may have transcription activation activity. The second polypeptide domain may comprise at least one VP16 transcription activation domain repeat. The second polypeptide domain may comprise a VP16 tetramer (“VP64”) or a p65 activation domain. The fusion protein may further comprise a linker connecting the first polypeptide domain to the second polypeptide domain. The fusion protein may comprise iCas9-VP64.
  • The present invention is directed to a DNA targeting system comprising said fusion protein and at least one guide RNA (gRNA). The at least one gRNA may comprise a 12-22 base pair complementary polynucleotide sequence of the target DNA sequence followed by a protospacer-adjacent motif. The at least one gRNA may target a promoter region of a gene, an enhancer region of a gene, or a transcribed region of a gene. The at least one gRNA may target an intron of a gene. The at least one gRNA may target an exon of a gene. The at least one gRNA may target a the promoter region of a gene selected from the group consisting of ASCL1, BRN2, MYTIL, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, and MYOD1. The at least one gRNA may comprise at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • The present invention is directed to a DNA targeting system that binds to a dystrophin gene comprising Cas9 and at least one guide RNA (gRNA). The at least one gRNA may target an intron of the dystrophin gene. The at least one gRNA may target an exon of the dystrophin gene. The at least one guide RNA may comprise at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625. The DNA targeting system may comprise between one and ten different gRNAs.
  • The present invention is directed to an isolated polynucleotide encoding said fusion protein or said DNA targeting system.
  • The present invention is directed to a vector comprising said isolated polynucleotide.
  • The present invention is directed to a cell comprising said isolated polynucleotide or said vector.
  • The present invention is directed to a method of modulating mammalian gene expression in a cell. The method comprises contacting the cell with said fusion protein, said DNA targeting system, said isolated polynucleotide, or said vector. The gene expression may be induced.
  • The present invention is directed to a method of transdifferentiating or inducing differentiation of a cell. The method comprises contacting the cell with said fusion protein, said DNA targeting system, said isolated polynucleotide, or said vector. The cell may be a fibroblast cell or an induced pluripotent stem cells. The fibroblast cell may be trandifferentiated into a neuronal cell or a myogenic cell. The DNA targeting system may be contacted with the cell and at least one gRNA targets a promoter region of at least one gene selected from the group consisting of ASCL1, BRN2, MYOD1, and MYT1L. The DNA targeting system may comprise at least one gRNA that targets the promoter region of the ASCL1 gene and at least one gRNA that targets the promoter region of the BRN2 gene. The DNA targeting system may comprise between one and twenty different gRNAs. The DNA targeting system may comprise 8 or 16 different gRNAs. The DNA targeting system may comprise dCas9-VP64. The DNA targeting system may be delivered to the cell virally or non-virally.
  • The present invention is directed to a method of correcting a mutant gene in a cell. The method comprises administering to a cell containing said DNA targeting system, said isolated polynucleotide, or said vector. The correction of the mutant gene may comprise homology-directed repair. The method may further comprise administering to the cell a donor DNA. The mutant gene may comprise a frameshift mutation which causes a premature stop codon and a truncated gene product. The correction of the mutant gene may comprise nuclease mediated non-homologous end joining. The correction of the mutant gene may comprise a deletion of a premature stop codon, a disruption of a splice acceptor site, a deletion of one or more exons, or disruption of a splice donor sequence. The deletion of one or more exons may result in the correction of the reading frame.
  • The present invention is directed to a method of treating a subject in need thereof having a mutant dystrophin gene. The method comprises administering to the subject said DNA targeting system, said isolated polynucleotide, or said vector. The subject may be suffering from Duchenne muscular dystrophy.
  • The present invention is directed to a method of correcting a mutant dystrophin gene in a cell. The method comprises administering to a cell containing a mutant dystrophin gene said DNA targeting system, said isolated polynucleotide, said vector, or said cell. The mutant dystrophin gene may comprise a premature stop codon, disrupted reading frame via gene deletion, an aberrant splice acceptor site, or an aberrant splice donor site, and wherein the target region is upstream or downstream of the premature stop codon, disrupted reading frame, aberrant splice acceptor site, or the aberrant splice donor site. The correction of the mutant dystrophin gene may comprise homology-directed repair. The method may further comprise administering to the cell a donor DNA. The mutant dystrophin gene may comprise a frameshift mutation which causes a premature stop codon and a truncated gene product. The correction of the mutant dystrophin gene may comprise nuclease mediated non-homologous end joining. The correction of the mutant dystrophin gene may comprise a deletion of a premature stop codon, correction of a disrupted reading frame, or modulation of splicing by disruption of a splice acceptor site or disruption of a splice donor sequence. The correction of the mutant dystrophin gene may comprise a deletion of exons 45-55 or exon 51.
  • The present invention is directed to a kit comprising said fusion protein, said DNA targeting system, said isolated polynucleotide, said vector, or said cell.
  • The present invention is directed to a method of modulating mammalian gene expression in a cell. The method comprises contacting the cell with a polynucleotide encoding a DNA targeting system. The DNA targeting system comprises said fusion protein and at least one guide RNA (gRNA). The DNA targeting system may comprise between one and ten different gRNAs. The different gRNAs may bind to different target regions within the target gene. The target regions may be separated by at least one nucleotide. The target regions may be separated by about 15 to about 700 base pairs. Each of the different gRNAs may bind to at least one different target genes. The different target genes may be located on same chromosome. The different target genes may be located on different chromosomes. The at least one target region may be within a non-open chromatin region, an open chromatin region, a promoter region of the target gene, an enhancer region of the target gene, a transcribed region of the target gene, or a region upstream of a transcription start site of the target gene. The at least one target region may be located between about 1 to about 1000 base pairs upstream of a transcription start site of a target gene. The at least one target region may be located between about 1 to about 600 base pairs upstream of a transcription start site of a target gene. The gene expression may be induced. The DNA targeting system may comprise two different gRNAs, three different gRNAs, four different gRNAs, five different gRNAs, six different gRNAs, seven different gRNAs, eight different gRNAs, nine different gRNAs, or ten different gRNAs. The at least one guide RNA may target a promoter region of a gene selected from the group consisting of ASCL1, BRN2, MYT1L, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, and MYOD1. The at least one guide RNA may comprise at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625. The at least one target region may be within an intron or an exon of a target gene.
  • The present invention is directed to a composition for inducing mammalian gene expression in a cell. The composition comprises said fusion protein and at least one guide RNA (gRNA).
  • The present invention is directed to a composition for inducing mammalian gene expression in a cell. The composition comprises an isolated polynucleotide sequence encoding said fusion protein and at least one guide RNA (gRNA). The at least one guide RNA may target a promoter region of a gene selected from the group consisting of ASCL1, BRN2, MYT1L, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, and MYOD1. The at least one guide RNA may comprise at least one of SEQ ID NOs 5-40, 65-144, 492-515, 540-563, and 585-625.
  • The present invention is directed to a cell comprising said composition for inducing mammalian gene expression in a cell.
  • The present invention is directed to a kit comprising said composition for inducing mammalian gene expression in a cell or said cell comprising said composition for inducing mammalian gene expression in a cell.
  • The present invention is directed to a kit for inducing mammalian gene expression in a cell. The kit comprises said composition for inducing mammalian gene expression in a cell or said cell comprising said composition for inducing mammalian gene expression in a cell.
  • The present invention is directed to a composition for genome editing in a muscle of a subject. The composition comprises a modified adeno-associated virus (AAV) vector and a nucleotide sequence encoding a site-specific nuclease. The muscle is skeletal muscle or cardiac muscle. The modified AAV vector may have enhanced cardiac and skeletal muscle tissue tropism. The site-specific nuclease may comprise a zinc finger nuclease, a TAL effector nuclease, or a CRISPR/Cas9 system. The site-specific nuclease may bind a gene or locus in the cell of the muscle. The gene or locus may be dystrophin gene. The composition may further comprise a donor DNA or transgene.
  • The present invention is directed to a kit comprising said composition for genome editing in a muscle of a subject.
  • The present invention is directed to a method of genome editing in a muscle of a subject. The method comprises administering to the muscle said composition for genome editing in a muscle of a subject, wherein the muscle is skeletal muscle or cardiac muscle. The genome editing may comprise correcting a mutant gene or inserting a transgene. Correcting a mutant gene may comprise deleting, rearranging, or replacing the mutant gene. Correcting the mutant gene may comprise nuclease-mediated non-homologous end joining or homology-directed repair.
  • The present invention is directed to a method of treating a subject. The method comprises administering said composition for genome editing in a muscle of a subject to a muscle of the subject, wherein the muscle is skeletal muscle or cardiac muscle. The subject may be suffering from a skeletal muscle condition or a genetic disease. The subject may be suffering from Duchenne muscular dystrophy.
  • The present invention is directed to a method of correcting a mutant gene in a subject, the method comprises administering said composition for genome editing in a muscle of a subject. The muscle is skeletal muscle or cardiac muscle. The composition may be injected into the skeletal muscle of the subject. The composition may be injected systemically to the subject. The skeletal muscle may be tibialis anterior muscle.
  • The present invention is directed to a modified lentiviral vector for genome editing in a subject comprising a first polynucleotide sequence encoding said fusion protein and a second polynucleotide sequence encoding at least one sgRNA. The first polynucleotide sequence may be operably linked to a first promoter. The first promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter. The second polynucleotide sequence may encode between one and ten different sgRNAs. The second polynucleotide sequence may encode two different sgRNAs, three different sgRNAs, four different sgRNAs, five different sgRNAs, six different sgRNAs, seven different sgRNAs, eight different sgRNAs, nine different sgRNAs, or ten different sgRNAs. Each of the polynucleotide sequences encoding the different sgRNAs may be operably linked to a promoter. Each of the promoters operably linked to the different sgRNAs may be the same promoter. Each of the promoters operably linked to the different sgRNAs may be different promoters. The promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter. The sgRNA may bind to a target gene. Each of the sgRNA may bind to a different target region within one target loci. Each of the sgRNA may bind to a different target region within different gene loci. The fusion protein may comprise Cas9 protein or iCas9-VP64 protein. The fusion protein may comprise a VP64 domain, a p300 domain, or a KRAB domain. The two or more endogenous genes may be transcriptionally activated. The two or more endogenous genes may be repressed.
  • The present invention is directed to a method of activating an endogenous gene in a cell. The method comprises contacting a cell with said modified lentiviral vector. The endogenous gene may be transiently activated. The endogenous gene may be stably activated. The endogenous gene may be transiently repressed. The endogenous gene may be stably repressed. The fusion protein may be expressed at similar levels to the sgRNAs. The fusion protein may be expressed at different levels to the sgRNAs. The cell may be a primary human cell.
  • The present invention is directed to a method of multiplex gene editing in a cell. The method comprises contacting a cell with said modified lentiviral vector. The multiplex gene editing may comprise correcting at least one mutant gene or inserting a transgene. Correcting a mutant gene may comprise deleting, rearranging, or replacing the at least one mutant gene. Correcting the at least one mutant gene may comprise nuclease-mediated non-homologous end joining or homology-directed repair. The multiplex gene editing may comprise deleting at least one gene, wherein the gene is an endogenous normal gene or a mutant gene. The multiplex gene editing may comprise deleting at least two genes. The multiplex gene editing may comprise deleting between two and ten genes.
  • The present invention is directed to a method of modulating gene expression of at least one target gene in a cell. The method comprises contacting a cell with said modified lentiviral vector. The gene expression of at least two genes may be modulated. The gene expression of between two genes and ten genes may be modulated. The gene expression of the at least one target gene may be modulated when gene expression levels of the at least one target gene are increased or decreased compared to normal gene expression levels for the at least one target gene.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIGS. 1A-1F show RNA-guided activation of the human IL1RN gene by iCas9-VP64. (FIG. 1A, FIG. 1B) An RNA-guided transcriptional activator was created by fusing the inactivated Cas9 (iCas9, D10A/H840A) to the VP64 transactivation domain. iCas9-VP64 recognizes genomic target sites through the hybridization of a guide RNA (gRNA) to a 20 bp target sequence. (FIG. 1C) Expression plasmids for four gRNAs or crRNA/tracrRNAs targeted to sequences in the IL1RN promoter were co-transfected with the iCas9-VP64 expression plasmid into HEK293T cells. Activation of IL1RN expression was assessed by qRT-PCR. (FIG. 1D) The four gRNA expression plasmids were co-transfected with iCas9-VP64 individually or in combination. Robust gene activation was observed by qRT-PCR only in response to the combination of gRNAs. (FIG. 1E) Activation of IL1RN expression was confirmed by assessing secretion of the IL-1ra gene product into the media by ELISA. IL-1ra was only detected in three of the six samples treated with the combination of gRNAs. For FIGS. 1C-1E, data are shown as the mean±s.e.m. (n=3 independent experiments). Treatment with the combination of gRNAs was statistically different than all other treatments (*P≤0.02) by Tukey's test. (FIG. 1F) RNA-seq was performed on samples treated with empty expression vector (n=2) or co-transfected with the expression plasmids for iCas9-VP64 and the four gRNAs targeting IL1RN (n=2). The only statistically significant changes in gene expression between these treatments were an increase in the four IL1RN isoforms (false discovery rate ≤3×10−4) and a decrease in IL32 (false discovery rate=0.03).
  • FIGS. 2A-2H show RNA-guided activation of human genes relevant to cell and gene therapy, genetic reprogramming, and regenerative medicine. HEK293T cells were transfected with the iCas9-VP64 expression plasmid and four gRNAs individually or in combination. Target gene expression was measured by qRT-PCR and normalized to GAPDH mRNA levels. Data are shown as the mean±s.e.m. (n=3 independent experiments). Treatment with the combination of gRNAs was statistically different than all other treatments (*P<0.05) by Tukey's test.
  • FIG. 3 shows expression of iCas9-VP64. Expression of iCas9-VP64 in transfected HEK293 cells was confirmed by western blot for the N-terminal Flag epitope tag. The wt Cas9 expression plasmid does not contain the epitope tag.
  • FIG. 4 shows positions of gRNA target sites and DNAse hypersensitivity of human target genes. The four gRNA target sites for each locus are designated as custom tracks above each gene and DNase-seq data indicating DNAse-hypersensitive open chromatin regions is shown below each gene. DNase-seq was performed in HEK293T cells to identify DNase hypersensitive regions, as previously described (Song et al., Cold Spring Harbor protocols 2010, pdb prot5384 (2010); Song et al. Genome Res 21, 1757-1767 (2011)). The results show that open chromatin was not a requirement for gene activation by combinations of gRNAs with iCas9-VP64.
  • FIG. 5 shows the absence of nuclease activity by iCas9-VP64. Wild-type Cas9 or inactivated (D10A, H840A) iCas9-VP64 expression plasmids were co-transfected with expression plasmids for four different guide RNAs targeting the IL1RN promoter. Nuclease activity was determined by the Surveyor assay (Guschin et al., Methods Mol Biol 649, 247-256 (2010)). The lower molecular weight bands indicative of nuclease activity and DNA repair by non-homologous end joining are only present following treatment with wild-type Cas9, supporting abrogation of nuclease activity by iCas9-VP64.
  • FIG. 6 shows RNA-seq for samples treated with gRNAs targeting HBG1 and HBG2. RNA-seq was performed on samples treated with a control empty expression vector (n=3) or cotransfected with the expression plasmids for iCas9-VP64 and the four gRNAs targeting HBG1 (n=2). Three of these gRNAs also target HBG2. Increases in both HBG1 and HBG2 relative to control were observed but were not statistically significant due to low expression levels. The only statistically significant changes in gene expression between these treatments were decreases in IL32 (false discovery rate=0.0007) and TNFRS9 (false discovery rate=0.002).
  • FIG. 7 shows upregulation of Ascl1 and γ-globin by iCas9-VP64. HEK293T cells were transfected with iCas9-VP64 and four gRNAs targeting the ASCL1 or HBG1 promoter. Levels of corresponding Ascl1 and γ-globin protein production were assessed by western blot. Low levels of these proteins were detectable in HEK293T cells and increases in expression were detectable following iCas9-VP64 treatment in two independent experiments.
  • FIGS. 8A-8H show activation of downstream targets of Ascl1 in iCas9-VP64-treated murine embryonic fibroblasts. Mouse embryonic fibroblasts (MEFs) were transfected with a control GFP expression plasmid or the iCas9-VP64 expression plasmid and a combination of four gRNA expression plasmids targeting ASCL1 at a ratio of 50:50 or 75:25. (FIG. 8A) The gRNA target sites in the human ASCL1 promoter (SEQ ID NO: 3) are conserved in the mouse ASCL1 promoter (SEQ ID NO: 4). Target sites are indicated by solid lines and the transcribed region is indicated by dashed line. (FIG. 8B) ASCL1 expression in MEFs increased at two days after iCas9-VP64/gRNA treatment as determined by qRT-PCR. (FIGS. 8C-8H) After 10 days in neural induction media, cells were stained for Ascl1 and Tuj1, an early marker of neuronal differentiation (FIGS. 8C-8D), or for Tuj1 and MAP2, a marker of more mature neuronal differentiation (FIGS. 8D-8F). Some Tuj1-positive cells adopted neuronal morphologies (FIGS. 8F-8G) and a single cell was found to be positive for Tuj1 and MAP2 (FIG. 8G). (FIG. 8H) Tuj1-positive cells were readily identified in the iCas9-VP64/gRNA-treated cultures (˜0.05%) but were absent in controls. n=3 independent samples and data are represented as mean standard error of the mean. gRNA 75/25 is significantly different than gRNA 50/50 and control (*P<0.01, Tukey's test).
  • FIG. 9A shows the iCas9-VP64 protein sequence (SEQ ID NO: 1) and FIG. 9B shows the sequence of the gRNA expression cassette with U6 promoter (SEQ ID NO: 2).
  • FIG. 10 shows the standard curves for qRT-PCR. For each gene, the experimental sample with the highest expression level was diluted to create a standard curve that was assayed by qRT-PCR to ensure efficient amplification over an appropriate dynamic range. The efficiencies of all amplification reactions were within 90-115%.
  • FIGS. 11A-11C show the validation of RNA-guided repair. FIG. 11A shows the Surveyor assay results of genomic DNA harvested from HEK 293T cells two days after Cas9 was co-transfected into the cells with empty vector (negative control) or gRNA. FIG. 11B shows the location of the gRNA target. FIG. 11C shows the expected cleavage sizes for each gRNA.
  • FIG. 12 shows RNA-guided repair in DMD 8036 (del48-50) cells as shown by Surveyor assay.
  • FIG. 13 shows RNA-guided repair in DMD 8036 (del48-50) cells as shown by PCR across the entire locus. The PCR of a wild-type dystrophin gene generates a fragment of 1447 bp in size, whereas PCR of the mutant gene in the DMD 8036 cell line shows a deletion of approximately 817 bp. The deletion band after introduction of the CRISPR/Cas9-based system was approximately 630 bp.
  • FIG. 14 shows RNA-guided repair in DMD 8036 (del48-50) cells as shown by Western blot with MANDYS8 (anti-dystrophin antibody) and GAPDH antibody (positive control).
  • FIG. 15 shows ChIP sequencing data illustrating the specific binding of iCas9-VP64 targeting the IL1RN promoter. HEK 293T cells were transfected with iCas9-VP64 targeting the IL1RN promoter.
  • FIGS. 16A-16D CRISPR/Cas9 targeting of the dystrophin gene. (FIG. 16A) sgRNA sequences were designed to bind sequences in the exon 45-55 mutational hotspot region of the dystrophin gene, such that gene editing could restore dystrophin expression from a wide variety of patient-specific mutations. Arrows within introns indicate sgRNA targets designed to delete entire exons from the genome. Arrows within exons indicate sgRNA targets designed to create targeted frameshifts in the dystrophin gene. (FIG. 16B) Example of frame correction following introduction of small insertions or deletions by NHEJ DNA repair in exon 51 using the CR3 sgRNA. FIG. 16B discloses SEQ ID NOS 633-636, respectively, in order of appearance. (FIG. 16C) Schematic of multiplex sgRNA targets designed to delete exon 51 and restore the dystrophin reading frame in a patient mutation with the deletion of exons 48-50. (FIG. 16D) Schematic of multiplex sgRNA targets designed to delete the entire exon 45-55 region to address a variety of DMD patient mutations.
  • FIG. 17 shows images of TBE-PAGE gels used to quantify Surveyor assay results to measure day 3 gene modification in Table 7. Asterisks mark expected sizes of bands indicative of nuclease activity.
  • FIG. 18 shows images of TBE-PAGE gels used to quantify Surveyor assay results to measure day 10 gene modification in Table 7. Asterisks mark expected sizes of bands indicative of nuclease activity.
  • FIGS. 19A-19D show fluorescence-activated flow sorting to enrich genetically modified DMD myoblasts. (FIG. 19A) A plasmid expressing a human-codon optimized SpCas9 protein linked to a GFP marker using a T2A ribosomal skipping peptide sequence was co-electroporated into human DMD myoblasts with one or two plasmids carrying sgRNA expression cassettes. (FIG. 19B) The indicated sgRNA expression cassettes were independently co-transfected into HEK293 Ts with a separate plasmid expressing SpCas9 with (bottom) or without (top) a GFP marker linked to SpCas9 by a T2A ribosomal skipping peptide sequence. Gene modification frequencies were assessed at 3 days post-transfection by the Surveyor assay. (FIG. 19C) DMD myoblasts with deletions of exons 48-50 in the dystrophin gene were treated with sgRNAs that correct the dystrophin reading frame in these patient cells. Gene modification was assessed at 20 days post-electroporation in unsorted (bulk) or GFP+ sorted cells. (FIG. 19D) GFP expression in DMD myoblasts 3 days after electroporation with indicated expression plasmids. Transfection efficiencies and sorted cell populations are indicated by the gated region.
  • FIGS. 20A-20D show targeted frameshifts to restore the dystrophin reading frame using CRISPR/Cas9. (FIG. 20A) The 5′ region of exon 51 was targeted using a sgRNA (SEQ ID NO: 637), CR3, that binds immediately upstream of the first out-of-frame stop codon. PAM: protospacer-adjacent motif. (FIG. 20B) The exon 51 locus was PCR amplified from HEK293T cells treated with SpCas9 and CR3 expression cassettes. Sequences of individual clones were determined by Sanger sequencing. The top sequence (bolded, exon in red) is the native, unmodified sequence. The number of clones for each sequence is indicated in parentheses. (FIG. 20C) Summary of total gene editing efficiency and reading frame conversions resulting from gene modification shown in FIG. 20B. (FIG. 20D) Western blot for dystrophin expression in human DMD myoblasts treated with SpCas9 and the CR3 sgRNA expression cassette (FIG. 19C) to create targeted frameshifts to restore the dystrophin reading frame. Dystrophin expression was probed using an antibody against the rod-domain of the dystrophin protein after 6 days of differentiation.
  • FIGS. 21A-21D show deletion of exon 51 from the human genome using multiplex CRISPR/Cas9 gene editing. (FIG. 21A) End-point genomic PCR across the exon 51 locus in human DMD myoblasts with a deletion of exons 48-50. The top arrow indicates the expected position of full-length PCR amplicons and the two lower arrows indicate the expected position of PCR amplicons with deletions caused by the indicated sgRNA combinations. (FIG. 21B) PCR products from FIG. 21A were cloned and individual clones were sequenced to determine insertions and deletions present at the targeted locus (SEQ ID NOS 424, 638, 425-428, 639 and 429-431, respectively, in order of appearance). The top row shows the wild-type unmodified sequence and the triangles indicate SpCas9 cleavage sites. At the right are representative chromatograms showing the sequences of the expected deletion junctions (SEQ ID NOS 640-642, respectively, in order of appearance). (FIG. 21C) End-point RT-PCR analysis of dystrophin mRNA transcripts in CRISPR/Cas9-modified human Δ48-50 DMD myoblasts treated with the indicated sgRNAs. A representative chromatogram of the expected deletion PCR product is shown at the right. Asterisk: band resulting from hybridization of the deletion product strand to the unmodified strand. (FIG. 21D) Rescue of dystrophin protein expression by CRISPR/Cas9 genome editing was assessed by western blot for the dystrophin protein with GAPDH as a loading control. The arrow indicates the expected restored dystrophin protein band.
  • FIGS. 22A-22D show deletion of the entire exon 45-55 region in human DMD myoblasts by multiplex CRISPR/Cas9 gene editing. (FIG. 22A) End-point genomic PCR of genomic DNA to detect deletion of the region between intron 44 and intron 55 after treating HEK293 Ts or DMD myoblasts with the indicated sgRNAs. (FIG. 22B) Individual clones of PCR products (SEQ ID NOS 432, 643 and 433, respectively, in order of appearance) of the expected size for the deletions from DMD myoblasts in FIG. 22A were analyzed by Sanger sequencing to determine the sequences of genomic deletions present at the targeted locus. Below is a representative chromatograms showing the sequence of the expected deletion junctions (SEQ ID NO: 644). (FIG. 22C) End-point RT-PCR analysis of dystrophin mRNA transcripts in CRISPR/Cas9-modified human Δ48-50 DMD myoblasts treated with the indicated sgRNAs. A representative chromatogram of the expected deletion PCR product is shown at the right (SEQ ID NO: 645). (FIG. 22D) Analysis of restored dystrophin protein expression by western blot following electroporation of DMD myoblasts with sgRNAs targeted to intron 44 and/or intron 55.
  • FIG. 23 shows verification of flow cytometry-based enrichment of gene-modified DMD myoblasts used for in vivo cell transplantation experiment. DMD myoblasts were treated with Cas9 with or without sgRNA expression vectors for CR1 and CR5 and sorted for GFP+ cells by flow cytometry. Deletions at the exon 51 locus were detected by end-point PCR using primers flanking the locus. Neg ctrl: DMD myoblasts treated with Cas9 only and sorted for GFP+ cells.
  • FIG. 24 shows expression of restored human dystrophin in vivo following transplantation of CRISPR/Cas9-treated human DMD myoblasts into immunodeficient mice. Human Δ48-50 DMD myoblasts were treated with SpCas9, CR1, and CR5 to delete exon 51 and sorted for GFP expression as shown in FIGS. 19A-19D. These sorted cells and untreated control cells were injected into the hind limbs of immunodeficient mice and assessed for human-specific protein expression in muscle fibers after 4 weeks post-transplantation. Cryosections were stained with anti-human spectrin, which is expressed by both uncorrected and corrected myoblasts that have fused into mouse myofibers, or anti-human dystrophin antibodies as indicated. White arrows indicate muscle fibers positive for human dystrophin.
  • FIGS. 25A-25F show additional immunofluorescence images probing human dystrophin expression. Serial sections from regions stained with anti-human spectrin are shown inset in top left. (FIG. 25A-FIG. 25C) Sections from muscles injected with untreated human DMD myoblasts. (FIG. 25D-FIG. 25F) Sections from muscles injected with CR1/5 treated human DMD myoblasts enriched by flow cytometry. White arrows indicate dystrophin positive fibers.
  • FIGS. 26A-26D shows evaluation of CRISPR/Cas9 toxicity and off-target effects for CR1/CR5-mediated deletion of exon 51 in human cells. (FIG. 26A) Results of a cytotoxicity assay in HEK293T cells treated with human-optimized SpCas9 and the indicated sgRNA constructs. Cytotoxicity is based on survival of GFP-positive cells that are co-transfected with the indicated nuclease. I-SceI is a well-characterized non-toxic meganuclease and GZF3 is a known toxic zinc finger nuclease. (FIG. 26B) Surveyor analysis at off-target sites in sorted hDMD cells treated with expression cassettes encoding Cas9 the indicated sgRNAs. These three off-target sites tested in hDMD cells were identified from a panel of 50 predicted sites tested in HEK293T cells (FIG. 27 and Table 4). TGT: on-target locus for indicated sgRNA. OT:off-target locus. (FIG. 26C, FIG. 26D) End-point nested PCR to detect chromosomal translocations in (FIG. 26C) HEK293T cells treated with Cas9 and CR1 or (FIG. 26D) sorted hDMD cells treated with Cas9, CR1, and CR5. The schematic depicts the relative location of nested primer pairs customized for each translocation event. The expected size of each band was estimated based on the primer size and the location of the predicted sgRNA cut site at each locus. Asterisks indicate bands detected at the expected size. The identities of the bands in FIG. 26C were verified by Sanger sequencing from each end (FIG. 30). A representative chromatogram for the P2/P5 translocation in HEK293T cells is shown (SEQ ID NO: 646).
  • FIG. 27 shows images of TBE-PAGE gels used to quantify Surveyor assay results to measure on-target and off-target gene modification in Table 4. Asterisks mark expected sizes of bands indicative of nuclease activity.
  • FIGS. 28A-28C show end-point nested PCR to detect chromosomal translocations caused by CRISPR/Cas9 off-target activity for CR3 and CR6/CR36 in human cells. Nested end-point PCR analysis was used to detect translocations in (FIG. 28A) HEK293T or sorted hDMD cells treated with Cas9 and CR3 as indicated, (FIG. 28B) HEK293T cells treated with Cas9 and CR36 alone, or (FIG. 28C) sorted hDMD cells treated with Cas9, CR6, and CR36 expression cassettes. The second nested PCR reaction for translocation was amplified using custom primers for each predicted translocation locus to maximize specificity (See Table 4). The schematic depicts the relative location of nested primer pairs used to probe for the presence of translocations. Each possible translocation event was first amplified from genomic DNA isolated from cells treated with or without the indicated sgRNA(s). A second nested PCR reaction was performed using primers within the predicted PCR amplicons that would result from translocations. Expected size was estimated based on the indicated primer binding site and the predicted sgRNA cut site at each locus. *indicates bands detected at the expected size and verified by Sanger sequencing from each end. # indicates amplicons in which Sanger sequencing showed sequences other than the predicted translocation, likely a result of mispriming during the nested PCR.
  • FIG. 29 shows Sanger sequencing chromatograms (SEQ ID NOS 647-654, respectively, in order of appearance) for bands detected in FIGS. 28A-28C resulting from translocations between CR3 and CR3-OT1, on chromosomes X and 1, respectively, in HEK293T cells treated with Cas9 and CR3 gene cassettes. Arrows show regions of homology to the indicated chromosome nearby the expected break points caused by the appropriate sgRNAs. Note that sequencing reads become out of phase near the break point due to the error-prone nature of DNA repair by non-homologous end-joining.
  • FIG. 30 shows Sanger sequencing chromatograms (SEQ ID NOS 655-660, respectively, in order of appearance) for bands detected in FIG. 26C resulting from translocations between CR1 and CR1-OT1, on chromosomes X and 16, respectively, in HEK293T cells treated with Cas9 and CR1 gene cassettes. Arrows show regions of homology to the indicated chromosome nearby the expected break points caused by the appropriate sgRNAs. Note that sequencing reads become out of phase near the break point due to the error-prone nature of DNA repair by non-homologous end-joining.
  • FIG. 31 shows an overview of in vivo AAV injections and tissue harvest.
  • FIGS. 32A-32C show Surveyor analysis of Rosa26 ZFN activities in skeletal muscle in vitro and in vivo following delivery of AAV-SASTG-ROSA. Arrows indicate expected bands resulting from Surveyor cleavage. n.d.: not detected. (FIG. 32A) Proliferating C2C12s were transduced with the indicated amount of virus and harvested at 4 days post-infection. Arrows indicate expected bands sizes resulting from Surveyor cleavage. (FIG. 32B) C2C12s were incubated in differentiation medium for 5 days and then transduced with the indicated amount of AAV-SASTG-ROSA virus in 24 well plates. Samples were collected at 10 days post-transduction. (FIG. 32C) The indicated amount of AAV-SASTG-ROSA was injected directly into the tibialis anterior of C57BL/6J mice and muscles were harvested 4 weeks post-infection. The harvested TA muscles were partitioned into 8 separate pieces for genomic DNA analysis, each shown in a separate lane.
  • FIG. 33 shows Rosa T2A opt DNA sequence (SEQ ID NO: 434) and Rosa T2A opt protein sequence (SEQ ID NO: 435).
  • FIG. 34 shows SASTG capsid DNA sequence (SEQ ID NO:436) and SASTG capsid peptide sequence (SEQ ID NO: 437).
  • FIG. 35 shows DZF16 ZFN target site sequence (SEQ ID NO: 442), DZF16-L6 left full amino acid sequence (SEQ ID NO: 443) and DZF16-R6 right full amino acid sequence (SEQ ID NO: 444).
  • FIG. 36 shows E51C3 ZFN target site sequence (SEQ ID NO: 445), E51C3-3L left full amino acid sequence (SEQ ID NO: 446) and E51C3-3R right full amino acid sequence (SEQ ID NO: 447).
  • FIG. 37 shows DZF15 ZFN target site sequence (SEQ ID NO: 448), DZF15-L6 left full amino acid sequence (SEQ ID NO: 449), DZF15-R6 right full amino acid sequence (SEQ ID NO: 450), DZF15-L5 left full amino acid sequence (SEQ ID NO: 451), DZF15-R5 right full amino acid sequence (SEQ ID NO: 452).
  • FIG. 38 shows E51C4 ZFN target site sequence (SEQ ID NO: 453), E51C4-4L left full amino acid sequence (SEQ ID NO: 454) and E51C4-4R right full amino acid sequence (SEQ ID NO: 455).
  • FIG. 39 shows schematic diagrams of a “Single vector, multiplex CRISPR system,” Dual vector, multiplex CRISPR system,” and “Single vector, single gRNA system.”
  • FIG. 40 shows the nucleotide sequences of SaCas9-NLS (with the NLS underlined) (SEQ ID NO: 459) and SaCas9 gRNA (SEQ ID NO: 460).
  • FIG. 41 shows the nucleotide sequences of NmCas9 (with the NLS 1 underlined, the NLS 2 underlined and bolded, and the HA tag bolded), NmCas9 short hairpin from Thomson PNAS 2013 (SEQ ID NO: 462), and NmCas9 long hairpin from Church Nature Biotech 2013 (SEQ ID NO: 463).
  • FIGS. 42A-42C show validation of sgRNA and lentiviral Cas9 expression constructs. (FIG. 42A) Constructs encoding unique Pol III promoters expressing sgRNAs targeting the AAVS1 locus or a construct containing the hU6 promoter immediately followed by poly-thymidine to terminate expression (“PolyT”) were transfected into HEK293T cells. End-point RT-PCR was used to probe for expression of each indicated promoter/sgRNA construct two days post-transfection. -RT: no reverse transcriptase control. (FIG. 42B) HEK293 Ts were transfected with expression vectors encoding the AAVS1 zinc-finger nuclease or Cas9-T2A-GFP and the indicated promoter/sgRNA expression cassettes and assessed for gene modification levels 3 days post-transfection using the Surveyor assay. (FIG. 42C) HEK293T cells were transduced with lentiviral constructs encoding the indicated Cas9-T2A-GFP constructs without sgRNAs and assessed for Cas9 expression by western blot 7 days post-transduction by probing for a FLAG epitope tag on the N-terminus of the Cas9 protein.
  • FIG. 43 shows Golden Gate assembly of single lentiviral CRISPR/Cas9 expression cassettes. FIG. 43 discloses SEQ ID NOS 661-672, respectively, in order of appearance.
  • FIGS. 44A-44B show single lentiviral delivery of a multiplex CRISPR/Cas9 system. (FIG. 44A) Four sgRNAs targeting distinct genomic loci were cloned into a lentiviral vector expressing the active Cas9 nuclease. (FIG. 44B) HEK293 Ts and primary human dermal fibroblasts were transduced with lentivirus expressing the indicated sgRNAs and assayed for cleavage events using the Surveyor assay. HEK293 Ts were assayed 7 days post transduction. The human fibroblasts were assayed 10 days post transduction.
  • FIGS. 45A-45D show transient gene activation in HEK293 Ts stably expressing dCas9-VP64. HEK293 Ts were transduced with lentivirus to stably express dCas9-VP64 and were subsequently transfected with plasmid expressing the indicated sgRNA combinations. By varying the number of sgRNAs delivered, tunable endogenous gene activation of the endogenous IL1RN (FIG. 45A) and HBG1 (FIG. 45B) loci was achieved 3 days post transfection. Peak levels of endogenous IL1RN (FIG. 45C) and HBG1 (FIG. 45D) were observed 3-6 days post transfection and the level of activation returned to background levels between days 15-20. Importantly, the cell lines were able to reactive following a second transfection on day 20 albeit at a lower level than previously observed.
  • FIGS. 46A-46D show stable gene activation in HEK293 Ts using a single lentiviral multiplex dCas9-VP64 vector. HEK293 Ts were transduced with lentivirus to stably express dCas9-VP64 and the indicated combinations of gRNAs. By varying the number of sgRNAs delivered, tunable endogenous gene activation of the endogenous IL1RN (FIG. 46A) and HBG1 (FIG. 46B) loci was achieved 7 days post transduction. Peak levels of endogenous IL1RN (FIG. 46C) and HBG1 (FIG. 46D) were observed 6 days post transduction and the level of activation was sustained out to day 21.
  • FIG. 47 shows IL1RN mRNA expression levels.
  • FIG. 48 shows a schematic representing the direct conversion of fibroblasts to neurons through ectopic expression of the BAM neuronal transcription factors.
  • FIGS. 49A-49C show (FIG. 49A) Schematic of the dCas9-VP64 construct. dCas9-VP64 is a catalytically inactive form of the Cas9 protein fused to a tetramer of the VP16 transcriptional activation domain. (FIG. 49B) Schematic showing the mechanism of RNA-guided recruitment of dCas9-VP64 to a genomic target. (FIG. 49C) Schematic of the experimental protocol to generate iNs with CRISPR/Cas9 transcription factors.
  • FIGS. 50A-50B show endogenous ASCL1 expression at day 3 determined by (FIG. 50A) qRT-PCR or total ASCL1 protein detected by (FIG. 50B) immunofluorescence in MEFs transduced with dCas9-VP64 and transfected with either gRNAs targeted to the ASCL1 promoter, ASCL1 cDNA, or luciferase. Asterisk (*) indicates significant (p<0.05) increase in ASCL1 expression with the co-delivery of 8 gRNAs compared to 4 gRNAs. Ectopic expression of ASCL1 produced more protein than induced by dCas9-VP64 and 8 gRNAs targeted to the Ascl1 promoter, but did not activate the endogenous locus by day 3 in culture.
  • FIG. 51A shows TUJ1 and MAP2-positive cells generated by ectopic BAM factors or by dCas9-VP64 and gRNAs targeted to the BRN2 and ASCL1 promoters. FIG. 51B shows cells with neuronal morphology expressing a hSyn-RFP reporter at day 11 in N3 medium.
  • FIG. 52A shows a cell with neuronal morphology positive for the GCaMP5 calcium indicator in the presence (bottom) or absence (top) of KCl in the culture medium. FIG. 52B shows a trace of normalized fluorescent intensity over time showing depolarization of the cell in response to KCl addition.
  • FIGS. 53A-53C show the CRISPR/Cas9 platform for control of mammalian gene regulation. (FIG. 53A) Cas9-based effectors bind genomic sequences in the presence of a chimeric gRNA molecule consisting of a constant region that complexes with Cas9 preceded by an exchangeable 20 bp protospacer that confers target site specificity. FIG. 53A discloses SEQ ID NO: 673. (FIG. 53B) Cas9-based synthetic transcription factors repress transcription of a target gene by interfering with RNA polymerase activity or by binding within the promoter and blocking the binding sites of endogenous transcription factors. (FIG. 53C) Targeting regulatory elements such as enhancers could also potentially block the expression of multiple distal genes.
  • FIG. 54 shows targeting the HS2 enhancer using CRISPR/dCas9-KRAB. The HS2 region is a potent enhancer that distally regulates the expression of globin genes >10 kb downstream. A panel of single gRNAs was designed to target sites along the enhancer region.
  • FIGS. 55A-55E show that single gRNAs targeting the HS2 enhancer effect potent transcriptional repression of globin genes. (FIG. 55A) dCas9 and dCas9-KRAB repressors were delivered on a lentiviral vector. Single gRNAs were transiently transfected for screening. When assayed by quantitative RT-PCR at 3 days post-transfection, K562s expressing dCas9-KRAB achieve up to 80% repression of (FIG. 55B) γ-globin, (FIG. 55C) ε-globin, and (FIG. 55D) β-globin genes, as compared to control cells that received no gRNA treatment. (FIG. 55E) Protein expression in cells expressing dCas9 or dCas9-KRAB and treated with Cr4 or Cr8 show mild repression of γ-globin expression at day 3, compared to β-actin controls.
  • FIGS. 56A-56C show expression of globin locus genes with varying doses of gRNA plasmid delivered to cells treated with (FIG. 56A) no lentivirus, (FIG. 56B) dCas9 lentivirus, or (FIG. 56C) dCas9-KRAB lentivirus. Increasing the dose of Cr4 gRNA plasmid delivered enhanced repression in dCas9-KRAB treated cells, indicating that both the dCas9-KRAB effector and targeted gRNA play a role in achieving repression.
  • FIGS. 57A-57D show that stably delivering single gRNAs with dCas9-KRAB silences expression of the globin genes. (FIG. 57A) dCas9 and dCas9-KRAB repressors were co-expressed on a lentiviral vector with single gRNAs. When assayed by quantitative RT-PCR at 7 days post-transduction, K562s expressing dCas9-KRAB achieve up to 95% repression of (FIG. 57B) γ-globin, (FIG. 57C) ε-globin, and (FIG. 57D) β-globin genes, as compared to control cells that received no lentiviral treatment.
  • FIG. 58 shows that isolating the p300 HAT “Core” for targeted epigenetic modification of histones only via dCas9 fusion.
  • FIG. 59 shows a simplified schematic of S. pyogenes dCas9-VP64 fusion (top) and dCas9-p300 core fusion (bottom). The Protospacer Adjacent Motifs (PAM) are shown with arrows at target gene loci and synthetic guide RNA (gRNA) is shown with hatched arrows.
  • FIGS. 60A-60C show representative data at three human loci demonstrating the efficacy of activation using dCas9-p300 in relation to dCas9-VP64 and dCas9 without any fused effector domain in the human 293T cell culture line.
  • FIGS. 61A-61C show the amino acid sequences of the dCas9 constructs. The legend for all FIGS. 61A-61C is shown in FIG. 61A. FIGS. 61A-61C disclose SEQ ID NOS 674-676, respectively, in order of appearance.
  • FIG. 62 shows that HAT-dCase9-p300 fusion proteins fail to activate gene expression.
  • FIGS. 63A-63B show that gRNA's also act synergistically with dCas9-p300 Core.
  • FIGS. 64A-64C show TALEN mediated integration of minidystrophin at the 5′UTR of the Dp427m skeletal muscle isoform of dystrophin in skeletal myoblast cell lines derived from human DMD patients carrying different deletions in the dystrophin gene. DMD patient cells were electroporated with constructs encoding a TALEN pair active at the 5′UTR locus and a donor template carrying the minidystrophin gene. (FIG. 64A) Schematic showing how minidystrophin is integrated into the 5′UTR. (FIG. 64B) Hygromycin-resistant clonal cell lines were isolated and screened by PCR for successful site-specific integrations at the 5′UTR using the primers shown in FIG. 64A. Asterisks indicate clones selected for further analysis in FIG. 64C. (FIG. 64C) Clonally isolated DMD myoblasts with detected integration events were differentiated for 6 days and assessed for expression of an HA tag fused to the C terminus of minidystrophin.
  • DETAILED DESCRIPTION
  • As described herein, certain methods and engineered CRISPR/CRISPR-associated (Cas) 9-based system compositions have been discovered to be useful for altering the expression of genes, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases. The CRISPR/Cas9-based system involves a Cas9 protein and at least one guide RNA, which provide the DNA targeting specificity for the system. In particular, the present disclosure describes a Cas9 fusion protein that combines the DNA sequence targeting function of the CRISPR/Cas9-based system with an additional activity, thus allowing changes in gene expression and/or epigenetic status. The system may also be used in genome engineering and correcting or reducing the effects of gene mutations.
  • The present disclosure also provides certain compositions and methods for delivering CRISPR/CRISPR-associated (Cas) 9-based system and multiple gRNAs to target one or more endogenous genes. Co-transfection of multiple sgRNAs targeted to a single promoter allow for synergistic activation, however, co-transfection of multiple plasmids leads to variable expression levels in each cell due to differences in copy number. Additionally, gene activation following transfection is transient due to dilution of plasmid DNA over time. Moreover, many cell types are not easily transfected and transient gene expression may not be sufficient for inducing a therapeutic effect. To address these limitations, a single lentiviral system was developed to express Cas9 and up to four sgRNAs from independent promoters. A platform is disclosed that expresses Cas9 or dCas9 fusion proteins and up to four gRNAs from a single lentiviral vector. The lentiviral vector expresses a constitutive or inducible Cas9 or dCas9-VP64 in addition to one, two, three, or four gRNAs expressed from independent promoters. This system enables control of both the magnitude and timing of CRISPR/Cas9-based gene regulation. Furthermore, the lentiviral platform provides the potent and sustained levels of gene expression that will facilitate therapeutic applications of the CRISPR/Cas9 system in primary cells. Finally, this system may be used for editing multiple genes simultaneously, such as the concurrent knockout of several oncogenes.
  • The present disclosure also provides certain compositions and methods for delivering site-specific nucleases to skeletal muscle and cardiac muscle using modified adeno-associated virus (AAV) vectors. The site-specific nucleases, which may be engineered, are useful for altering the expression of genes, genome engineering, correcting or reducing the effects of mutations in genes involved in genetic diseases, or manipulating genes involved in other conditions affecting skeletal muscle or cardiac muscle or muscle regeneration. The engineered site-specific nucleases may include a zinc finger nuclease (ZFN), a TAL effector nuclease (TALEN), and/or a CRISPR/Cas9 system for genome editing. As described herein, genes in skeletal muscle tissue were successfully edited in vivo using this unique delivery system. The disclosed invention provides a means to rewrite the human genome for therapeutic applications and target model species for basic science applications.
  • Gene editing is highly dependent on cell cycle and complex DNA repair pathways that vary from tissue to tissue. Skeletal muscle is a very complex environment, consisting of large myofibers with more than 100 nuclei per cell. Gene therapy and biologics in general have been limited for decades by in vivo delivery hurdles. These challenges include stability of the carrier in vivo, targeting the right tissue, getting sufficient gene expression and active gene product, and avoiding toxicity that might overcome activity, which is common with gene editing tools. Other delivery vehicles, such as direct injection of plasmid DNA, work to express genes in skeletal muscle and cardiac muscle in other contexts, but do not work well with these site-specific nucleases for achieving detectable levels of genome editing.
  • While many gene sequences are unstable in AAV vectors and therefore undeliverable, these site-specific nucleases are surprisingly stable in the AAV vectors. When these site-specific nucleases are delivered and expressed, they remained active in the skeletal muscle tissue. The protein stability and activity of the site-specific nucleases are highly tissue type- and cell type-dependent. These active and stable nucleases are able to modify gene sequences in the complex environment of skeletal muscle. The current invention describes a way to deliver active forms of this class of therapeutics to skeletal muscle or cardiac muscle that is effective, efficient and facilitates successful genome modification.
  • The present disclosure also provides certain fusion epigenetic effector molecules, a dCas9-p300 fusion protein, which provides a robust and potentially more widely applicable tool for synthetic transcriptional modulation compared to the dCas9-VP64 fusion. The activated target genes to a substantially greater extent than the dCas9-VP64 fusion protein at all loci tested. In addition, the p300 has intrinsic endogenous activity at enhancers within the human genome. The dCas9-p300 fusion protein may be able to activate endogenous target gene promoters and enhancer regions.
  • The dCas9-p300 fusion protein can be used in human tissue culture cell lines to activate gene expression. This fusion protein may be used to direct the epigenetic state of target loci within human cells with precision and predictability in order to control differentiation, modulate cellular regulation, and apply innovative potential therapies. Current technologies are limited in the strength of activation and the extent and sustainability of epigenetic modulation; obstacles which may be obviated via utilization of this new fusion protein.
  • Section headings as used in this section and the entire disclosure herein are merely for organizational purposes and are not intended to be limiting.
  • 1. DEFINITIONS
  • Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
  • The terms “comprise(s),” “include(s),” “having,” “has,” “can,” “contain(s),” and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms “a,” “and” and “the” include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments “comprising,” “consisting of” and “consisting essentially of,” the embodiments or elements presented herein, whether explicitly set forth or not.
  • For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
  • “Adeno-associated virus” or “AAV” as used interchangeably herein refers to a small virus belonging to the genus Dependovirus of the Parvoviridae family that infects humans and some other primate species. AAV is not currently known to cause disease and consequently the virus causes a very mild immune response.
  • “Binding region” as used herein refers to the region within a nuclease target region that is recognized and bound by the nuclease.
  • “Cardiac muscle” or “heart muscle” as used interchangeably herein means a type of involuntary striated muscle found in the walls and histological foundation of the heart, the myocardium. Cardiac muscle is made of cardiomyocytes or myocardiocytes. Myocardiocytes show striations similar to those on skeletal muscle cells but contain only one, unique nucleus, unlike the multinucleated skeletal cells.
  • “Cardiac muscle condition” as used herein refers to a condition related to the cardiac muscle, such as cardiomyopathy, heart failure, arrhythmia, and inflammatory heart disease.
  • “Coding sequence” or “encoding nucleic acid” as used herein means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes a protein. The coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered. The coding sequence may be codon optimize.
  • “Complement” or “complementary” as used herein means a nucleic acid can mean Watson-Crick (e.g., A-T/U and C-G) or Hoogsteen base pairing between nucleotides or nucleotide analogs of nucleic acid molecules. “Complementarity” refers to a property shared between two nucleic acid sequences, such that when they are aligned antiparallel to each other, the nucleotide bases at each position will be complementary.
  • “Correcting”, “genome editing” and “restoring” as used herein refers to changing a mutant gene that encodes a truncated protein or no protein at all, such that a full-length functional or partially full-length functional protein expression is obtained. Correcting or restoring a mutant gene may include replacing the region of the gene that has the mutation or replacing the entire mutant gene with a copy of the gene that does not have the mutation with a repair mechanism such as homology-directed repair (HDR). Correcting or restoring a mutant gene may also include repairing a frameshift mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, by generating a double stranded break in the gene that is then repaired using non-homologous end joining (NHEJ). NHEJ may add or delete at least one base pair during repair which may restore the proper reading frame and eliminate the premature stop codon. Correcting or restoring a mutant gene may also include disrupting an aberrant splice acceptor site or splice donor sequence. Correcting or restoring a mutant gene may also include deleting a non-essential gene segment by the simultaneous action of two nucleases on the same DNA strand in order to restore the proper reading frame by removing the DNA between the two nuclease target sites and repairing the DNA break by NHEJ.
  • “Donor DNA”, “donor template” and “repair template” as used interchangeably herein refers to a double-stranded DNA fragment or molecule that includes at least a portion of the gene of interest. The donor DNA may encode a full-functional protein or a partially-functional protein.
  • “Duchenne Muscular Dystrophy” or “DMD” as used interchangeably herein refers to a recessive, fatal, X-linked disorder that results in muscle degeneration and eventual death. DMD is a common hereditary monogenic disease and occurs in 1 in 3500 males. DMD is the result of inherited or spontaneous mutations that cause nonsense or frame shift mutations in the dystrophin gene. The majority of dystrophin mutations that cause DMD are deletions of exons that disrupt the reading frame and cause premature translation termination in the dystrophin gene. DMD patients typically lose the ability to physically support themselves during childhood, become progressively weaker during the teenage years, and die in their twenties.
  • “Dystrophin” as used herein refers to a rod-shaped cytoplasmic protein which is a part of a protein complex that connects the cytoskeleton of a muscle fiber to the surrounding extracellular matrix through the cell membrane. Dystrophin provides structural stability to the dystroglycan complex of the cell membrane that is responsible for regulating muscle cell integrity and function. The dystrophin gene or “DMD gene” as used interchangeably herein is 2.2 megabases at locus Xp21. The primary transcription measures about 2,400 kb with the mature mRNA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids.
  • Exon 51” as used herein refers to the 51st exon of the dystrophin gene. Exon 51 is frequently adjacent to frame-disrupting deletions in DMD patients and has been targeted in clinical trials for oligonucleotide-based exon skipping. A clinical trial for the exon 51 skipping compound eteplirsen recently reported a significant functional benefit across 48 weeks, with an average of 47% dystrophin positive fibers compared to baseline. Mutations in exon 51 are ideally suited for permanent correction by NHEJ-based genome editing.
  • “Frameshift” or “frameshift mutation” as used interchangeably herein refers to a type of gene mutation wherein the addition or deletion of one or more nucleotides causes a shift in the reading frame of the codons in the mRNA. The shift in reading frame may lead to the alteration in the amino acid sequence at protein translation, such as a missense mutation or a premature stop codon.
  • “Functional” and “full-functional” as used herein describes protein that has biological activity. A “functional gene” refers to a gene transcribed to mRNA, which is translated to a functional protein.
  • “Fusion protein” as used herein refers to a chimeric protein created through the joining of two or more genes that originally coded for separate proteins. The translation of the fusion gene results in a single polypeptide with functional properties derived from each of the original proteins.
  • “Genetic construct” as used herein refers to the DNA or RNA molecules that comprise a nucleotide sequence that encodes a protein. The coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered. As used herein, the term “expressible form” refers to gene constructs that contain the necessary regulatory elements operable linked to a coding sequence that encodes a protein such that when present in the cell of the individual, the coding sequence will be expressed.
  • “Genetic disease” as used herein refers to a disease, partially or completely, directly or indirectly, caused by one or more abnormalities in the genome, especially a condition that is present from birth. The abnormality may be a mutation, an insertion or a deletion. The abnormality may affect the coding sequence of the gene or its regulatory sequence. The genetic disease may be, but not limited to DMD, hemophilia, cystic fibrosis, Huntington's chorea, familial hypercholesterolemia (LDL receptor defect), hepatoblastoma, Wilson's disease, congenital hepatic porphyria, inherited disorders of hepatic metabolism, Lesch Nyhan syndrome, sickle cell anemia, thalassaemias, xeroderma pigmentosum, Fanconi's anemia, retinitis pigmentosa, ataxia telangiectasia, Bloom's syndrome, retinoblastoma, and Tay-Sachs disease.
  • “Homology-directed repair” or “HDR” as used interchangeably herein refers to a mechanism in cells to repair double strand DNA lesions when a homologous piece of DNA is present in the nucleus, mostly in G2 and S phase of the cell cycle. HDR uses a donor DNA template to guide repair and may be used to create specific sequence changes to the genome, including the targeted addition of whole genes. If a donor template is provided along with the site specific nuclease, such as with a CRISPR/Cas9-based systems, then the cellular machinery will repair the break by homologous recombination, which is enhanced several orders of magnitude in the presence of DNA cleavage. When the homologous DNA piece is absent, non-homologous end joining may take place instead.
  • “Genome editing” as used herein refers to changing a gene. Genome editing may include correcting or restoring a mutant gene. Genome editing may include knocking out a gene, such as a mutant gene or a normal gene. Genome editing may be used to treat disease or enhance muscle repair by changing the gene of interest.
  • “Identical” or “identity” as used herein in the context of two or more nucleic acids or polypeptide sequences means that the sequences have a specified percentage of residues that are the same over a specified region. The percentage may be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thymine (T) and uracil (U) may be considered equivalent. Identity may be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.
  • “Mutant gene” or “mutated gene” as used interchangeably herein refers to a gene that has undergone a detectable mutation. A mutant gene has undergone a change, such as the loss, gain, or exchange of genetic material, which affects the normal transmission and expression of the gene. A “disrupted gene” as used herein refers to a mutant gene that has a mutation that causes a premature stop codon. The disrupted gene product is truncated relative to a full-length undisrupted gene product.
  • “Non-homologous end joining (NHEJ) pathway” as used herein refers to a pathway that repairs double-strand breaks in DNA by directly ligating the break ends without the need for a homologous template. The template-independent re-ligation of DNA ends by NHEJ is a stochastic, error-prone repair process that introduces random micro-insertions and micro-deletions (indels) at the DNA breakpoint. This method may be used to intentionally disrupt, delete, or alter the reading frame of targeted gene sequences. NHEJ typically uses short homologous DNA sequences called microhomologies to guide repair. These microhomologies are often present in single-stranded overhangs on the end of double-strand breaks. When the overhangs are perfectly compatible, NHEJ usually repairs the break accurately, yet imprecise repair leading to loss of nucleotides may also occur, but is much more common when the overhangs are not compatible.
  • “Normal gene” as used herein refers to a gene that has not undergone a change, such as a loss, gain, or exchange of genetic material. The normal gene undergoes normal gene transmission and gene expression.
  • “Nuclease mediated NHEJ” as used herein refers to NHEJ that is initiated after a nuclease, such as a cas9, cuts double stranded DNA.
  • “Nucleic acid” or “oligonucleotide” or “polynucleotide” as used herein means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the complementary strand of a depicted single strand. Many variants of a nucleic acid may be used for the same purpose as a given nucleic acid. Thus, a nucleic acid also encompasses substantially identical nucleic acids and complements thereof. A single strand provides a probe that may hybridize to a target sequence under stringent hybridization conditions. Thus, a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.
  • Nucleic acids may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequence. The nucleic acid may be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids may be obtained by chemical synthesis methods or by recombinant methods.
  • “Operably linked” as used herein means that expression of a gene is under the control of a promoter with which it is spatially connected. A promoter may be positioned 5′ (upstream) or 3′ (downstream) of a gene under its control. The distance between the promoter and a gene may be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance may be accommodated without loss of promoter function.
  • “Partially-functional” as used herein describes a protein that is encoded by a mutant gene and has less biological activity than a functional protein but more than a non-functional protein.
  • “Premature stop codon” or “out-of-frame stop codon” as used interchangeably herein refers to nonsense mutation in a sequence of DNA, which results in a stop codon at location not normally found in the wild-type gene. A premature stop codon may cause a protein to be truncated or shorter compared to the full-length version of the protein.
  • “Promoter” as used herein means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter may comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter may also comprise distal enhancer or repressor elements, which may be located as much as several thousand base pairs from the start site of transcription. A promoter may be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter may regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents. Representative examples of promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.
  • “Repeat variable diresidue” or “RVD” as used interchangeably herein refers to a pair of adjacent amino acid residues within a DNA recognition motif (also known as “RVD module”), which includes 33-35 amino acids, of a TALE DNA-binding domain. The RVD determines the nucleotide specificity of the RVD module. RVD modules may be combined to produce an RVD array. The “RVD array length” as used herein refers to the number of RVD modules that corresponds to the length of the nucleotide sequence within the TALEN target region that is recognized by a TALEN, i.e., the binding region.
  • “Site-specific nuclease” as used herein refers to an enzyme capable of specifically recognizing and cleaving DNA sequences. The site-specific nuclease may be engineered. Examples of engineered site-specific nucleases include zinc finger nucleases (ZFNs), TAL effector nucleases (TALENs), and CRISPR/Cas9-based systems.
  • “Skeletal muscle” as used herein refers to a type of striated muscle, which is under the control of the somatic nervous system and attached to bones by bundles of collagen fibers known as tendons. Skeletal muscle is made up of individual components known as myocytes, or “muscle cells”, sometimes colloquially called “muscle fibers.” Myocytes are formed from the fusion of developmental myoblasts (a type of embryonic progenitor cell that gives rise to a muscle cell) in a process known as myogenesis. These long, cylindrical, multinucleated cells are also called myofibers.
  • “Skeletal muscle condition” as used herein refers to a condition related to the skeletal muscle, such as muscular dystrophies, aging, muscle degeneration, wound healing, and muscle weakness or atrophy.
  • “Spacers” and “spacer region” as used interchangeably herein refers to the region within a TALEN or ZFN target region that is between, but not a part of, the binding regions for two TALENs or ZFNs.
  • “Subject” and “patient” as used herein interchangeably refers to any vertebrate, including, but not limited to, a mammal (e.g., cow, pig, camel, llama, horse, goat, rabbit, sheep, hamsters, guinea pig, cat, dog, rat, and mouse, a non-human primate (for example, a monkey, such as a cynomolgous or rhesus monkey, chimpanzee, etc.) and a human). In some embodiments, the subject may be a human or a non-human. The subject or patient may be undergoing other forms of treatment.
  • “Target gene” as used herein refers to any nucleotide sequence encoding a known or putative gene product. The target gene may be a mutated gene involved in a genetic disease.
  • “Target region” as used herein refers to the region of the target gene to which the site-specific nuclease is designed to bind and cleave.
  • “Transcription activator-like effector” or “TALE” as used herein refers to a protein structure that recognizes and binds to a particular DNA sequence. The “TALE DNA-binding domain” refers to a DNA-binding domain that includes an array of tandem 33-35 amino acid repeats, also known as RVD modules, each of which specifically recognizes a single base pair of DNA. RVD modules may be arranged in any order to assemble an array that recognizes a defined sequence.
  • A binding specificity of a TALE DNA-binding domain is determined by the RVD array followed by a single truncated repeat of 20 amino acids. A TALE DNA-binding domain may have 12 to 27 RVD modules, each of which contains an RVD and recognizes a single base pair of DNA. Specific RVDs have been identified that recognize each of the four possible DNA nucleotides (A, T, C, and G). Because the TALE DNA-binding domains are modular, repeats that recognize the four different DNA nucleotides may be linked together to recognize any particular DNA sequence. These targeted DNA-binding domains may then be combined with catalytic domains to create functional enzymes, including artificial transcription factors, methyltransferases, integrases, nucleases, and recombinases.
  • “Transcription activator-like effector nucleases” or “TALENs” as used interchangeably herein refers to engineered fusion proteins of the catalytic domain of a nuclease, such as endonuclease FokI, and a designed TALE DNA-binding domain that may be targeted to a custom DNA sequence. A “TALEN monomer” refers to an engineered fusion protein with a catalytic nuclease domain and a designed TALE DNA-binding domain. Two TALEN monomers may be designed to target and cleave a TALEN target region.
  • “Transgene” as used herein refers to a gene or genetic material containing a gene sequence that has been isolated from one organism and is introduced into a different organism. This non-native segment of DNA may retain the ability to produce RNA or protein in the transgenic organism, or it may alter the normal function of the transgenic organism's genetic code. The introduction of a transgene has the potential to change the phenotype of an organism.
  • “Variant” used herein with respect to a nucleic acid means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.
  • “Variant” with respect to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant may also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes may be identified, in part, by considering the hydropathic index of amino acids, as understood in the art. Kyte et al., J. Mol. Biol. 157:105-132 (1982). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes may be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ±2 are substituted. The hydrophilicity of amino acids may also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide. Substitutions may be performed with amino acids having hydrophilicity values within ±2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
  • “Vector” as used herein means a nucleic acid sequence containing an origin of replication. A vector may be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome. A vector may be a DNA or RNA vector. A vector may be a self-replicating extrachromosomal vector, and preferably, is a DNA plasmid. For example, the vector may encode an iCas9-VP64 fusion protein comprising the amino acid sequence of SEQ ID NO: 1 or at least one gRNA nucleotide sequence of any one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625. Alternatively, the vector may encode Cas9 and at least one gRNA nucleotide sequence of any one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • “Zinc finger” as used herein refers to a protein structure that recognizes and binds to DNA sequences. The zinc finger domain is the most common DNA-binding motif in the human proteome. A single zinc finger contains approximately 30 amino acids and the domain typically functions by binding 3 consecutive base pairs of DNA via interactions of a single amino acid side chain per base pair.
  • “Zinc finger nuclease” or “ZFN” as used interchangeably herein refers to a chimeric protein molecule comprising at least one zinc finger DNA binding domain effectively linked to at least one nuclease or part of a nuclease capable of cleaving DNA when fully assembled.
  • Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. For example, any nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those that are well known and commonly used in the art. The meaning and scope of the terms should be clear; in the event however of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
  • 2. COMPOSITIONS FOR GENOME EDITING
  • The present invention is directed to compositions for genome editing, genomic alteration or altering gene expression of a target gene. The compositions may include a may include viral vector and fusion protein such as a site-specific nuclease or CRISPR/Cas9-system with at least one gRNA.
  • a. Compositions for Genome Editing in Muscle
  • The present invention is directed to a composition for genome editing a target gene in skeletal muscle or cardiac muscle of a subject. The composition includes a modified AAV vector and a nucleotide sequence encoding a site-specific nuclease. The composition delivers active forms of site-specific nucleases to skeletal muscle or cardiac muscle. The composition may further comprise a donor DNA or a transgene. These compositions may be used in genome editing, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases and/or other skeletal or cardiac muscle conditions.
  • The target gene may be involved in differentiation of a cell or any other process in which activation, repression, or disruption of a gene may be desired, or may have a mutation such as a deletion, frameshift mutation, or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, the site-specific nucleases may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon, the aberrant splice acceptor site or the aberrant splice donor site. The site-specific nucleases may also be used to disrupt normal gene splicing by targeting splice acceptors and donors to induce skipping of premature stop codons or restore a disrupted reading frame. The site-specific nucleases may or may not mediate off-target changes to protein-coding regions of the genome.
  • 3. CRISPR SYSTEM
  • “Clustered Regularly Interspaced Short Palindromic Repeats” and “CRISPRs”, as used interchangeably herein refers to loci containing multiple short direct repeats that are found in the genomes of approximately 40% of sequenced bacteria and 90% of sequenced archaea. The CRISPR system is a microbial nuclease system involved in defense against invading phages and plasmids that provides a form of acquired immunity. The CRISPR loci in microbial hosts contain a combination of CRISPR-associated (Cas) genes as well as non-coding RNA elements capable of programming the specificity of the CRISPR-mediated nucleic acid cleavage. Short segments of foreign DNA, called spacers, are incorporated into the genome between CRISPR repeats, and serve as a ‘memory’ of past exposures. Cas9 forms a complex with the 3′ end of the sgRNA, and the protein-RNA pair recognizes its genomic target by complementary base pairing between the 5′ end of the sgRNA sequence and a predefined 20 bp DNA sequence, known as the protospacer. This complex is directed to homologous loci of pathogen DNA via regions encoded within the crRNA, i.e., the protospacers, and protospacer-adjacent motifs (PAMs) within the pathogen genome. The non-coding CRISPR array is transcribed and cleaved within direct repeats into short crRNAs containing individual spacer sequences, which direct Cas nucleases to the target site (protospacer). By simply exchanging the 20 bp recognition sequence of the expressed sgRNA, the Cas9 nuclease can be directed to new genomic targets. CRISPR spacers are used to recognize and silence exogenous genetic elements in a manner analogous to RNAi in eukaryotic organisms.
  • Three classes of CRISPR systems (Types I, II and III effector systems) are known. The Type II effector system carries out targeted DNA double-strand break in four sequential steps, using a single effector enzyme, Cas9, to cleave dsDNA. Compared to the Type I and Type III effector systems, which require multiple distinct effectors acting as a complex, the Type II effector system may function in alternative contexts such as eukaryotic cells. The Type II effector system consists of a long pre-crRNA, which is transcribed from the spacer-containing CRISPR locus, the Cas9 protein, and a tracrRNA, which is involved in pre-crRNA processing. The tracrRNAs hybridize to the repeat regions separating the spacers of the pre-crRNA, thus initiating dsRNA cleavage by endogenous RNase III. This cleavage is followed by a second cleavage event within each spacer by Cas9, producing mature crRNAs that remain associated with the tracrRNA and Cas9, forming a Cas9:crRNA-tracrRNA complex.
  • The Cas9:crRNA-tracrRNA complex unwinds the DNA duplex and searches for sequences matching the crRNA to cleave. Target recognition occurs upon detection of complementarity between a “protospacer” sequence in the target DNA and the remaining spacer sequence in the crRNA. Cas9 mediates cleavage of target DNA if a correct protospacer-adjacent motif (PAM) is also present at the 3′ end of the protospacer. For protospacer targeting, the sequence must be immediately followed by the protospacer-adjacent motif (PAM), a short sequence recognized by the Cas9 nuclease that is required for DNA cleavage. Different Type II systems have differing PAM requirements. The S. pyogenes CRISPR system may have the PAM sequence for this Cas9 (SpCas9) as 5′-NRG-3′, where R is either A or G, and characterized the specificity of this system in human cells. A unique capability of the CRISPR/Cas9 system is the straightforward ability to simultaneously target multiple distinct genomic loci by co-expressing a single Cas9 protein with two or more sgRNAs. For example, the Streptococcuspyogenes Type II system naturally prefers to use an “NGG” sequence, where “N” can be any nucleotide, but also accepts other PAM sequences, such as “NAG” in engineered systems (Hsu et al., Nature Biotechnology (2013) doi:10.1038/nbt.2647). Similarly, the Cas9 derived from Neisseria meningitidis (NmCas9) normally has a native PAM of NNNNGATT, but has activity across a variety of PAMs, including a highly degenerate NNNNGNNN PAM (Esvelt et al. Nature Methods (2013) doi:10.1038/nmeth.2681).
  • 4. CRISPR/CAS9-BASED SYSTEM
  • An engineered form of the Type II effector system of Streptococcuspyogenes was shown to function in human cells for genome engineering. In this system, the Cas9 protein was directed to genomic target sites by a synthetically reconstituted “guide RNA” (“gRNA”, also used interchangeably herein as a chimeric single guide RNA (“sgRNA”)), which is a crRNA-tracrRNA fusion that obviates the need for RNase III and crRNA processing in general (see FIG. 53A). Provided herein are CRISPR/Cas9-based engineered systems for use in genome editing and treating genetic diseases. The CRISPR/Cas9-based engineered systems may be designed to target any gene, including genes involved in a genetic disease, aging, tissue regeneration, or wound healing. The CRISPR/Cas9-based systems may include a Cas9 protein or Cas9 fusion protein and at least one gRNA. The Cas9 fusion protein may, for example, include a domain that has a different activity that what is endogenous to Cas9, such as a transactivation domain.
  • The target gene may be involved in differentiation of a cell or any other process in which activation of a gene may be desired, or may have a mutation such as a frameshift mutation or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, the CRISPR/Cas9-based system may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon, the aberrant splice acceptor site or the aberrant splice donor site. The CRISPR-Cas9-based system may also be used to disrupt normal gene splicing by targeting splice acceptors and donors to induce skipping of premature stop codons or restore a disrupted reading frame. The CRISPR/Cas9-based system may or may not mediate off-target changes to protein-coding regions of the genome.
  • a. Cas9
  • The CRISPR/Cas9-based system may include a Cas9 protein or a Cas9 fusion protein. Cas9 protein is an endonuclease that cleaves nucleic acid and is encoded by the CRISPR loci and is involved in the Type II CRISPR system. The Cas9 protein may be from any bacterial or archaea species, such as Streptococcuspyogenes. The Cas9 protein may be mutated so that the nuclease activity is inactivated. An inactivated Cas9 protein from Streptococcuspyogenes (iCas9, also referred to as “dCas9”) with no endonuclease activity has been recently targeted to genes in bacteria, yeast, and human cells by gRNAs to silence gene expression through steric hindrance. As used herein, “iCas9” and “dCas9” both refer to a Cas9 protein that has the amino acid substitutions D10A and H840A and has its nuclease activity inactivated. For example, the CRISPR/Cas9-based system may include a Cas9 of SEQ ID NO: 459 or 461.
  • b. Cas9 Fusion Protein
  • The CRISPR/Cas9-based system may include a fusion protein. The fusion protein may comprise two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein and the second polypeptide domain has an activity such as transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, or demethylase activity. The fusion protein may include a Cas9 protein or a mutated Cas9 protein, as described above, fused to a second polypeptide domain that has an activity such as transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, nucleic acid association activity, methylase activity, or demethylase activity.
  • (1) Transcription Activation Activity
  • The second polypeptide domain may have transcription activation activity, i.e., a transactivation domain. For example, gene expression of endogenous mammalian genes, such as human genes, may be achieved by targeting a fusion protein of iCas9 and a transactivation domain to mammalian promoters via combinations of gRNAs. The transactivation domain may include a VP16 protein, multiple VP16 proteins, such as a VP48 domain or VP64 domain, or p65 domain of NF kappa B transcription activator activity. For example, the fusion protein may be iCas9-VP64.
  • (2) Transcription Repression Activity
  • The second polypeptide domain may have transcription repression activity. The second polypeptide domain may have a Kruppel associated box activity, such as a KRAB domain, ERF repressor domain activity, Mxi1 repressor domain activity, SID4X repressor domain activity, Mad-SID repressor domain activity or TATA box binding protein activity. For example, the fusion protein may be dCas9-KRAB.
  • (3) Transcription Release Factor Activity
  • The second polypeptide domain may have transcription release factor activity. The second polypeptide domain may have eukaryotic release factor 1 (ERF1) activity or eukaryotic release factor 3 (ERF3) activity.
  • (4) Histone Modification Activity
  • The second polypeptide domain may have histone modification activity. The second polypeptide domain may have histone deacetylase, histone acetyltransferase, histone demethylase, or histone methyltransferase activity. The histone acetyltransferase may be p300 or CREB-binding protein (CBP) protein, or fragments thereof. For example, the fusion protein may be dCas9-p300.
  • (5) Nuclease Activity
  • The second polypeptide domain may have nuclease activity that is different from the nuclease activity of the Cas9 protein. A nuclease, or a protein having nuclease activity, is an enzyme capable of cleaving the phosphodiester bonds between the nucleotide subunits of nucleic acids. Nucleases are usually further divided into endonucleases and exonucleases, although some of the enzymes may fall in both categories. Well known nucleases are deoxyribonuclease and ribonuclease.
  • (6) Nucleic Acid Association Activity
  • The second polypeptide domain may have nucleic acid association activity or nucleic acid binding protein-DNA-binding domain (DBD) is an independently folded protein domain that contains at least one motif that recognizes double- or single-stranded DNA. A DBD can recognize a specific DNA sequence (a recognition sequence) or have a general affinity to DNA. nucleic acid association region selected from the group consisting of helix-turn-helix region, leucine zipper region, winged helix region, winged helix-turn-helix region, helix-loop-helix region, immunoglobulin fold, B3 domain, Zinc finger, HMG-box, Wor3 domain, TAL effector DNA-binding domain.
  • (7) Methylase Activity
  • The second polypeptide domain may have methylase activity, which involves transferring a methyl group to DNA, RNA, protein, small molecule, cytosine or adenine. The second polypeptide domain may include a DNA methyltransferase.
  • (8) Demethylase Activity
  • The second polypeptide domain may have demethylase activity. The second polypeptide domain may include an enzyme that remove methyl (CH3-) groups from nucleic acids, proteins (in particular histones), and other molecules. Alternatively, the second polypeptide may covert the methyl group to hydroxymethylcytosine in a mechanism for demethylating DNA. The second polypeptide may catalyze this reaction. For example, the second polypeptide that catalyzes this reaction may be Tet1.
  • c. gRNA
  • The gRNA provides the targeting of the CRISPR/Cas9-based system. The gRNA is a fusion of two noncoding RNAs: a crRNA and a tracrRNA. The sgRNA may target any desired DNA sequence by exchanging the sequence encoding a 20 bp protospacer which confers targeting specificity through complementary base pairing with the desired DNA target. gRNA mimics the naturally occurring crRNA:tracrRNA duplex involved in the Type II Effector system. This duplex, which may include, for example, a 42-nucleotide crRNA and a 75-nucleotide tracrRNA, acts as a guide for the Cas9 to cleave the target nucleic acid. The “target region”, “target sequence” or “protospacer” as used interchangeably herein refers to the region of the target gene to which the CRISPR/Cas9-based system targets. The CRISPR/Cas9-based system may include at least one gRNA, wherein the gRNAs target different DNA sequences. The target DNA sequences may be overlapping. The target sequence or protospacer is followed by a PAM sequence at the 3′ end of the protospacer. Different Type II systems have differing PAM requirements. For example, the Streptococcus pyogenes Type II system uses an “NGG” sequence, where “N” can be any nucleotide.
  • The number of gRNA administered to the cell may be at least 1 gRNA, at least 2 different gRNA, at least 3 different gRNA at least 4 different gRNA, at least 5 different gRNA, at least 6 different gRNA, at least 7 different gRNA, at least 8 different gRNA, at least 9 different gRNA, at least 10 different gRNAs, at least 11 different gRNAs, at least 12 different gRNAs, at least 13 different gRNAs, at least 14 different gRNAs, at least 15 different gRNAs, at least 16 different gRNAs, at least 17 different gRNAs, at least 18 different gRNAs, at least 18 different gRNAs, at least 20 different gRNAs, at least 25 different gRNAs, at least 30 different gRNAs, at least 35 different gRNAs, at least 40 different gRNAs, at least 45 different gRNAs, or at least 50 different gRNAs. The number of gRNA administered to the cell may be between at least 1 gRNA to at least 50 different gRNAs, at least 1 gRNA to at least 45 different gRNAs, at least 1 gRNA to at least 40 different gRNAs, at least 1 gRNA to at least 35 different gRNAs, at least 1 gRNA to at least 30 different gRNAs, at least 1 gRNA to at least 25 different gRNAs, at least 1 gRNA to at least 20 different gRNAs, at least 1 gRNA to at least 16 different gRNAs, at least 1 gRNA to at least 12 different gRNAs, at least 1 gRNA to at least 8 different gRNAs, at least 1 gRNA to at least 4 different gRNAs, at least 4 gRNAs to at least 50 different gRNAs, at least 4 different gRNAs to at least 45 different gRNAs, at least 4 different gRNAs to at least 40 different gRNAs, at least 4 different gRNAs to at least 35 different gRNAs, at least 4 different gRNAs to at least 30 different gRNAs, at least 4 different gRNAs to at least 25 different gRNAs, at least 4 different gRNAs to at least 20 different gRNAs, at least 4 different gRNAs to at least 16 different gRNAs, at least 4 different gRNAs to at least 12 different gRNAs, at least 4 different gRNAs to at least 8 different gRNAs, at least 8 different gRNAs to at least 50 different gRNAs, at least 8 different gRNAs to at least 45 different gRNAs, at least 8 different gRNAs to at least 40 different gRNAs, at least 8 different gRNAs to at least 35 different gRNAs, 8 different gRNAs to at least 30 different gRNAs, at least 8 different gRNAs to at least 25 different gRNAs, 8 different gRNAs to at least 20 different gRNAs, at least 8 different gRNAs to at least 16 different gRNAs, or 8 different gRNAs to at least 12 different gRNAs.
  • The gRNA may comprise a complementary polynucleotide sequence of the target DNA sequence followed by a PAM sequence. The gRNA may comprise a “G” at the 5′ end of the complementary polynucleotide sequence. The gRNA may comprise at least a 10 base pair, at least a 11 base pair, at least a 12 base pair, at least a 13 base pair, at least a 14 base pair, at least a 15 base pair, at least a 16 base pair, at least a 17 base pair, at least a 18 base pair, at least a 19 base pair, at least a 20 base pair, at least a 21 base pair, at least a 22 base pair, at least a 23 base pair, at least a 24 base pair, at least a 25 base pair, at least a 30 base pair, or at least a 35 base pair complementary polynucleotide sequence of the target DNA sequence followed by a PAM sequence. The PAM sequence may be “NGG”, where “N” can be any nucleotide. The gRNA may target at least one of the promoter region, the enhancer region or the transcribed region of the target gene. The gRNA may include a nucleic acid sequence of at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, 585-625, 462 (FIG. 40), 464 (FIG. 41), and 465 (FIG. 41).
  • The gRNA may target any nucleic acid sequence. The nucleic acid sequence target may be DNA. The DNA may be any gene. For example, the gRNA may target a gene, such as BRN2, MYT1L, ASCL1, NANOG, VEGFA, TERT, IL1B, IL1R2, IL1RN, HBG1, HBG2, MYOD1, OCT4, and DMD.
  • (1) Dystrophin
  • Dystrophin is a rod-shaped cytoplasmic protein which is a part of a protein complex that connects the cytoskeleton of a muscle fiber to the surrounding extracellular matrix through the cell membrane. Dystrophin provides structural stability to the dystroglycan complex of the cell membrane. The dystrophin gene is 2.2 megabases at locus Xp21. The primary transcription measures about 2,400 kb with the mature mRNA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids. Normal skeleton muscle tissue contains only small amounts of dystrophin but its absence of abnormal expression leads to the development of severe and incurable symptoms. Some mutations in the dystrophin gene lead to the production of defective dystrophin and severe dystrophic phenotype in affected patients. Some mutations in the dystrophin gene lead to partially-functional dystrophin protein and a much milder dystrophic phenotype in affected patients.
  • DMD is the result of inherited or spontaneous mutations that cause nonsense or frame shift mutations in the dystrophin gene. Naturally occurring mutations and their consequences are relatively well understood for DMD. It is known that in-frame deletions that occur in the exon 45-55 region contained within the rod domain can produce highly functional dystrophin proteins, and many carriers are asymptomatic or display mild symptoms. Furthermore, more than 60% of patients may theoretically be treated by targeting exons in this region of the dystrophin gene. Efforts have been made to restore the disrupted dystrophin reading frame in DMD patients by skipping non-essential exons during mRNA splicing to produce internally deleted but functional dystrophin proteins. The deletion of internal dystrophin exons retain the proper reading frame but cause the less severe Becker muscular dystrophy.
  • (2) CRISPR/Cas9-Based System for Targeting Dystrophin
  • A CRISPR/Cas9-based system specific for dystrophin gene are disclosed herein. The CRISPR/Cas9-based system may include Cas9 and at least one gRNA to target the dystrophin gene. The CRISPR/Cas9-based system may bind and recognize a target region. The target regions may be chosen immediately upstream of possible out-of-frame stop codons such that insertions or deletions during the repair process restore the dystrophin reading frame by frame conversion. Target regions may also be splice acceptor sites or splice donor sites, such that insertions or deletions during the repair process disrupt splicing and restore the dystrophin reading frame by splice site disruption and exon exclusion. Target regions may also be aberrant stop codons such that insertions or deletions during the repair process restore the dystrophin reading frame by eliminating or disrupting the stop codon.
  • Single or multiplexed sgRNAs may be designed to restore the dystrophin reading frame by targeting the mutational hotspot at exons 45-55 and introducing either intraexonic small insertions and deletions, or large deletions of one or more exons. Following treatment with Cas9 and one or more sgRNAs, dystrophin expression may be restored in Duchenne patient muscle cells in vitro. Human dystrophin was detected in vivo following transplantation of genetically corrected patient cells into immunodeficient mice. Significantly, the unique multiplex gene editing capabilities of the CRISPR/Cas9 system enable efficiently generating large deletions of this mutational hotspot region that can correct up to 62% of patient mutations by universal or patient-specific gene editing approaches.
  • The CRISPR/Cas9-based system may use gRNA of varying sequences and lengths. Examples of gRNAs may be found in Table 6. The CRISPR/Cas9-based system may target a nucleic acid sequence of SEQ ID NOs: 65-144, or a complement thereof. The gRNA may include a nucleotide sequence selected from the group consisting of SEQ ID NO: 65-144, or a complement thereof. For example, the disclosed CRISPR/Cas9-based systems were engineered to mediate highly efficient gene editing at exon 51 of the dystrophin gene. These CRISPR/Cas9-based systems restored dystrophin protein expression in cells from DMD patients.
  • (a) Exons 51 and 45-55
  • Exon 51 is frequently adjacent to frame-disrupting deletions in DMD. Elimination of exon 51 from the dystrophin transcript by exon skipping can be used to treat approximately 15% of all DMD patients. This class of DMD mutations is ideally suited for permanent correction by NIEJ-based genome editing and HDR. The CRISPR/Cas9-based systems described herein have been developed for targeted modification of exon 51 in the human dystrophin gene. These CRISPR/Cas9-based systems were transfected into human DMD cells and mediated efficient gene modification and conversion to the correct reading frame. Protein restoration was concomitant with frame restoration and detected in a bulk population of CRISPR/Cas9-based system-treated cells. Similarly, the elimination of exons 45-55 of the dystrophin transcript can be used to treat approximately 62% of all DMD patients.
  • (3) AAV/CRISPR Constructs
  • AAV may be used to deliver CRISPRs using various construct configurations (see FIG. 39). For example, AAV may deliver Cas9 and gRNA expression cassettes on separate vectors. Alternatively, if the small Cas9 proteins, derived from species such as Staphylococcus aureus or Neisseria meningitidis, are used then both the Cas9 and up to two gRNA expression cassettes may be combined in a single AAV vector within the 4.7 kb packaging limit (see FIG. 39).
  • 5. MULTIPLEX CRISPR/CAS9-BASED SYSTEM
  • The present disclosure is directed to a multiplex CRISPR/Cas9-Based System which includes a CRISPR/CRISPR-associated (Cas) 9-based system, such as Cas9 or dCas9, and multiple gRNAs to target one or more endogenous genes. This platform utilizes a convenient Golden Gate cloning method to rapidly incorporate up to four independent sgRNA expression cassettes into a single lentiviral vector. Each sgRNA was efficiently expressed and could mediate multiplex gene editing at diverse loci in immortalized and primary human cell lines. Transient transcriptional activation in cell lines stably expressing dCas9-VP64 was demonstrated to be tunable by synergistic activation with one to four sgRNAs. Furthermore, the single lentiviral vector can induce sustained and long-term endogenous gene expression in immortalized and primary human cells. This system allows for rapid assembly of a single lentiviral vector that enables efficient multiplex gene editing or activation in model and primary cell lines.
  • The multiplex CRISPR/Cas9-Based System provides potency of transcriptional activation and tunable induction of transcriptional activation. Readily generated by Golden Gate assembly, the final vector expresses a constitutive Cas9 or dCas9-VP64 in addition to one, two, three, or four sgRNAs expressed from independent promoters. Each promoter is capable of efficiently expressing sgRNAs that direct similar levels of Cas9 nuclease activity. Furthermore, lentiviral delivery of a single vector expressing Cas9 and four sgRNAs targeting independent loci resulted in simultaneous multiplex gene editing of all four loci. Tunable transcriptional activation at two endogenous genes in both transient and stable contexts was achieved using lentiviral delivery of Cas9 with or without sgRNAs. Highly efficient and long-term gene activation in primary human cells is accomplished. This system is therefore an attractive and efficient method to generate multiplex gene editing and long-term transcriptional activation in human cells.
  • The multiplex CRISPR/Cas9-Based System allows efficient multiplex gene editing for simultaneously inactivating multiple genes. The CRISPR/Cas9 system can simultaneously target multiple distinct genomic loci by co-expressing a single Cas9 protein with two or more sgRNAs, making this system uniquely suited for multiplex gene editing or synergistic activation applications. The CRISPR/Cas9 system greatly expedites the process of molecular targeting to new sites by simply modifying the expressed sgRNA molecule. The single lentiviral vector may be combined with methods for achieving inducible control of these components, either by chemical or optogenetic regulation, to facilitate investigation of the dynamics of gene regulation in both time and space.
  • The multiplex CRISPR/Cas9-based systems may transcriptionally activate two or more endogenous genes. The multiplex CRISPR/Cas9-based systems may transcriptionally repress two or more endogenous genes. For example, at least two endogenous genes, at least three endogenous genes, at least four endogenous genes, at least five endogenous genes, or at least ten endogenous genes may be activated or repressed by the multiplex CRISPR/Cas9-based system. Between two and fifteen genes, between two and ten genes, between two and five genes, between five and fifteen genes, or between five and ten genes may be activated or repressed by the multiplex CRISPR/Cas9-based system.
  • (1) Modified Lentiviral Vector
  • The multiplex CRISPR/Cas9-based system includes a modified lentiviral vector. The modified lentiviral vector includes a first polynucleotide sequence encoding a fusion protein and a second polynucleotide sequence encoding at least one sgRNA. The fusion protein may be the fusion protein of the CRISPR/Cas9-based system, as described above. The first polynucleotide sequence may be operably linked to a promoter. The promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter.
  • The second polynucleotide sequence encodes at least 1 sgRNA. For example, the second polynucleotide sequence may encode at least 1 sgRNA, at least 2 sgRNAs, at least 3 sgRNAs, at least 4 sgRNAs, at least 5 sgRNAs, at least 6 sgRNAs, at least 7 sgRNAs, at least 8 sgRNAs, at least 9 sgRNAs, at least 10 sgRNAs, at least 11 sgRNA, at least 12 sgRNAs, at least 13 sgRNAs, at least 14 sgRNAs, at least 15 sgRNAs, at least 16 sgRNAs, at least 17 sgRNAs, at least 18 sgRNAs, at least 19 sgRNAs, at least 20 sgRNAs, at least 25 sgRNA, at least 30 sgRNAs, at least 35 sgRNAs, at least 40 sgRNAs, at least 45 sgRNAs, or at least 50 sgRNAs. The second polynucleotide sequence may encode between 1 sgRNA and 50 sgRNAs, between 1 sgRNA and 45 sgRNAs, between 1 sgRNA and 40 sgRNAs, between 1 sgRNA and 35 sgRNAs, between 1 sgRNA and 30 sgRNAs, between 1 sgRNA and 25 different sgRNAs, between 1 sgRNA and 20 sgRNAs, between 1 sgRNA and 16 sgRNAs, between 1 sgRNA and 8 different sgRNAs, between 4 different sgRNAs and 50 different sgRNAs, between 4 different sgRNAs and 45 different sgRNAs, between 4 different sgRNAs and 40 different sgRNAs, between 4 different sgRNAs and 35 different sgRNAs, between 4 different sgRNAs and 30 different sgRNAs, between 4 different sgRNAs and 25 different sgRNAs, between 4 different sgRNAs and 20 different sgRNAs, between 4 different sgRNAs and 16 different sgRNAs, between 4 different sgRNAs and 8 different sgRNAs, between 8 different sgRNAs and 50 different sgRNAs, between 8 different sgRNAs and 45 different sgRNAs, between 8 different sgRNAs and 40 different sgRNAs, between 8 different sgRNAs and 35 different sgRNAs, between 8 different sgRNAs and 30 different sgRNAs, between 8 different sgRNAs and 25 different sgRNAs, between 8 different sgRNAs and 20 different sgRNAs, between 8 different sgRNAs and 16 different sgRNAs, between 16 different sgRNAs and 50 different sgRNAs, between 16 different sgRNAs and 45 different sgRNAs, between 16 different sgRNAs and 40 different sgRNAs, between 16 different sgRNAs and 35 different sgRNAs, between 16 different sgRNAs and 30 different sgRNAs, between 16 different sgRNAs and 25 different sgRNAs, or between 16 different sgRNAs and 20 different sgRNAs. Each of the polynucleotide sequences encoding the different sgRNAs may be operably linked to a promoter. The promoters that are operably linked to the different sgRNAs may be the same promoter. The promoters that are operably linked to the different sgRNAs may be different promoters. The promoter may be a constitutive promoter, an inducible promoter, a repressible promoter, or a regulatable promoter.
  • The at least one sgRNA may bind to a target gene or loci. If more than one sgRNA is included, each of the sgRNAs binds to a different target region within one target loci or each of the sgRNA binds to a different target region within different gene loci. The fusion protein may include Cas9 protein or iCas9-VP64 protein. The fusion protein may include a VP64 domain, a p300 domain, or a KRAB domain.
  • 6. SITE-SPECIFIC NUCLEASES
  • The composition, as described above, includes a nucleotide sequence encoding a site-specific nuclease that binds and cleaves a target region. The site-specific nuclease may be engineered. For example, an engineered site-specific nuclease may be a CRISPR/Cas9-based system, a ZFN, or a TALEN. The site-specific nuclease may bind and cleave a gene or locus in the genome of a cell in the skeletal muscle or cardiac muscle. For example, the gene or locus may be the Rosa26 locus or the dystrophin gene.
  • a. CRISPR/Cas9-based system
  • The CRISPR/Cas9-based system, as described above, may be used to introduce site-specific double strand breaks at targeted genomic loci.
  • b. Zinc Finger Nucleases (ZFN)
  • The site-specific nuclease may be a ZFN. A single zinc finger contains approximately 30 amino acids and the domain functions by binding 3 consecutive base pairs of DNA via interactions of a single amino acid side chain per base pair. The modular structure of the zinc finger motif permits the conjunction of several domains in series, allowing for the recognition and targeting of extended sequences in multiples of 3 nucleotides. These targeted DNA-binding domains can be combined with a nuclease domain, such as FokI, to generate a site-specific nuclease, called a“zinc finger nuclease” (ZFNs) that can be used to introduce site-specific double strand breaks at targeted genomic loci. This DNA cleavage stimulates the natural DNA-repair machinery, leading to one of two possible repair pathways, NTEJ andHFIDR. For example, the ZFN may target the Rosa26 locus (Perez-Pinera et al. Nucleic Acids Research (2012) 40:3741-3752) or a dystrophin gene. Examples of ZFNs are shown in Table 1and FIGS. 35-38. In Table 1, the DNA recognition helices are underlined and “Fok ELD-S” and “Fok KKR-S” refers to the FokI nuclease domain that is fused to the zinc finger protein DNA-binding domains. In FIGS. 35-38, the target DNA sequence in the target sites (i.e., in SEQ ID NOs: 442, 445, 448, and 453) and the DNA recognition helices in the ZFN amino acid sequences (i.e., in SEQ ID NOs: 443, 444, 446, 447, 449-452, 454, and 455) are underlined, respectively.
  • TABLE 1
    Full amino acid sequences of identified ZFNs.
    ZFN B left Fok ELD-S full amino acid sequence
    (SEQ ID NO: 438)
    MDYKDHDGDYKDHDIDYKDDDDKMAPKKKRKVGRLEPGEKPYKCPECGK
    SFSRKDALRGHQRTHTGEKPYKCPECGKSFSHRTTLTNHQRTHTGEKPY
    KCPECGKSFSQRNALAGHQRTHTGEKPYKCPECGKSFSHKNALQNHQRT
    HTGEKPYKCPECGKSFSDPGHLVRHQRTHTGEKPYKCPECGKSFSTSGN
    LVRHQRTHTGAAARALVKSELEEKKSELRHKLKYVPHEYIELIEIARNP
    TQDRILEMKVMEFFMKVYGYRGEHLGGSRKPDGAIYTVGSPIDYGVIVD
    TKAYSGGYNLPIGQADEMERYVEENQTRDKHLNPNEWWKVYPSSVTEFK
    FLFVSGHFKGNYKAQLTRLNHITNCNGAVLSVEELLIGGEMIKAGTLTL
    EEVRRKFNNGEINF*
    ZFN B right Fok KKR-S full amino acid sequence
    (SEQ ID NO: 439)
    MDYKDHDGDYKDHDIDYKDDDDKMAPKKKRKVGRLEPGEKPYKCPECGK
    SFSQQRSLVGHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPY
    KCPECGKSFSTSGHLVRHQRTHTGEKPYKCPECGKSFSQRAHLERHQRT
    HTGEKPYKCPECGKSFSTSGSLVRHQRTHTGEKPYKCPECGKSFSTSGN
    LVRHQRTHTGAAARALVKSELEEKKSELRHKLKYVPHEYIELIEIARNP
    TQDRILEMKVMEFFMKVYGYRGEHLGGSRKPDGAIYTVGSPIDYGVIVD
    TKAYSGGYNLPIGQADEMQRYVKENQTRNKHINPNEWWKVYPSSVTEFK
    FLFVSGHFKGNYKAQLTRLNRKTNCNGAVLSVEELLIGGEMIKAGTLTL
    EEVRRKFNNGEINF*
    ZFN J left Fok KKR-S full amino acid sequence
    (SEQ ID NO: 440)
    MDYKDHDGDYKDHDIDYKDDDDKMAPKKKRKVGRLEPGERPFQCRICMR
    NFSSKQALAVHTRTHTGEKPFQCRICMRNFSQSTTLKRHLRTHTGEKPF
    QCRICMRNFSRSDHLSLHLKTHLRGSQLVKSELEEKKSELRHKLKYVPH
    EYIELIEIARNPTQDRILEMKVMEFFMKVYGYRGEHLGGSRKPDGAIYT
    VGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVKENQTRNKHINPNEW
    WKVYPSSVTEFKFLFVSGHFKGNYKAQLTRLNRKTNCNGAVLSVEELLI
    GGEMIKAGTLTLEEVRRKFNNGEINF*
    ZFN J right Fok ELD-S full amino acid sequence
    (SEQ ID NO: 441)
    MDYKDHDGDYKDHDIDYKDDDDKMAPKKKRKVGRLEPGERPEQCRICMR
    NESRRAHLQNHTRTHTGEKPEQCRICMRNESQSTTLKRHLRTHTGEKPE
    QCRICMRNESDGGHLTRHLKTHLRGSQLVKSELEEKKSELRHKLKYVPH
    EYIELIETARNPTQDRILEMKVMEFFMKVYGYRGEHLGGSRKPDGAIYT
    VGSPIDYGVIVDTKAYSGGYNLPIGQADEMERYVEENQTRDKHLNPNEW
    WKVYPSSVTEFKFLFVSGHEKGNYKAQLTRLNHITNCNGAVLSVEELLI
    GGEMIKAGTLTLEEVRRKFNNGEINF*
  • c. TAL Effector Nucleases (TALENs)
  • TALENs may be used to introduce site-specific double strand breaks at targeted genomic loci. Site-specific double-strand breaks are created when two independent TALENs bind to nearby DNA sequences, thereby permitting dimerization of FokI and cleavage of the target DNA. TALENs have advanced genome editing due to their high rate of successful and efficient genetic modification. This DNA cleavage may stimulate the natural DNA-repair machinery, leading to one of two possible repair pathways: homology-directed repair (HDR) or the non-homologous end joining (NHEJ) pathway. The TALENs may be designed to target any gene involved in a genetic disease.
  • The TALENs may include a nuclease and a TALE DNA-binding domain that binds to the target gene in a TALEN target region. The target gene may have a mutation such as a frameshift mutation or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, the TALEN may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon. A “TALEN target region” includes the binding regions for two TALENs and the spacer region, which occurs between the binding regions. The two TALENs bind to different binding regions within the TALEN target region, after which the TALEN target region is cleaved. Examples of TALENs are described in International Patent Application No. PCT/US2013/038536, which is incorporated by reference in its entirety.
  • 7. TRANSCRIPTIONAL ACTIVATORS
  • The composition, as described above, includes a nucleotide sequence encoding a transcriptional activator that activates a target gene. The transcriptional activator may be engineered. For example, an engineered transcriptional activator may be a CRISPR/Cas9-based system, a zinc finger fusion protein, or a TALE fusion protein.
  • a. CRISPR/Cas9-Based System
  • The CRISPR/Cas9-based system, as described above, may be used to activate transcription of a target gene with RNA. The CRISPR/Cas9-based system may include a fusion protein, as described above, wherein the second polypeptide domain has transcription activation activity or histone modification activity. For example, the second polypeptide domain may include VP64 or p300.
  • b. Zinc Finger Fusion Proteins
  • The transcriptional activator may be a zinc finger fusion protein. The zinc finger targeted DNA-binding domains, as described above, can be combined with a domain that has transcription activation activity or histone modification activity. For example, the domain may include VP64 or p300.
  • c. TALE Fusion Proteins
  • TALE fusion proteins may be used to activate transcription of a target gene. The TALE fusion protein may include a TALE DNA-binding domain and a domain that has transcription activation activity or histone modification activity. For example, the domain may include VP64 or p300.
  • 8. COMPOSITIONS
  • The present invention is directed to a composition for altering gene expression and engineering or altering genomic DNA in a cell or subject. The composition may also include a viral delivery system.
  • a. Compositions for Genome Editing in Muscle
  • The present invention is directed to a composition for genome editing a target gene in skeletal muscle or cardiac muscle of a subject. The composition includes a modified AAV vector and a nucleotide sequence encoding a site-specific nuclease. The composition delivers active forms of site-specific nucleases to skeletal muscle or cardiac muscle. The composition may further comprise a donor DNA or a transgene. These compositions may be used in genome editing, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases and/or other skeletal or cardiac muscle conditions.
  • The target gene may be involved in differentiation of a cell or any other process in which activation, repression, or disruption of a gene may be desired, or may have a mutation such as a deletion, frameshift mutation, or a nonsense mutation. If the target gene has a mutation that causes a premature stop codon, an aberrant splice acceptor site or an aberrant splice donor site, the site-specific nucleases may be designed to recognize and bind a nucleotide sequence upstream or downstream from the premature stop codon, the aberrant splice acceptor site or the aberrant splice donor site. The site-specific nucleases may also be used to disrupt normal gene splicing by targeting splice acceptors and donors to induce skipping of premature stop codons or restore a disrupted reading frame. The site-specific nucleases may or may not mediate off-target changes to protein-coding regions of the genome.
  • b. Adeno-Associated Virus Vectors
  • The composition, as described above, includes a modified adeno-associated virus (AAV) vector. The modified AAV vector may have enhanced cardiac and skeletal muscle tissue tropism. The modified AAV vector may be capable of delivering and expressing the site-specific nuclease in the cell of a mammal. For example, the modified AAV vector may be an AAV-SASTG vector (Piacentino et al. (2012) Human Gene Therapy 23:635-646). The modified AAV vector may deliver nucleases to skeletal and cardiac muscle in vivo. The modified AAV vector may be based on one or more of several capsid types, including AAV1, AAV2, AAV5, AAV6, AAV8, and AAV9. The modified AAV vector may be based on AAV2 pseudotype with alternative muscle-tropic AAV capsids, such as AAV2/1, AAV2/6, AAV2/7, AAV2/8, AAV2/9, AAV2.5 and AAV/SASTG vectors that efficiently transduce skeletal muscle or cardiac muscle by systemic and local delivery (Seto et al. Current Gene Therapy (2012) 12:139-151).
  • c. CRISPR/Cas9-Based System
  • The present disclosure also provides DNA targeting systems or compositions of at least one CRISPR/Cas9-based system, as described above. These compositions may be used in genome editing, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases. The composition includes a CRISPR/Cas9-based system that includes a Cas9 protein or Cas9 fusion protein, as described above. The CRISPR/Cas9-based system may also include at least one gRNA, as described above.
  • d. Multiplex CRISPR/Cas9-Based System
  • The present disclosure also provides multiplex CRISPR/Cas9-based systems, as described above. These compositions may be used in genome editing, genome engineering, and correcting or reducing the effects of mutations in genes involved in genetic diseases. These compositions may be used to target more than one gene. The composition includes a modified lentiviral vector comprising a CRISPR/Cas9-based system that includes a Cas9 protein or Cas9 fusion protein, as described above and more than one gRNA, as described above.
  • 9. METHODS OF USES
  • Potential applications of the compositions are diverse across many areas of science and biotechnology. The disclosed compositions may be used to repair genetic mutations that cause disease. The disclosed compositions may be used to disrupt genes such that gene disruption leads to increases in muscle regeneration or muscle strength, or decreases in muscle aging. The disclosed compositions may be used to introduce therapeutic genes to be expressed systemically from skeletal muscle or cardiac muscle, such as clotting factors or monoclonal antibodies. The disclosed compositions may be used to modulate mammalian gene expression. The disclosed compositions may be used to transdifferentiate or induce the differentiation of a cell or correct a mutant gene in a cell. Examples of activation of genes related to cell and gene therapy, genetic reprogramming, and regenerative medicine are provided. RNA-guided transcriptional activators may be used to reprogram cell lineage specification. Activation of endogenous genes encoding the key regulators of cell fate, rather than forced overexpression of these factors, may potentially lead to more rapid, efficient, stable, or specific methods for genetic reprogramming, transdifferentiation, and/or induced differentiation.
  • 10. METHODS OF GENOME EDITING IN MUSCLE
  • The present disclosure is directed to a method of genome editing in a skeletal muscle or cardiac muscle of a subject. The method comprises administering to the skeletal muscle or cardiac muscle of the subject the composition for genome editing in skeletal muscle or cardiac muscle, as described above. The genome editing may include correcting a mutant gene or inserting a transgene. Correcting the mutant gene may include deleting, rearranging, or replacing the mutant gene. Correcting the mutant gene may include nuclease-mediated NHEJ or HDR.
  • 11. METHODS OF USING CRISPR/CAS9-BASED SYSTEM
  • Potential applications of the CRISPR/Cas9-based system are diverse across many areas of science and biotechnology. The disclosed CRISPR/Cas9-based systems may be used to modulate mammalian gene expression. The disclosed CRISPR/Cas9-based systems may be used to transdifferentiate or induce differentiation of a cell or correct a mutant gene in a cell. Examples of activation of genes related to cell and gene therapy, genetic reprogramming, and regenerative medicine are provided. RNA-guided transcriptional activators may be used to reprogram cell lineage specification. Although reprogramming was incomplete and inefficient in these experiments, there are many ways by which this method could be improved, including repeated transfections of iCas9-VP64/gRNA combinations, stable expression of these factors, and targeting multiple genes, such as Brn2 and Mytl1 in addition to Ascl1 for transdifferentiation into a neuronal phenotype. Activation of endogenous genes encoding the key regulators of cell fate, rather than forced overexpression of these factors, may potentially lead to more rapid, efficient, stable, or specific methods for genetic reprogramming and transdifferentiation or induced differentiation of a cell. Finally, Cas9 fusions to other domains, including repressive and epigenetic-modifying domains, could provide a greater diversity of RNA-guided transcriptional regulators to complement other RNA-based tools for mammalian cell engineering.
  • a. Methods of Activating Gene Expression
  • The present disclosure provides a mechanism for activating the expression of endogenous genes, such as mammalian genes, based on targeting a transcriptional activator to promoters via RNA using a CRISPR/Cas9 based system, as described above. This is fundamentally different from previously described methods based on engineering sequence-specific DNA-binding proteins and may provide opportunities for targeted gene regulation. Because the generation of gRNA expression plasmids simply involves synthesizing two short custom oligonucleotides and one cloning step, it is possible to generate many new gene activators quickly and economically. The gRNAs can also be transfected directly to cells following in vitro transcription. Multiple gRNAs targeted to single promoters were shown, but simultaneous targeting of multiple promoters could also be possible. Recognition of genomic target sites with RNAs, rather than proteins, may also circumvent limitations of targeting epigenetically modified sites, such as methylated DNA.
  • In contrast to current methods based on engineering DNA-binding proteins, Cas9 fused to a transcriptional activation domain can be targeted by combinations of guide RNA molecules to induce the expression of endogenous human genes. This straightforward and versatile approach for targeted gene activation circumvents the need for engineering new proteins and allows for widespread synthetic gene regulation.
  • The method may include administering to a cell or subject a CRISPR/Cas9-based system, a polynucleotide or vector encoding said CRISPR/Cas9-based system, or DNA targeting systems or compositions of at least one CRISPR/Cas9-based system, as described above. The method may include administering a CRISPR/Cas9-based system, such as administering a Cas9 fusion protein containing transcription activation domain or a nucleotide sequence encoding said Cas9 fusion protein. The Cas9 fusion protein may include a transcription activation domain such as aVP16 protein or a transcription co-activator such as a p300 protein.
  • (1) dCas9-VP16
  • The Cas9 fusion protein may include a transcription activation domain such as aVP16 protein. The transcription activation domain may contain at least 1 VP16 protein, at least 2 VP16 proteins, at least 3 VP16 proteins, at least 4 VP16 proteins (i.e., a VP64 activator domain), at least 5 VP16 proteins, at least 6 VP16 proteins, at least 6 VP16 proteins, or at least 10 VP16 proteins. The Cas9 protein may be a Cas9 protein in which the nuclease activity is inactivated. For example, the Cas9 protein in the fusion protein may be iCas9 (amino acids 36-1403 of SEQ ID NO: 1), which includes the amino acid substitutions of D10A and H840A. The Cas9 fusion protein may be iCas9-VP64.
  • (2) dCas9-p300
  • The Cas9 fusion protein may include a transcription co-activation domain such as a p300 protein. The p300 protein (also known as EP300 or E1A binding protein p300) is encoded by the EP300 gene and regulates the activity of many genes in tissues throughout the body. The p300 protein plays a role in regulating cell growth and division, prompting cells to mature and assume specialized functions (differentiate) and preventing the growth of cancerous tumors. The p300 protein activates transcription by connecting transcription factors with a complex of proteins that carry out transcription in the cell's nucleus. The p300 interaction with transcription factors is managed by one or more of p300 domains: the nuclear receptor interaction domain (RID), the CREB and MYB interaction domain (KIX), the cysteine/histidine regions (TAZ1/CH and TAZ2/CH3) and the interferon response binding domain (IBiD). The last four domains, KIX, TAZ1, TAZ2 and IBiD of p300, each bind tightly to a sequence spanning both transactivation domains 9aaTADs of transcription factor p53. The protein functions as histone acetyltransferase that regulates transcription via chromatin remodeling, and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein.
  • The p300 protein may activate Mothers against decapentaplegic homolog 7, MAF, TSG101, Peroxisome proliferator-activated receptor alpha, NPAS2, PAX6, DDX5, MYBL2, Mothers against decapentaplegic homolog 1, Mothers against decapentaplegic homolog 2, Lymphoid enhancer-binding factor 1, SNIP1, TRERF1, STAT3, EID1, RAR-related orphan receptor alpha, ELK1, HIF1A, ING5, Peroxisome proliferator-activated receptor gamma, SS18, TCF3, Zif268, Estrogen receptor alpha, GPS2, MyoD, YY1, ING4, PROX1, CITED1, HNF1A, MEF2C, MEF2D, MAML1, Twist transcription factor, PTMA, IRF2, DTX1, Flap structure-specific endonuclease 1, Myocyte-specific enhancer factor 2A, CDX2, BRCA1, HNRPU, STAT6, CITED2, RELA, TGS1, CEBPB, Mdm2, NCOA6, NFATC2, Thyroid hormone receptor alpha, BCL3, TFAP2A, PCNA, P53 and TAL1.
  • The transcription co-activation domain may include a human p300 protein or a fragment thereof. The transcription co-activation domain may include a wild-type human p300 protein or a mutant human p300 protein, or fragments thereof. The transcription co-activation domain may include the core lysine-acetyltranserase domain of the human p300 protein, i.e., the p300 HAT Core (also known as “p300 WT Core”; see FIG. 58). The Cas9 protein may be a Cas9 protein in which the nuclease activity is inactivated. For example, the Cas9 protein in the fusion protein may be iCas9 (amino acids 36-1403 of SEQ ID NO: 1), which includes the amino acid substitutions of D10A and H840A. The Cas9 fusion protein may be iCas9-p300 WT Core.
  • (3) gRNA
  • The method may also include administering to a cell or subject a CRISPR/Cas9-based system at least one gRNA, wherein the gRNAs target different DNA sequences. The target DNA sequences may be overlapping. The number of gRNA administered to the cell may be at least 1 gRNA, at least 2 different gRNAs, at least 3 different gRNAs at least 4 different gRNAs, at least 5 different gRNAs, at least 6 different gRNAs, at least 7 different gRNAs, at least 8 different gRNAs, at least 9 different gRNAs, at least 10 different gRNAs, at least 11 different gRNAs, at least 12 different gRNAs, at least 13 different gRNAs, at least 14 different gRNAs, at least 15 different gRNAs, at least 16 different gRNAs, at least 17 different gRNAs, at least 18 different gRNAs, at least 18 different gRNAs, at least 20 different gRNAs, at least 25 different gRNAs, at least 30 different gRNAs, at least 35 different gRNAs, at least 40 different gRNAs, at least 45 different gRNAs, or at least 50 different gRNAs. The number of gRNA administered to the cell may be between at least 1 gRNA to at least 50 different gRNAs, at least 1 gRNA to at least 45 different gRNAs, at least 1 gRNA to at least 40 different gRNAs, at least 1 gRNA to at least 35 different gRNAs, at least 1 gRNA to at least 30 different gRNAs, at least 1 gRNA to at least 25 different gRNAs, at least 1 gRNA to at least 20 different gRNAs, at least 1 gRNA to at least 16 different gRNAs, at least 1 gRNA to at least 12 different gRNAs, at least 1 gRNA to at least 8 different gRNAs, at least 1 gRNA to at least 4 different gRNAs, at least 4 gRNAs to at least 50 different gRNAs, at least 4 different gRNAs to at least 45 different gRNAs, at least 4 different gRNAs to at least 40 different gRNAs, at least 4 different gRNAs to at least 35 different gRNAs, at least 4 different gRNAs to at least 30 different gRNAs, at least 4 different gRNAs to at least 25 different gRNAs, at least 4 different gRNAs to at least 20 different gRNAs, at least 4 different gRNAs to at least 16 different gRNAs, at least 4 different gRNAs to at least 12 different gRNAs, at least 4 different gRNAs to at least 8 different gRNAs, at least 8 different gRNAs to at least 50 different gRNAs, at least 8 different gRNAs to at least 45 different gRNAs, at least 8 different gRNAs to at least 40 different gRNAs, at least 8 different gRNAs to at least 35 different gRNAs, 8 different gRNAs to at least 30 different gRNAs, at least 8 different gRNAs to at least 25 different gRNAs, 8 different gRNAs to at least 20 different gRNAs, at least 8 different gRNAs to at least 16 different gRNAs, 8 different gRNAs to at least 12 different gRNAs, at least 8 different gRNAs to at least 8 different gRNAs,
  • The gRNA may comprise a complementary polynucleotide sequence of the target DNA sequence followed by NGG. The gRNA may comprise a “G” at the 5′ end of the complementary polynucleotide sequence. The gRNA may comprise at least a 10 base pair, at least a 11 base pair, at least a 12 base pair, at least a 13 base pair, at least a 14 base pair, at least a 15 base pair, at least a 16 base pair, at least a 17 base pair, at least a 18 base pair, at least a 19 base pair, at least a 20 base pair, at least a 21 base pair, at least a 22 base pair, at least a 23 base pair, at least a 24 base pair, at least a 25 base pair, at least a 30 base pair, or at least a 35 base pair complementary polynucleotide sequence of the target DNA sequence followed by NGG. The gRNA may target at least one of the promoter region, the enhancer region or the transcribed region of the target gene. The gRNA may include a nucleic acid sequence of at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • b. Methods of Repressing Gene Expression
  • The present disclosure provides a mechanism for repressing the expression of endogenous genes, such as mammalian genes, based on targeting genomic regulatory elements, such as distal enhancers, via RNA using a CRISPR/Cas9 based system, as described above. The Cas9 fusion protein may include a transcriptional repressor, such as the KRAB repressor. The Cas9 fusion protein may be dCas9-KRAB. The dCas9-KRAB may additionally affect epigenetic gene regulation by recruiting heterochromatin-forming factors to the targeted locus. The CRISPR/dCas9-KRAB system may be used to repress the transcription of genes, but can also be used to target genomic regulatory elements which were previously inaccessible by traditional repression methods such as RNA interference (FIG. 53B). Delivering dCas9-KRAB with gRNAs targeted to a distal enhancer may disrupt expression of multiple genes regulated by the targeted enhancer (see FIG. 53C). The targeted enhancer may be any enhancer for a gene such as the HS2 enhancer.
  • a. Methods of Transdifferentiation or Induced Differentiation
  • The present disclosure provides a mechanism for transdifferentiating or inducing differentiation of cells by activating endogenous genes via RNA using a CRISPR/Cas9-based system, as described above.
  • (1) Transdifferentiation
  • The CRISPR/Cas9-based system may be used to transdifferentiate cells. Transdifferentiation, also known as lineage reprogramming or direct conversion, is a process where cells convert from one differentiated cell type to another without undergoing an intermediate pluripotent state or progenitor cell type. It is a type of metaplasia, which includes all cell fate switches, including the interconversion of stem cells. Transdifferentiation of cells has potential uses for disease modeling, drug discovery, gene therapy and regenerative medicine. Activation of endogenous genes, such as BRN2, MYT1L, ASCL1, NANOG, and/or MYOD1, using the CRISPR/Cas9 based system described above may lead to transdifferentiation of several cell types, such as fibroblasts, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, or smooth muscle cells, into neuronal and myogenic phenotypes, respectively.
  • (2) Inducing Differentiation
  • The CRISPR/Cas9-based system may be used to induce differentiation of cells, such as stem cells, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, or smooth muscle cells. For example, stem cells, such as embryonic stem cells or pluripotent stem cells, may be induced to differentiate into muscle cells or vascular endothelial cell, i.e., induce neuronal or myogenic differentiation.
  • 12. USES OF MULTIPLEX CRISPR/CAS9-BASED SYSTEM
  • The multiplex CRISPR/Cas9-Based System takes advantage of the simplicity and low cost of sgRNA design and may be helpful in exploiting advances in high-throughput genomic research using CRISPR/Cas9 technology. For example, the single lentiviral vectors described here are useful in expressing Cas9 and numerous sgRNAs in difficult cell lines, such as primary fibroblasts described here (FIG. 47). The multiplex CRISPR/Cas9-Based System may be used in the same ways as the CRISPR/Cas9-Based System described above.
  • In addition to the described transcriptional activation and nuclease functionality, this system will be useful for expressing other novel Cas9-based effectors that control epigenetic modifications for diverse purposes, including interrogation of genome architecture and pathways of endogenous gene regulation. As endogenous gene regulation is a delicate balance between multiple enzymes, multiplexing Cas9 systems with different functionalities will allow for examining the complex interplay among different regulatory signals. The vector described here should be compatible with aptamer-modified sgRNAs and orthogonal Cas9s to enable independent genetic manipulations using a single set of sgRNAs.
  • The multiplex CRISPR/Cas9-Based System may be used to activate at least one endogenous gene in a cell. The method includes contacting a cell with the modified lentiviral vector. The endogenous gene may be transiently activated or stably activated. The endogenous gene may be transiently repressed or stably repressed. The fusion protein may be expressed at similar levels to the sgRNAs. The fusion protein may be expressed at different levels compared to the sgRNAs. The cell may be a primary human cell.
  • The multiplex CRISPR/Cas9-Based System may be used in a method of multiplex gene editing in a cell. The method includes contacting a cell with the modified lentiviral vector. The multiplex gene editing may include correcting a mutant gene or inserting a transgene. Correcting a mutant gene may include deleting, rearranging or replacing the mutant gene. Correcting the mutant gene may include nuclease-mediated non-homologous end joining or homology-directed repair. The multiplex gene editing may include deleting or correcting at least one gene, wherein the gene is an endogenous normal gene or a mutant gene. The multiplex gene editing may include deleting or correcting at least two genes. For example, at least two genes, at least three genes, at least four genes, at least five genes, at least six genes, at least seven genes, at least eight genes, at least nine genes, or at least ten genes may be deleted or corrected.
  • The multiplex CRISPR/Cas9-Based System may be used in a method of multiplex modulation of gene expression in a cell. The method includes contacting a cell with the modified lentiviral vector. The method may include modulating the gene expression levels of at least one gene. The gene expression of the at least one target gene is modulated when gene expression levels of the at least one target gene are increased or decreased compared to normal gene expression levels for the at least one target gene. The gene expression levels may be RNA or protein levels.
  • 13. METHODS OF CORRECTING A MUTANT GENE AND TREATING A SUBJECT
  • The present disclosure is also directed to a method of correcting a mutant gene in a subject. The method comprises administering to the skeletal muscle or cardiac muscle of the subject the composition for genome editing in skeletal muscle or cardiac muscle, as described above. Use of the composition to deliver the site-specific nuclease to the skeletal muscle or cardiac muscle may restore the expression of a full-functional or partially-functional protein with a repair template or donor DNA, which can replace the entire gene or the region containing the mutation. The site-specific nuclease may be used to introduce site-specific double strand breaks at targeted genomic loci. Site-specific double-strand breaks are created when the site-specific nuclease binds to a target DNA sequences, thereby permitting cleavage of the target DNA. This DNA cleavage may stimulate the natural DNA-repair machinery, leading to one of two possible repair pathways: homology-directed repair (HDR) or the non-homologous end joining (NHEJ) pathway.
  • The present disclosure is directed to genome editing with a site-specific nuclease without a repair template, which can efficiently correct the reading frame and restore the expression of a functional protein involved in a genetic disease. The disclosed site-specific nucleases may involve using homology-directed repair or nuclease-mediated non-homologous end joining (NHEJ)-based correction approaches, which enable efficient correction in proliferation-limited primary cell lines that may not be amenable to homologous recombination or selection-based gene correction. This strategy integrates the rapid and robust assembly of active site-specific nucleases with an efficient gene editing method for the treatment of genetic diseases caused by mutations in nonessential coding regions that cause frameshifts, premature stop codons, aberrant splice donor sites or aberrant splice acceptor sites.
  • a. Nuclease Mediated Non-Homologous End Joining
  • Restoration of protein expression from an endogenous mutated gene may be through template-free NHEJ-mediated DNA repair. In contrast to a transient method targeting the target gene RNA, the correction of the target gene reading frame in the genome by a transiently expressed site-specific nuclease may lead to permanently restored target gene expression by each modified cell and all of its progeny.
  • Nuclease mediated NHEJ gene correction may correct the mutated target gene and offers several potential advantages over the HDR pathway. For example, NHEJ does not require a donor template, which may cause nonspecific insertional mutagenesis. In contrast to HDR, NHEJ operates efficiently in all stages of the cell cycle and therefore may be effectively exploited in both cycling and post-mitotic cells, such as muscle fibers. This provides a robust, permanent gene restoration alternative to oligonucleotide-based exon skipping or pharmacologic forced read-through of stop codons and could theoretically require as few as one drug treatment. NHEJ-based gene correction using a CRISPR/Cas9-based system, as well as other engineered nucleases including meganucleases and zinc finger nucleases, may be combined with other existing ex vivo and in vivo platforms for cell- and gene-based therapies, in addition to the plasmid electroporation approach described here. For example, delivery of a CRISPR/Cas9-based system by mRNA-based gene transfer or as purified cell permeable proteins could enable a DNA-free genome editing approach that would circumvent any possibility of insertional mutagenesis.
  • b. Homology-Directed Repair
  • Restoration of protein expression from an endogenous mutated gene may involve homology-directed repair. The method as described above further includes administrating a donor template to the cell. The donor template may include a nucleotide sequence encoding a full-functional protein or a partially-functional protein. For example, the donor template may include a miniaturized dystrophin construct, termed minidystrophin (“minidys”), a full-functional dystrophin construct for restoring a mutant dystrophin gene, or a fragment of the dystrophin gene that after homology-directed repair leads to restoration of the mutant dystrophin gene.
  • c. Methods of Correcting a Mutant Gene and Treating a Subject Using CRISPR/Cas9
  • The present disclosure is also directed to genome editing with the CRISPR/Cas9-based system to restore the expression of a full-functional or partially-functional protein with a repair template or donor DNA, which can replace the entire gene or the region containing the mutation. The CRISPR/Cas9-based system may be used to introduce site-specific double strand breaks at targeted genomic loci. Site-specific double-strand breaks are created when the CRISPR/Cas9-based system binds to a target DNA sequences using the gRNA, thereby permitting cleavage of the target DNA. The CRISPR/Cas9-based system has the advantage of advanced genome editing due to their high rate of successful and efficient genetic modification. This DNA cleavage may stimulate the natural DNA-repair machinery, leading to one of two possible repair pathways: homology-directed repair (HDR) or the non-homologous end joining (NHEJ) pathway. For example, a CRISPR/Cas9-based system directed towards the dystrophin gene may include a gRNA having a nucleic acid sequence of any one of SEQ ID NOs: 65-115.
  • The present disclosure is directed to genome editing with CRISPR/Cas9-based system without a repair template, which can efficiently correct the reading frame and restore the expression of a functional protein involved in a genetic disease. The disclosed CRISPR/Cas9-based system and methods may involve using homology-directed repair or nuclease-mediated non-homologous end joining (NHEJ)-based correction approaches, which enable efficient correction in proliferation-limited primary cell lines that may not be amenable to homologous recombination or selection-based gene correction. This strategy integrates the rapid and robust assembly of active CRISPR/Cas9-based system with an efficient gene editing method for the treatment of genetic diseases caused by mutations in nonessential coding regions that cause frameshifts, premature stop codons, aberrant splice donor sites or aberrant splice acceptor sites.
  • The present disclosure provides methods of correcting a mutant gene in a cell and treating a subject suffering from a genetic disease, such as DMD. The method may include administering to a cell or subject a CRISPR/Cas9-based system, a polynucleotide or vector encoding said CRISPR/Cas9-based system, or composition of said CRISPR/Cas9-based system as described above. The method may include administering a CRISPR/Cas9-based system, such as administering a Cas9 protein or Cas9 fusion protein containing a second domain having nuclease activity, a nucleotide sequence encoding said Cas9 protein or Cas9 fusion protein, and/or at least one gRNA, wherein the gRNAs target different DNA sequences. The target DNA sequences may be overlapping. The number of gRNA administered to the cell may be at least 1 gRNA, at least 2 different gRNA, at least 3 different gRNA at least 4 different gRNA, at least 5 different gRNA, at least 6 different gRNA, at least 7 different gRNA, at least 8 different gRNA, at least 9 different gRNA, at least 10 different gRNA, at least 15 different gRNA, at least 20 different gRNA, at least 30 different gRNA, or at least 50 different gRNA, as described above. The gRNA may include a nucleic acid sequence of at least one of SEQ ID NOs: 65-115. The method may involve homology-directed repair or non-homologous end joining.
  • 14. METHODS OF TREATING A DISEASE
  • The present disclosure is directed to a method of treating a subject in need thereof. The method comprises administering to a tissue of a subject the composition for altering gene expression and engineering or altering genomic DNA in a cell or subject genome editing, as described above. The method may comprises administering to the skeletal muscle or cardiac muscle of the subject the composition for genome editing in skeletal muscle or cardiac muscle, as described above. The subject may be suffering from a skeletal muscle or cardiac muscle condition causing degeneration or weakness or a genetic disease. For example, the subject may be suffering from Duchenne muscular dystrophy, as described above.
  • a. Duchenne Muscular Dystrophy
  • The method, as described above, may be used for correcting the dystrophin gene and recovering full-functional or partially-functional protein expression of said mutated dystrophin gene. In some aspects and embodiments the disclosure provides a method for reducing the effects (e.g., clinical symptoms/indications) of DMD in a patient. In some aspects and embodiments the disclosure provides a method for treating DMD in a patient. In some aspects and embodiments the disclosure provides a method for preventing DMD in a patient. In some aspects and embodiments the disclosure provides a method for preventing further progression of DMD in a patient.
  • 15. CONSTRUCTS AND PLASMIDS
  • The compositions, as described above, may comprise genetic constructs that encodes the CRISPR/Cas9-based system, as disclosed herein. The genetic construct, such as a plasmid, may comprise a nucleic acid that encodes the CRISPR/Cas9-based system, such as the Cas9 protein and Cas9 fusion proteins and/or at least one of the gRNAs. The compositions, as described above, may comprise genetic constructs that encodes the modified AAV vector and a nucleic acid sequence that encodes the site-specific nuclease, as disclosed herein. The genetic construct, such as a plasmid, may comprise a nucleic acid that encodes the site-specific nuclease. The compositions, as described above, may comprise genetic constructs that encodes the modified lentiviral vector, as disclosed herein. The genetic construct, such as a plasmid, may comprise a nucleic acid that encodes the Cas9-fusion protein and at least one sgRNA. The genetic construct may be present in the cell as a functioning extrachromosomal molecule. The genetic construct may be a linear minichromosome including centromere, telomeres or plasmids or cosmids.
  • The genetic construct may also be part of a genome of a recombinant viral vector, including recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus. The genetic construct may be part of the genetic material in attenuated live microorganisms or recombinant microbial vectors which live in cells. The genetic constructs may comprise regulatory elements for gene expression of the coding sequences of the nucleic acid. The regulatory elements may be a promoter, an enhancer, an initiation codon, a stop codon, or a polyadenylation signal.
  • The nucleic acid sequences may make up a genetic construct that may be a vector. The vector may be capable of expressing the fusion protein, such as the Cas9-fusion protein or site-specific nuclease, in the cell of a mammal. The vector may be recombinant. The vector may comprise heterologous nucleic acid encoding the fusion protein, such as the Cas9-fusion protein or site-specific nuclease. The vector may be a plasmid. The vector may be useful for transfecting cells with nucleic acid encoding the Cas9-fusion protein or site-specific nuclease, which the transformed host cell is cultured and maintained under conditions wherein expression of the Cas9-fusion protein or the site-specific nuclease system takes place.
  • Coding sequences may be optimized for stability and high levels of expression. In some instances, codons are selected to reduce secondary structure formation of the RNA such as that formed due to intramolecular bonding.
  • The vector may comprise heterologous nucleic acid encoding the CRISPR/Cas9-based system or the site-specific nuclease and may further comprise an initiation codon, which may be upstream of the CRISPR/Cas9-based system or the site-specific nuclease coding sequence, and a stop codon, which may be downstream of the CRISPR/Cas9-based system or the site-specific nuclease coding sequence. The initiation and termination codon may be in frame with the CRISPR/Cas9-based system or the site-specific nuclease coding sequence. The vector may also comprise a promoter that is operably linked to the CRISPR/Cas9-based system or the site-specific nuclease coding sequence. The promoter operably linked to the CRISPR/Cas9-based system or the site-specific nuclease coding sequence may be a promoter from simian virus 40 (SV40), a mouse mammary tumor virus (MMTV) promoter, a human immunodeficiency virus (HIV) promoter such as the bovine immunodeficiency virus (BIV) long terminal repeat (LTR) promoter, a Moloney virus promoter, an avian leukosis virus (ALV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter, Epstein Barr virus (EBV) promoter, or a Rous sarcoma virus (RSV) promoter. The promoter may also be a promoter from a human gene such as human ubiquitin C (hUbC), human actin, human myosin, human hemoglobin, human muscle creatine, or human metalothionein. The promoter may also be a tissue specific promoter, such as a muscle or skin specific promoter, natural or synthetic. Examples of such promoters are described in US Patent Application Publication No. US20040175727, the contents of which are incorporated herein in its entirety.
  • The vector may also comprise a polyadenylation signal, which may be downstream of the CRISPR/Cas9-based system or the site-specific nuclease. The polyadenylation signal may be a SV40 polyadenylation signal, LTR polyadenylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human β-globin polyadenylation signal. The SV40 polyadenylation signal may be a polyadenylation signal from a pCEP4 vector (Invitrogen, San Diego, Calif.).
  • The vector may also comprise an enhancer upstream of the CRISPR/Cas9-based system, i.e., the Cas9 protein or Cas9 fusion protein coding sequence or sgRNAs, or the site-specific nuclease. The enhancer may be necessary for DNA expression. The enhancer may be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, HA, RSV or EBV. Polynucleotide function enhancers are described in U.S. Pat. Nos. 5,593,972, 5,962,428, and WO94/016737, the contents of each are fully incorporated by reference. The vector may also comprise a mammalian origin of replication in order to maintain the vector extrachromosomally and produce multiple copies of the vector in a cell. The vector may also comprise a regulatory sequence, which may be well suited for gene expression in a mammalian or human cell into which the vector is administered. The vector may also comprise a reporter gene, such as green fluorescent protein (“GFP”) and/or a selectable marker, such as hygromycin (“Hygro”).
  • The vector may be expression vectors or systems to produce protein by routine techniques and readily available starting materials including Sambrook et al., Molecular Cloning and Laboratory Manual, Second Ed., Cold Spring Harbor (1989), which is incorporated fully by reference. In some embodiments the vector may comprise the nucleic acid sequence encoding the CRISPR/Cas9-based system, including the nucleic acid sequence encoding the Cas9 protein or Cas9 fusion protein and the nucleic acid sequence encoding the at least one gRNA comprising the nucleic acid sequence of at least one of SEQ ID NOs: 5-40, 65-144, 492-515, 540-563, and 585-625.
  • 16. PHARMACEUTICAL COMPOSITIONS
  • The composition may be in a pharmaceutical composition. The pharmaceutical composition may comprise about 1 ng to about 10 mg of DNA encoding the CRISPR/Cas9-based system or CRISPR/Cas9-based system protein component, i.e., the Cas9 protein or Cas9 fusion protein. The pharmaceutical composition may comprise about 1 ng to about 10 mg of the DNA of the modified AAV vector and nucleotide sequence encoding the site-specific nuclease. The pharmaceutical composition may comprise about 1 ng to about 10 mg of the DNA of the modified lentiviral vector. The pharmaceutical compositions according to the present invention are formulated according to the mode of administration to be used. In cases where pharmaceutical compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free and particulate free. An isotonic formulation is preferably used. Generally, additives for isotonicity may include sodium chloride, dextrose, mannitol, sorbitol and lactose. In some cases, isotonic solutions such as phosphate buffered saline are preferred. Stabilizers include gelatin and albumin. In some embodiments, a vasoconstriction agent is added to the formulation.
  • The composition may further comprise a pharmaceutically acceptable excipient. The pharmaceutically acceptable excipient may be functional molecules as vehicles, adjuvants, carriers, or diluents. The pharmaceutically acceptable excipient may be a transfection facilitating agent, which may include surface active agents, such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.
  • The transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid. The transfection facilitating agent is poly-L-glutamate, and more preferably, the poly-L-glutamate is present in the composition for genome editing in skeletal muscle or cardiac muscle at a concentration less than 6 mg/ml. The transfection facilitating agent may also include surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalene, and hyaluronic acid may also be used administered in conjunction with the genetic construct. In some embodiments, the DNA vector encoding the composition may also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA-liposome mixture (see for example WO9324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents. Preferably, the transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid.
  • 17. METHODS OF DELIVERY
  • Provided herein is a method for delivering the pharmaceutical formulations, preferably compositions described above, for providing genetic constructs. The delivery of the compositions may be the transfection or electroporation of the composition as a nucleic acid molecule that is expressed in the cell and delivered to the surface of the cell. The nucleic acid molecules may be electroporated using BioRad Gene Pulser Xcell or Amaxa Nucleofector IIb devices. Several different buffers may be used, including BioRad electroporation solution, Sigma phosphate-buffered saline product #D8537 (PBS), Invitrogen OptiMM I (OM), or Amaxa Nucleofector solution V (N.V.). Transfections may include a transfection reagent, such as Lipofectamine 2000.
  • Upon delivery of the composition to the tissue, and thereupon the vector into the cells of the mammal, the transfected cells will express the fusion protein, such as a CRISPR/Cas9-based system and/or a site-specific nuclease. The composition may be administered to a mammal to alter gene expression or to re-engineer or alter the genome. For example, the composition may be administered to a mammal to correct the dystrophin gene in a mammal. The mammal may be human, non-human primate, cow, pig, sheep, goat, antelope, bison, water buffalo, bovids, deer, hedgehogs, elephants, llama, alpaca, mice, rats, or chicken, and preferably human, cow, pig, or chicken.
  • a. CRISPR/Cas9-Based System
  • The vector encoding a CRISPR/Cas9-based system protein component, i.e., the Cas9 protein or Cas9 fusion protein, may be delivered to the mammal by DNA injection (also referred to as DNA vaccination) with and without in vivo electroporation, liposome mediated, nanoparticle facilitated, and/or recombinant vectors. The recombinant vector may be delivered by any viral mode. The viral mode may be recombinant lentivirus, recombinant adenovirus, and/or recombinant adeno-associated virus.
  • The nucleotide encoding a CRISPR/Cas9-based system protein component, i.e., the Cas9 protein or Cas9 fusion protein, may be introduced into a cell to genetically correct the target gene or alter gene expression of a gene, such as activate or repress endogenous genes. For example, a nucleotide encoding a CRISPR/Cas9-based system protein component, i.e., the Cas9 protein or Cas9 fusion protein, directed towards a mutant dystrophin gene by the gRNA may be introduced into a myoblast cell from a DMD patient. Alternatively, they may be introduced into a fibroblast cell from a DMD patient, and the genetically corrected fibroblast cell may be treated with MyoD to induce differentiation into myoblasts, which may be implanted into subjects, such as the damaged muscles of a subject to verify that the corrected dystrophin protein was functional and/or to treat the subject. The modified cells may also be stem cells, such as induced pluripotent stem cells, bone marrow-derived progenitors, skeletal muscle progenitors, human skeletal myoblasts from DMD patients, CD133+ cells, mesoangioblasts, and MyoD- or Pax7-transduced cells, or other myogenic progenitor cells. For example, the CRISPR/Cas9-based system may cause neuronal or myogenic differentiation of an induced pluripotent stem cell.
  • 18. ROUTES OF ADMINISTRATION
  • The compositions may be administered to a subject by different routes including orally, parenterally, sublingually, transdermally, rectally, transmucosally, topically, via inhalation, via buccal administration, intrapleurally, intravenous, intraarterial, intraperitoneal, subcutaneous, intramuscular, intranasal intrathecal, and intraarticular or combinations thereof. For veterinary use, the composition may be administered as a suitably acceptable formulation in accordance with normal veterinary practice. The veterinarian may readily determine the dosing regimen and route of administration that is most appropriate for a particular animal. The compositions may be administered by traditional syringes, needleless injection devices, “microprojectile bombardment gone guns”, or other physical methods such as electroporation (“EP”), “hydrodynamic method”, or ultrasound.
  • The composition may be delivered to the mammal by several technologies including DNA injection (also referred to as DNA vaccination) with and without in vivo electroporation, liposome mediated, nanoparticle facilitated, recombinant vectors such as recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus. The composition may be injected into the skeletal muscle or cardiac muscle. For example, the composition may be injected into the tibialis anterior muscle.
  • 19. CELL TYPES
  • Any of these delivery methods and/or routes of administration could be utilized with a myriad of cell types, for example, those cell types currently under investigation for cell-based therapies. Cell types may be fibroblasts, pluripotent stem cells, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, smooth muscle cells, or K562 human erythroid leukemia cell line.
  • a. DMD
  • Cell types currently under investigation for cell-based therapies of DMD include immortalized myoblast cells, such as wild-type and DMD patient derived lines, for example Δ48-50 DMD, DMD 8036 (del48-50), C25C14 and DMD-7796 cell lines, primal DMD dermal fibroblasts, induced pluripotent stem cells, bone marrow-derived progenitors, skeletal muscle progenitors, human skeletal myoblasts from DMD patients, CD133+ cells, mesoangioblasts, cardiomyocytes, hepatocytes, chondrocytes, mesenchymal progenitor cells, hematopoetic stem cells, smooth muscle cells, and MyoD- or Pax7-transduced cells, or other myogenic progenitor cells. Immortalization of human myogenic cells may be used for clonal derivation of genetically corrected myogenic cells. Cells may be modified ex vivo to isolate and expand clonal populations of immortalized DMD myoblasts that contain a genetically corrected dystrophin gene and are free of other nuclease-introduced mutations in protein coding regions of the genome. Alternatively, transient in vivo delivery of nucleases by non-viral or non-integrating viral gene transfer, or by direct delivery of purified proteins and gRNAs containing cell-penetrating motifs may enable highly specific correction in situ with minimal or no risk of exogenous DNA integration.
  • 20. KITS
  • Provided herein is a kit, which may be used to edit a genome in skeletal muscle or cardiac muscle, such as correcting a mutant gene. The kit comprises a composition for genome editing in skeletal muscle or cardiac muscle, as described above, and instructions for using said composition. Instructions included in kits may be affixed to packaging material or may be included as a package insert. While the instructions are typically written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this disclosure. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. As used herein, the term “instructions” may include the address of an internet site that provides the instructions.
  • The composition for genome editing in skeletal muscle or cardiac muscle may include a modified AAV vector and a nucleotide sequence encoding a site-specific nuclease, as described above. The site-specific nuclease may include a ZFN, a TALEN, or CRISPR/Cas9-based system, as described above, that specifically binds and cleaves a mutated gene. The site-specific nuclease, as described above, may be included in the kit to specifically bind and target a particular region in the mutated gene. The site-specific nuclease may be specific for a mutated dystrophin gene, as described above. The kit may further include donor DNA, a gRNA, or a transgene, as described above.
  • a. CRISPR/Cas9-based system
  • Provided herein is a kit, which may be used to correct a mutated gene. The kit comprises at least one component for correcting a mutated gene and instructions for using the CRISPR/Cas9-based system. Instructions included in kits may be affixed to packaging material or may be included as a package insert. While the instructions are typically written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this disclosure. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. As used herein, the term “instructions” may include the address of an internet site that provides the instructions.
  • At least one component may include at least one CRISPR/Cas9-based system, as described above, which specifically targets a gene. The kit may include a Cas9 protein or Cas9 fusion protein, a nucleotide sequence encoding said Cas9 protein or Cas9 fusion protein, and/or at least one gRNA. The CRISPR/Cas9-based system, as described above, may be included in the kit to specifically bind and target a particular target region upstream, within or downstream of the coding region of the target gene. For example, a CRISPR/Cas9-based system may be specific for a promoter region of a target gene or a CRISPR/Cas9-based system may be specific for a mutated gene, for example a mutated dystrophin gene, as described above. The kit may include donor DNA, as described above.
  • 21. EXAMPLES
  • It will be readily apparent to those skilled in the art that other suitable modifications and adaptations of the methods of the present disclosure described herein are readily applicable and appreciable, and may be made using suitable equivalents without departing from the scope of the present disclosure or the aspects and embodiments disclosed herein. Having now described the present disclosure in detail, the same will be more clearly understood by reference to the following examples, which are merely intended only to illustrate some aspects and embodiments of the disclosure, and should not be viewed as limiting to the scope of the disclosure. The disclosures of all journal references, U.S. patents, and publications referred to herein are hereby incorporated by reference in their entireties.
  • The present invention has multiple aspects, illustrated by the following non-limiting examples.
  • Example 1 Materials and Methods
  • Cell culture and transfection. HEK293T cells were obtained from the American Tissue Collection Center (ATCC) through the Duke University Cancer Center Facilities and were maintained in DMEM supplemented with 10% fetal bovine serum and 1% penicillin/streptomycin at 37° C. with 5% C02. HEK293T cells were transfected with Lipofectamine 2000 (Invitrogen) according to manufacturer's instructions. Transfection efficiencies were routinely higher than 80% as determined by fluorescence microscopy following delivery of a control eGFP expression plasmid. Cas9 expression plasmid was transfected at a mass ratio of 3:1 to either the individual gRNA expression plasmids or the identical amount of gRNA expression plasmid consisting of a mixture of equal amounts of the four gRNAs.
  • Primary mouse embryonic fibroblasts (PMEF-HL, Millipore, Billerica, Mass.) were seeded (75,000 per well) in 24-well TCPS plates (BD, Franklin Lakes, N.J.) and maintained at 37° C. and 5% CO2 in complete MEF medium consisting of high glucose DMEM supplemented with 10% Premium Select FBS (Atlanta Biologicals, Lawrenceville, Ga.), 25 μg mL−1 gentamicin (Invitrogen), 1× GutaMAX, non-essential amino acids, sodium pyruvate, and β-mercaptoethanol (Invitrogen). MEF transfections were performed with a single 1 μg cm−2 dose of total plasmid DNA, delivered as cationic nanocomplexes following electrostatic condensation with poly(CBA-ABOL) in serum- and antibiotic-free OptiMEM, as described previously (Adler et al. Molecular therapy. Nucleic acids 1, e32 (2012)). OptiMEM was replaced with complete MEF medium 4 hrs after transfection. 48 hrs after transfection, MEFs were processed for qRT-PCR, or the complete MEF medium was replaced with N3 neural induction medium containing: DMEM/F-12 (Invitrogen), 1× N-2 Supplement (Invitrogen), 10 ng mL−1 human bFGF2 (Stemgent, Cambridge, Mass.), and 25 μg mL−1 gentamicin (Invitrogen). A GFP reporter vector (pmax-GFP, 3486 bp, Amaxa, Cologne, Germany) was used to optimize transfection conditions. Cas9 expression plasmid was transfected at a mass ratio of 3:1 or 1:1 to an equal mixture of four gRNA expression plasmids.
  • Plasmids. The plasmids encoding wild-type and H840A Cas9 were obtained from Addgene (Plasmid #39312 and Plasmid #39316; Jinek, et al. Science 337, 816-821 (2012)). H840A Cas9 was cloned into the vector pcDNA3.1 in frame with a FLAG epitope tag and a nuclear localization sequence (NLS) at the N-terminus with a primer pair that introduced the D10A mutation. The VP64 domain, an NLS, and an HA epitope tag were cloned in frame with the Cas9 ORF at the C-terminus (FIG. 1A, FIG. 9A). The tracrRNA and crRNA expression cassettes (Cong et al. Science 339, 819-823 (2013)) were ordered as gBlocks (Integrated DNA Technologies (IDT)) and cloned into a pZDonor plasmid (Sigma) with KpnI and SacII sites. A chimeric guide RNA expression cassette (Mali et al. Science 339, 823-826 (2013)) was also ordered as gBlocks with modifications to include a BbsI restriction site to facilitate rapid cloning of new guide RNA spacer sequences (FIG. 9B). The oligonucleotides containing the target sequences were obtained from IDT, hybridized, phosphorylated, and cloned in the appropriate plasmids using BbsI sites. The target sequences are provided in Table 2.
  • TABLE 2
    Target sequences of gRNAs
    SEQ
    Target Name Sequence ID NO
    ASCL1 CR1 GCTGGGTGTCCCATTGAAA  5
    CR2 CAGCCGCTCGCTGCAGCAG  6
    CR3 TGGAGAGTTTGCAAGGAGC  7
    CR4 GTTTATTCAGCCGGGAGTC  8
    NANOG CR1 CGCCAGGAGGGGTGGGTCTA  9
    CR2 CCTTGGTGAGACTGGTAGA 10
    CR3 GTCTTCAGGTTCTGTTGCT 11
    CR4 ATATTCCTGATTTAAAAGT 12
    VEGFA CR1 TTAAAAGTCGGCTGGTAGC 13
    CR2 CGGGCCGGGGGCGGGGTCC 14
    CR3 GCCCGAGCCGCGTGTGGAA 15
    CR4 CCTTCATTGCGGCGGGCTG 16
    TERT CR1 CCGACCCCTCCCGGGTCCC 17
    CR2 CAGGACCGCGCTTCCCACG 18
    CR3 TGCACCCTGGGAGCGCGAG 19
    CR4 CCGCACGCACCTGTTCCCA 20
    IL1B CR1 AAAACAGCGAGGGAGAAAC 21
    CR2 TTAACTTGATTGTGAAATC 22
    CR3 AAAACAATGCATATTTGCA 23
    CR4 AAAATCCAGTATTTTAATG 24
    IL1R2 CR1 ACCCAGCACTGCAGCCTGG 25
    CR2 AACTTATGCGGCGTTTCCT 26
    CR3 TCACTTTAAAACCACCTCT 27
    CR4 GCATCTTTTTCTCTTTAAT 28
    IL1RN CR1 TGTACTCTCTGAGGTGCTC 29
    CR2 ACGCAGATAAGAACCAGTT 30
    CR3 CATCAAGTCAGCCATCAGC 31
    CR4 GAGTCACCCTCCTGGAAAC 32
    HBG1/2 CR1 GCTAGGGATGAAGAATAAA 33
    CR2 TTGACCAATAGCCTTGACA 34
    CR3 TGCAAATATCTGTCTGAAA 35
    CR4 AAATTAGCAGTATCCTCTT 36
    MYOD1 CR1 CCTGGGCTCCGGGGCGTTT 37
    CR2 GGCCCCTGCGGCCACCCCG 38
    CR3 CTCCCTCCCTGCCCGGTAG 39
    CR4 AGGTTTGGAAAGGGCGTGC 40
  • Western blot. Cells were lysed in 50 mM Tris-Cl (pH 7.4), 150 mM NaCl, 0.50 Triton X-100, and 0.1% SDS. Lysates were mixed with loading buffer, boiled for 5 min, and equal volumes of protein were run in NuPAGE® Novex 0-2% or 10% Bis-Tris Gel polyacrylamide gels and transferred to nitrocellulose membranes. Non-specific antibody binding was blocked with 50 mM Tris/150 mM NaCl/0.1% Tween-20 (TBS-T) with 5% nonfat milk for 30 min. The membranes were incubated with primary antibodies (HRP-conjugated anti-Flag (Cell Signaling, Cat #2044) in 5% BSA in TBS-T diluted 1:1000 overnight; anti-GAPDH (Cell Signaling, clone 14C10) in 5% milk in TBS-T diluted 1:5000 for 30 min; anti-ASCL1 (Santa Cruz, clone sc-48449) in 5% BSA diluted 1:500; or anti-g-globin (Santa Cruz, clone 51-7) in 5% milk diluted 1:500 and the membranes were washed with TBS-T for 30 min. Membranes labeled with primary antibodies were incubated with anti-rabbit HRP-conjugated antibody (Sigma-Aldrich) diluted 1:5000 for 30 min, anti-goat (1:3000) or anti-mouse (1:5000) and washed with TBS-T for 30 min. Membranes were visualized using the Immun-Star WesternC™ Chemiluminescence Kit (Bio-Rad) and images were captured using a ChemiDoc™ XRS+ System and processed using ImageLab software (Bio-Rad).
  • ELISA. Serum-free culture media (OPTI-MEM) was collected and frozen at −80° C. Human IL-1ra secretion into culture media was quantified via enzyme-linked immunosorbent assay (ELISA), according to the manufacturer's protocols (R&D Systems, Cat. No. DY280). The standard curve was prepared by diluting recombinant human IL-1ra in OPTI-MEM and the IL-1ra in culture media was measured undiluted. The samples were concentrated about 8 fold via centrifugation through 3 kDa MWCO filters for 20 min (Amicon Ultra, Cat # UFC500396). Reported values were corrected by the concentration factor for each sample.
  • Optical density was measured at 450 nm, with a wavelength correction at 540 nm. Each standard and sample was assayed in duplicate. The duplicate readings were averaged and normalized by subtracting the average zero standard optical density. A standard curve was generated by log-transforming the data and performing a linear regression of the IL-1ra concentration versus the optical density. Reported values are the mean and standard error of the mean from three independent experiments (n=3) that were performed on different days with technical duplicates that were averaged for each experiment.
  • qRT-PCR. Total RNA was isolated using the RNeasy Plus RNA isolation kit (Qiagen). cDNA synthesis was performed using the SuperScript® VILO™ cDNA Synthesis Kit (Invitrogen). Real-time PCR using PerfeCTa® SYBR® Green FastMix was performed with the CFX96 Real-Time PCR Detection System (Bio-Rad) with oligonucleotide primers reported in Table 3 that were designed using Primer3Plus software and purchased from IDT.
  • TABLE 3
    Sequences of primers used for qRT-PCR.
    SEQ SEQ
    Target Forward Primer ID NO Reverse Primer ID NO
    hASCL1 GGAGCTTCTCGACT 41 AACGCCACTGACAA 53
    TCACCA GAAAGC
    NANOG GATTTGTGGGCCTG 42 CAGATCCATGGAGG 54
    AAGAAA AAGGAA
    VEGFA AAGGAGGAGGGCAG 43 GGGTACTCCTGGAA 55
    AATCAT GATGTCC
    TERT AAACCTTCCTCAGC
    44 GTTTGCGACGCATG 56
    TATGCCC TTCCTC
    IL1B AGCTGATGGCCCTA 45 AAGCCCTTGCTGTA 57
    AACAGA GTGGTG
    IL1R2 CAGGAGGACTCTGG 46 CGGCAGGAAAGCAT 58
    CACCTA CTGTAT
    IL1RN GGAATCCATGGAGG
    47 TGTTCTCGCTCAGG 59
    GAAGAT TCAGTG
    HBG1/2 GCTGAGTGAACTGC 48 GAATTCTTTGCCGA 60
    ACTGTGA AATGGA
    MYOD1 CTCTCTGCTCCTTT 49 GTGCTCTTCGGGTT 61
    GCCACA TCAGGA
    GAPDH CAATGACCCCTTCA
    50 TTGATTTTGGAGGG 62
    TTGACC ATCTCG
    mASCL1 GGAACAAGAGCTGC
    51 GTTTTTCTGCCTCC 63
    TGGACT CCATTT
    mGAPDH AACTTTGGCATTGT
    52 GGATGCAGGGATGA 64
    GGAAGG TGTTCT
  • Primer specificity was confirmed by agarose gel electrophoresis and melting curve analysis. Reaction efficiencies over the appropriate dynamic range were calculated to ensure linearity of the standard curve (FIG. 10). The results are expressed as fold-increase mRNA expression of the gene of interest normalized to GAPDH expression by the ΔΔCT method. Reported values are the mean and standard error of the mean from three independent experiments performed on different days (n=3) with technical duplicates that were averaged for each experiment.
  • RNA-Seq. RNA seq libraries were constructed. Briefly, first strand cDNA was synthesized from oligo dT Dynabead® (Invitrogen) captured mRNA using SuperScript® VILO™ cDNA Synthesis Kit (Invitrogen). Second strand cDNA was synthesized using DNA Polymerase I (New England Biolabs). cDNA was purified using Agencourt AMPure XP beads (Beckman Coulter) and Nextera transposase (Illumina; 5 min at 55° C.) was used to simultaneously fragment and insert sequencing primers into the double-stranded cDNA. Transposition reactions were halted using QG buffer (Qiagen) and fragmented cDNA was purified on AMPure XP beads. Indexed sequencing libraries were generated by 6 cycles of PCR.
  • Libraries were sequenced using 50-bp single end reads on two lanes of an Illumina HiSeq 2000 instrument, generating between 29 million and 74 million reads per library. Reads were aligned to human RefSeq transcripts using Bowtie (Langmead et al. Genome biology 10, R25 (2009)). The statistical significance of differential expression, including correction for multiple hypothesis testing, was calculated using DESeq (Anders et al. Genome biology 11, R106 (2010)). Raw RNA-seq reads and the number of reads aligned to each RefSeq transcript have been deposited for public access in the Gene Expression Omnibus (GEO), with accession number currently pending.
  • Immunofluorescence staining. For detection of Tuj1 and MAP2 expression, transfected MEFs were fixed at day 10 of culture in N3 medium with 4% PFA (EMS, Hatfield, Pa.) at room temperature (RT) for 20 min. Cells were then incubated in blocking buffer containing 0.2% Triton X-100, 3% w/v BSA, and 10% goat serum (Sigma-Aldrich, Saint Louis, Mo.) for two hrs at room temperature with rabbit anti-Tuj1 (Covance, Princeton, N.J., clone TUJ1 1-15-79, 1:500) and mouse anti-MAP2 (BD, clone Ap20, 1:500), or for an additional 24 hrs at 4° C. with mouse anti-Ascl1 (BD clone 24B72D11.1, 1:100). The cells were then washed three times with PBS, incubated for 1 hr at room temperature in blocking buffer with Alexa Fluor 488 goat anti-mouse IgG and Alexa Fluor 594 goat anti-rabbit IgG (Invitrogen, 1:200), and washed three times with PBS. Stained MEFs were then scanned with a Nikon Eclipse TE2000-U inverted fluorescence microscope with a ProScanII motorized stage (Prior Scientific, Rockland, Mass.) to produce large mosaic images of each complete culture area. These mosaics were processed with a FIJI macro to automatically and uniformly threshold each image according to local contrast, exclude small debris, and to count the number of Tuj1+ cells in each well.
  • Statistics. Statistical analysis was performed by Tukey's test with alpha equal to 0.05 in JMP 10 Pro.
  • Example 2 Results
  • To create a CRISPR/Cas9-based transcriptional activation system, catalytic residues of Cas9 (D10A, H840A) were mutated to create iCas9 and genetically fused with a C-terminal VP64 acidic transactivation domain (FIG. 1A, FIG. 1). Robust expression of iCas9-VP64 was observed from the transfected plasmid in human embryonic kidney (HEK) 293T cells by western blot of the N-terminal Flag epitope tag (FIG. 3). The CRISPR system recognizes its target through base pairing of a 20 bp sequence in the gRNA to a complementary DNA target, which is followed by the NGG protospacer-adjacent motif (PAM) sequence, where N is any base pair. Combinations of synthetic transcription factors targeted to endogenous human promoters result in synergistic and robust activation of gene expression. Therefore four gRNA target sites followed by the NGG PAM sequence were identified in the promoter of the IL1RN gene within 500 bp of the transcriptional start site (FIG. 4, Table 2). To compare crRNA- and gRNA-based targeting strategies, the four target site sequences were introduced into crRNA and gRNA expression plasmids17 and co-transfected with the iCas9-VP64 expression plasmid into HEK293T cells. Although substantial induction of IL1RN expression was observed by qRT-PCR in samples treated with the combination of crRNAs, much higher levels were achieved with the combination of gRNAs (FIG. 1C). No changes to gene expression were observed in cells treated with gRNAs and an expression plasmid for iCas9 without VP64, demonstrating the critical role of the activation domain in modulating gene expression (FIG. 1C). Nuclease activity at these target sites was confirmed to have been abrogated in the iCas9-VP64 system by performing the Surveyor assay to detect DNA repair events in samples treated with iCas9-VP64 and wild-type Cas9 (FIG. 5). By transfecting each of the four gRNAs individually or in combination, targeting multiple sites in the promoter with combinations of gRNAs showed robust increases in gene expression (FIG. 1D). High levels of IL1RN expression were observed only when the gRNA combinations were co-transfected with iCas9-VP64 (FIG. 1D), as seen with other classes of engineered transcription factors. Similarly, production of the IL-1 receptor antagonist (IL-1ra) protein, encoded by the IL1RN gene, was only observed in three of the six samples treated with the combination of gRNAs across three different experiments, whereas it was never detected in samples treated with single gRNAs or control plasmid (FIG. 1E). To examine the specificity of gene activation by iCas9-VP64, global gene expression of HEK293T cells treated with the combination of four gRNAs by RNA-seq was assessed (FIG. 1F). Notably, the only genes with significantly increased expression relative to control (false discovery rate ≤3×10−4) were the four isoforms expressed from the IL1RN locus (FIG. 4), indicating a high level of specificity of gene activation.
  • To demonstrate the general applicability of this system, four gRNAs were designed to target each of the promoters of eight other genes relevant to medicine and biotechnology, including ASCL1, NANOG, HBG1/2, MYOD1, VEGFA, TERT, IL1B, and IL1R2 (FIG. 4, Table 2). Forced expression of ASCL1 and MYOD1 leads to transdifferentiation of several cell types into neuronal and myogenic phenotypes, respectively. NANOG is a marker of pluripotency and that is also used in genetic reprogramming strategies. Activation of the homologs HBG1 and HBG2, which encode γ-globin during fetal development, can be used as a therapeutic strategy to compensate for β-globin mutations in sickle cell disease. Up-regulation of VEGFA by synthetic transcription factors has been explored as a strategy to enhance tissue regeneration and wound healing. The forced expression of telomerase, encoded by the TERT gene, can be used to immortalize cell lines. IL1B encodes the IL-1β cytokine that mediates inflammation and autoimmunity. IL-1β signaling can be blocked by expression of IL-1ra or the decoy receptor encoded by IL1R2. Expression of each of these genes was enhanced by co-transfection of expression plasmids for iCas9-VP64 and the four gRNAs into HEK293T cells, as determined by qRT-PCR (FIGS. 2A-2H). In some cases expression of a single gRNA was sufficient to induce gene expression, but in all cases co-transfection of the four gRNAs led to synergistic effects (FIGS. 2A-2D). Notably, chromatin accessibility, as determined by DNase-seq, was not a predictor of successful gene activation (FIG. 4). RNA-seq was performed on cells transfected with iCas9-VP64 and the four gRNAs targeting HBG1, three of which also target HBG2. This revealed specific and reproducible increases in expression of both HBG1 and HBG2, which cannot be distinguished by RNA-seq, although statistical significance was not achieved due to low total expression levels (FIG. 6). Increases in protein expression of Asc1 and γ-globin following treatment with iCas9-VP64 and the four gRNAs were detected by western blot (FIG. 7), corroborating higher mRNA levels observed by qRT-PCR (FIGS. 2A-2H). Low baseline levels of Ascl1 and γ-globin protein expression were detectable in empty vector controls. As preliminary evidence that the activation of gene targets by iCas9-VP64 can lead to secondary changes in gene networks and cell phenotypes, expression plasmids for iCas9-VP64 and the four gRNAs targeting ASCL1 were co-transfected into murine embryonic fibroblasts (MEFs) (FIGS. 8A-8H). Forced expression of Ascl1 in MEFs has been shown to partially activate the neuronal gene network, including the downstream target Tuj1. Because the gRNA target sites are conserved in the human and mouse ASCL1 promoters (FIG. 8A), activation of ASCL1 expression was also observed in MEFs treated with plasmids encoding iCas9-VP64 and the four gRNAs (FIG. 8B). Furthermore, cells expressing Ascl1 and the neuronal marker Tuj1 were readily detected by immunofluorescence staining 12 days after transfection in the iCas9-VP64/gRNA-treated samples (FIGS. 8C-8H). No Tuj1-positive cells were observed in the cells treated with the control plasmid.
  • Thus far there has not been any comprehensive survey of the specificity of Cas9/CRISPR activity in mammalian cells. Using RNA-seq, targeted gene activation was shown to be exquisitely specific with no detectable off-target gene activation (FIG. 1F, FIG. 6). IL1RN and HBG12 were chosen for this specificity analysis as the gene products, IL-1ra and γ-globin, may not generate secondary effects on gene expression in HEK293T cells. Exploiting the synergistic activity of multiple weak transcriptional activators, in contrast to using a single strong activator, may increase specific gene regulation since it is unlikely that multiple adjacent off-target sites would exist at another locus. Interestingly, the IL32 gene was moderately downregulated (false discovery rate <0.03) in both the samples treated with iCas9-VP64 and either the IL1RN- or HBG1/2-targeted gRNAs compared to control samples treated with only an empty expression plasmid (FIG. 1F, FIG. 6). Because both the IL1RN and HBG1/2-targeted samples were similarly affected, it is unlikely that this is the result of off-target iCas9-VP64 activity related to the identity of the target sequences.
  • To evaluate the specificity with which iCas9-VP64 binds the genome, ChIP sequencing was performed using an anti-HA antibody on cells treated with iCas9-VP64 and four gRNAs targeting the IL1RN promoter. The experiment revealed that iCas9 targets the IL1RN promoter (FIG. 15). Moreover, the experiment revealed an extremely high level of specificity. The iCas9 had only 10 potential off-target binding sites (FDR<5%). To further query the specificity, RNA sequencing experiments were performed with iCas9 EGEMs and found that only IL1RN gene isoforms increased in expression relative to control (FDR≤3×10.4).
  • Example 3 CRISPRs Targeting the Dystrophin Gene—Methods and Materials
  • Plasmid constructs. The expression cassettes for the S. pyogenes sgRNA and human codon optimized Cas9 (hCas9) nuclease were used, as previously described (Perez-Pinera et al., Nat Methods 10:973-976 (2013)). In order to create a fluorescent reporter system to enrich CRISPR/Cas9-modified cells, a GeneBlock (IDT) was synthesized containing a portion of the 3′ end of the Cas9 coding sequence fused to a T2A skipping peptide immediately upstream of a multiple cloning site and subsequently cloned into the hCas9 expression vector. An eGFP reporter gene was then cloned into the T2A vector to allow co-translation of Cas9 and eGFP proteins from the same expression vector (hCas9-T2A-GFP, SEQ ID NO: 116).
  • Cell culture and transfection. HEK293T cells were obtained from the American Tissue Collection Center (ATCC) through the Duke Cell Culture Facility and were maintained in DMEM supplemented with 10% bovine calf serum and 1% penicillin/streptomycin. Immortalized myoblasts (Mamchaoui, K. et al. Skelet Muscle 1, 1-11 (2011)) (one from a wild-type donor, and two Δ48-50 DMD patient derived lines) were maintained in skeletal muscle media (PromoCell) supplemented with 20% bovine calf serum (Sigma), 50 μg/ml fetuin, 10 ng/ml human epidermal growth factor (Sigma), 1 ng/ml human basic fibroblast growth factor (Sigma), 10 μg/ml human insulin (Sigma), 1% GutaMAX (Invitrogen), and 1% penicillin/streptomycin (Invitrogen). Primary DMD dermal fibroblasts were obtained from the Coriell Cell repository (GM05162A, A46-50) and maintained in DMEM supplemented with 10% fetal bovine serum, 1 ng/mL human basic fibroblast growth factor, and 1% penicillin/streptomycin. All cell lines were maintained at 37° C. and 5% C02.
  • HEK293T cells were transfected with Lipofectamine 2000 (Invitrogen) with 400 ng of each expression vector according to the manufacturer's protocol in 24 well plates. Immortalized myoblasts and primary fibroblasts were transfected with 5 μg of each expression vector by electroporation using the Gene Pulser XCell (BioRad) with PBS as an electroporation buffer using optimized conditions for each line (FIGS. 1A-1F) (Ousterout et al. Mol Ther 21:1718-1726 (2013)). Transfection efficiencies were measured by delivering an eGFP expression plasmid (pmaxGFP, Clontech) and using flow cytometry. These efficiencies were routinely ≥95% for HEK293T and ≥70% for the primary fibroblasts and immortalized myoblasts. For all experiments, the indicated mass of electroporated plasmid corresponds to the amount used for each CRISPR/Cas9-based system.
  • Cel-I Quantification of Endogenous Gene Modification (Surveyor Assay).
  • CRISPR/Cas9-based system-induced lesions at the endogenous target site were quantified using the Surveyor nuclease assay (Guschin, D. Y. et al. Meth Mol Biol 649, 247-256 (2010)), which can detect mutations characteristic of nuclease-mediated NHEJ. After transfection, cells were incubated for 3 or 10 days at 37° C. and genomic DNA was extracted using the DNeasy Blood and Tissue kit (QIAGEN). The target locus was amplified by 35 cycles of PCR with the AccuPrime High Fidelity PCR kit (Invitrogen) using primers specific to each locus (see Table 4), such as 5′-GAGTTTGGCTCAAATTGTTACTCTT-3′ (SEQ ID NO: 626) and 5′-GGGAAATGGTCTAGGAGAGTAAAGT-3′ (SEQ ID NO: 627).
  • TABLE 4
    Summary of top 10 off target sites predicted
    in silico and activity at each site as
    detected by the Surveyor assay in HEK293T
    cells transfected with Cas9 and the indicated
    sgRNA expression cassettes.
    SEQ
    ID Intron/ %
    NO. Guide Target Sequence PAM Score Chr Gene Exon #MMs indels
     67 CR3 Guide GCCTACTCAGACTGTTACTC
    150 Target tCCTACTCAGACTGTTACTC TGG X DMD Exon 1 13.0
    151 OT1 tCCTACTCAcACTGTTACTC AGG 7.4  1 STRIP1 Intron 2  9.3
    152 OT2 aCCTgCTCAcACTGTTACTC CAG 2.5  2 ARHGAP25 Intron 3 n.d.
    153 OT3 GCaTtCTCAaACTGTTACTC AGG 2.4 13 None None 3 n.d.
    154 OT4 GgaTtCTCAcACTGTTACTC GGG 1.3 14 PGPEP1 Exon 4 n.d.
    155 OT5 aCaTACTtAtACTGTTACTC TAG 1.3 19 MDGA2 Intron 4 n.d.
    156 OT6 tatTcCTaAGACTGTTACTC AAG 0.9  8 LPPR1 Intron 5 n.d.
    157 OT7 aaggACTaAGACTGTTACTC GGG 0.9  9 RNF122 Intron 5 n.d.
    158 OT8 GagctCTCAtACTGTTACTC TAG 0.8  3 DNMBP Exon 5 n.d.
    159 OT9 GCaaAaTgAGACTGTTACTC CAG 0.8  5 SLC12A2 Intron 4 n.d.
    160 OT10 cCtcAtTCAGACTGTTACTC AAG 0.8  4 KCNIP4 Intron 4 n.d.
     65 CR1 Guide GATTGGCTTTGATTTCCCTA
    161 Target cATTGGCTTTGATTTCCCTA GGG X DMD Intron 1  8.3
    162 OT1 aATTGGCATTGATTTCCCTA GAG 7.1 16 None None 2  0.8
    163 OT2 cATTGGCTTTaATTTCCCTA TAG 4.8  4 None None 2 n.d.
    164 OT3 GATaGGCTgTGATTTCCCTA GAG 3.9  9 None None 2 n.d.
    165 OT4 GAaTaGCcTTGATTTCCCTA AAG 2.4  1 None None 3 n.d.
    166 OT5 aATTtGCTTTGATTTCCCTg AGG 1.5  1 TIMM17A Intron 3 n.d.
    167 OT6 GATgtGCTTTGATTTCCCTt GGG 1.4 17 MYO1D Intron 3 n.d.
    168 OT7 aATTGGtTTTaATTTCCCTA AAG 1.1  8 PIK1A Intron 3 n.d.
    169 OT8 aATTGGgTTTGATTTCCCTt TGG 1.1 11 MS4A1 Intron 3 n.d.
    170 OT9 GATgGGtTTTtATTTCCCTA GAG 1.0 11 None None 3 n.d.
    171 OT10 GAaTGGtTTTGATTTCCCTg GAG 1.0 11 None None 3 n.d.
     69 CR5 Guide GCAGTTGCCTAAGAACTGGT
    172 Target aCAGTTGCCTAAGAACTGGT GGG X DMD Intron 1 14.0
    173 OT1 cCAGTTGtCTAAGAACTGGg GAG 1.5  5 NRG1 Intron 3 n.d.
    174 OT2 GCAGTTGCCTgtGAACTGGT AGG 1.4 X None None 2 n.d.
    175 OT3 GCAGaTGCagAAGAACTGGT GAG 1.4 19 SMIM7 Intron 3 n.d.
    176 OT4 GCAGTTcCagAAGAACTGGT GAG 0.9 11 GLB1L2 Intron 3 n.d.
    177 OT5 caAcTTGCCTAtGAACTGGT AGG 0.7  8 ASAP1 Intron 4 n.d.
    178 OT6 aCAccTGCCTAAGAACTGGa GGG 0.7 11 None None 4 n.d.
    179 OT7 tCAGgTGgCTAAGAACTGGg TGG 0.7 14 NIN Intron 4 n.d.
    180 OT8 GaAGTTGgCcAAGAACTGGa GAG 0.6  7 None None 4 n.d.
    181 OT9 GCtGcTGCCcAAGAACTGGc AGG 0.6 11 AMOTL1 Intron 4 n.d.
    182 OT10 tCAGcTGgCTAAGAACgGGT AAG 0.6  7 ACTR3C Intron 4 n.d.
     70 CR6 Guide GGGGCTCCACCCTCACGAGT
    183 Target aGGGCTCCACCCTCACGAGT GGG X DMD Intron 1 19.9
    184 OT1 GcaGCTCagCCCTCACGAGT CAG 0.8  3 None None 4 n.d.
    185 OT2 GGGGCTtCAgCaTCACGAGT GAG 0.8  8 None None 3 n.d.
    186 OT3 GGGGCTCtcCCCTCACtAGT GAG 0.6  8 None None 3 n.d.
    187 OT4 GGGGaTCCACCtTCACcAGT CAG 0.6  2 None None 3 n.d.
    188 OT5 aGGGCTggACCCTCACaAGT AAG 0.4 16 AXIN1 Intron 4 n.d.
    189 OT6 tGGtCTCCtCCCcCACGAGT GGG 0.4  2 None None 4 n.d.
    190 OT7 aGGGCTCCcaCCcCACGAGT GAG 0.3  5 None None 4 n.d.
    191 OT8 GaGGCTCCAtaCTCACcAGT GAG 0.3 11 None None 4 n.d.
    192 OT9 GGaGCTgCcCCtTCACGAGT GGG 0.3  3 None None 4 n.d.
    193 OT10 atGaCTCCACCCTCAaGAGT AAG 0.3  8 AGPAT5 None 4 n.d.
    100 CR36 Guide GCCTTCTTTATCCCCTATCG
    194 Target GCCTTCTTTATCCCCTATCG AGG X DMD Intron 0 20.6
    195 OT1 GtCTgCTgTgTCCCCTATCG GGG 1.3 21 None None 4 n.d.
    196 OT2 cCCTTCTcTATCCCCTgTCG TGG 1.3  8 None None 3 n.d.
    197 OT3 GCCTTCTTTATCCCCTcTCt TGG 0.9 10 None None 2  0.5
    198 OT4 GCgcTCTTTtTCCCCTATCt TAG 0.6 16 None None 4 n.d.
    199 OT5 GCCcTCTgTcTCCCCTgTCG CAG 0.5  1 NFASC None 4 n.d.
    200 OT6 tCCATCTtTgTCCCCTATtG AGG 0.5 10 None None 4 n.d.
    201 OT7 aCCtTCTCTcTCCCCTATaG AGG 0.5  5 LOC100996485 Intron 4 n.d.
    202 OT8 GttTTCTTTtTCCCCTATgG GAG 0.5  3 None None 4 n.d.
    203 OT9 tgCTTCTTaATCCCCTATCa AAG 0.4  7 None None 4 n.d.
    204 OT10 aCCTTCTTacTCCCCTATCc GGG 0.4 10 ADARB2 None 4 n.d.
    n.d.: not detected.
  • The resulting PCR products were randomly melted and reannealed in a thermal cycler with the program: 95° C. for 240 s, followed by 85° C. for 60 s, 75° C. for 60 s, 65° C. for 60 s, 55° C. for 60 s, 45° C. for 60 s, 35° C. for 60 s, and 25° C. for 60 s with a −0.3° C./s rate between steps. Following reannealing, 8 μL of PCR product was mixed with 1 μL of Surveyor Nuclease S and 1 μL of Enhancer S (Transgenomic) and incubated at 42° C. for 1 hr. After incubation, 6 μL of digestion product was loaded onto a 10% TBE polyacrylamide gel and run at 200V for 30 min. The gels were stained with ethidium bromide and quantified using ImageLab (Bio-Rad) by densitometry as previously described (Guschin, et al. Meth Mol Biol 649, 247-256 (2010)).
  • Fluorescence-activated cell sorting of myoblasts. DMD myoblasts were electroporated with 5 micrograms each of hCas9-T2A-GFP and sgRNA expression vectors and incubated at 37° C. and 5% C02. Three days after electroporation, cells were trypsinized and collected for FACS sorting using a FACSvantage II sorting machine. GFP-positive cells were collected and grown for analysis.
  • PCR-based assay to detect genomic deletions. The exon 51 or exon 45-55 loci were amplified from genomic DNA by PCR (Invitrogen AccuPrime High Fidelity PCR kit) using primers flanking each locus. The flanking primers were CelI-CR1/2-F and CelI-CR5-R for exon 51 or CelI-CR6-F and CelI-CR36-R for exon 45-55 analysis (Table 4). PCR products were separated on TAE-agarose gels and stained with ethidium bromide for analysis.
  • PCR-based detection of translocations. Loci with predicted possible translocations were amplified by a two-step nested PCR (Invitrogen AccuPrime High Fidelity PCR kit for each step) of genomic DNA from cells transfected with Cas9 alone (control) or Cas9 with sgRNA. In the first step, translocations that may occur at each on-target and off-target sgRNA target site were amplified by 35 cycles of PCR using combinations of Surveyor primers for each locus that were modified to include restriction sites to facilitate cloning and sequencing analysis (Table 4). One microliter of each PCR reaction was subjected to a second round of amplification by 35 rounds of PCR using nested primer sets custom designed for each individual predicted translocation (Table 4). Each second nested PCR primer binds within the same approximate region within the primary amplicon; however, each pair was optimized using Primer3 online bioinformatics software to ensure specific detection of each translocation. PCR amplicons corresponding to the expected length of predicted translocations and only present in cells treated with sgRNA were purified (QIAGEN Gel Extraction kit) and analyzed by Sanger sequencing.
  • mRNA analysis. Immortalized myoblasts were differentiated into myofibers by replacing the growth medium with DMEM supplemented with 1% insulin-transferrin-selenium (Invitrogen #51500056) and 1% penicillin/streptomycin (Invitrogen #15140) for 5 days before the cells were trypsinized and collected. Total RNA was isolated from these cells using the RNeasy Plus Mini Kit (QIAGEN) according to the manufacturer's instructions. RNA was reverse transcribed to cDNA using the VILO cDNA synthesis kit (Life Technologies #11754) and 1.5 micrograms of RNA for 2 hrs at 42° C. according to the manufacturer's instructions. The target loci were amplified by 35 cycles of PCR with the AccuPrime High Fidelity PCR kit (Invitrogen) using primers annealing to exons 44 and 52 to detect exon 51 deletion by CR1/5 or CR2/5 or primers annealing to exons 44 and 60 to detect exon 45-55 deletion by CR6/36 (Table 4). PCR products were run on TAE-agarose gels and stained with ethidium bromide for analysis. The resolved PCR bands were cloned and analyzed by Sanger sequencing to verify the expected exon junctions. Table 5 lists the sequences of primers used in Example 4.
  • TABLE 5
    Sd
    EQ
    ID
    NO. Primer name Primer sequence Notes
    205 CelI-CR1/2-F GAGAGGTTATGTGGCTTTACCA Forward Surveyor primer for CR1/2
    206 CelI-CR1-R AAAAATGCTTCCCACTTTGC Reverse Surveyor primer for CR1
    207 CelI-CR2-R CTCATTCTCATGCCTGGACA Reverse Surveyor primer for CR2
    208 CelI-CR3-F GAGTTTGGCTCAAATTGTTACTCTT Forward Surveyor primer for CR3
    209 CelI-CR3-R GGGAAATGGTCTAGGAGAGTAAAGT Reverse Surveyor primer for CR3
    210 CelI-CR4/31-F GTTTGGCTCAAATTGTTACTCTTCA Forward Surveyor primer for CR4 or
    CR31
    211 CelI-CR4/31-R GTGAGAGTAATGTGTTTGCTGAGAG Reverse Surveyor primer for CR4 or
    CR31
    212 CelI-CR5-F CGGGCTTGGACAGAACTTAC Forward Surveyor primer for CR5
    213 CelI-CR5-R CTGCGTAGTGCCAAAACAAA Reverse Surveyor primer for CR5
    214 CelI-CR6-F TAATTTCATTGAAGAGTGGCTGAA Forward Surveyor primer for CR6
    215 CelI-CR6-R AAGCCCTGTGTGGTAGTAGTCAGT Reverse Surveyor primer for CR6
    216 CelI-CR7-F TGAGTCATGTTGGATAACCAGTCT Forward Surveyor primer for CR7
    217 CelI-CR7-R GAAGGTCAGGAACATACAATTCAA Reverse Surveyor primer for CR7
    218 CelI-CR10/11-F GATATGGGCATGTCAGTTTCATAG Forward Surveyor primer for CR10 or
    CR11
    219 CelI-CR10/11-R TGCTGTTGATTAATGGTTGATAGG Reverse Surveyor primer for CR10 or
    CR11
    220 CelI-CR12/13-F TTTTAAATTGCCATGTTTGTGTC Forward Surveyor primer for CR12 or
    CR13
    221 Cell-CR12/13-R ATGAATAACCTAATGGGCAGAAAA Reverse Surveyor primer for CR12 or
    CR13
    222 CelI-CR14/15-F TCAAGTCGCTTCATTTTGATAGAC Forward Surveyor primer for CR14 or
    CR15
    223 CelI-CR14/15-R CACAACAAAACATATAGCCAAAGC Reverse Surveyor primer for CR14 or
    CR15
    224 CelI-CR16/17-F TGCTGCTAAAATAACACAAATCAGT Forward Surveyor primer for CR16 or
    CR17
    225 CelI-CR16/17-R CTGTGCCTATTGTGGTTATCCTG Reverse Surveyor primer for CR16 or
    CR17
    226 CelI-CR18/19-F ATTGATCTGCAATACATGTGGAGT Forward Surveyor primer for CR18 or
    CR19
    227 CelI-CR18/19-R TTTGCCTCTGCTATTACAGTATGG Reverse Surveyor primer for CR18 or
    CR19
    228 CelI-CR20/21-F TGTAGGGTGGTTGGCTAAAATAAT Forward Surveyor primer for CR20 or
    CR21
    229 CelI-CR20/21-R TTTTTGCACAGTCAATAACACAAA Reverse Surveyor primer for CR20 or
    CR21
    230 CelI-CR22/23-F GGCTGGTCTCACAATTGTACTTTA Forward Surveyor primer for CR22 or
    CR23
    231 CelI-CR22/23-R CATTATGGACTGAAAATCTCAGCA Reverse Surveyor primer for CR22 or
    CR23
    232 CelI-CR24/25-F ATCATCCTAGCCATAACACAATGA Forward Surveyor primer for CR24 or
    CR25
    233 CelI-CR24/25-R TTCAGCTTTAACGTGATTTTCTGT Reverse Surveyor primer for CR24 or
    CR25
    234 CelI-CR26/27-F GGATTCAGAAGCTGTTTACGAAGT Forward Surveyor primer for CR26 or
    CR27
    235 CelI-CR26/27-R TTTAGCTGGATTGGAAAAACAAAT Reverse Surveyor primer for CR26 or
    CR27
    236 CelI-CR28/29-F AACTCACCCCATTGTTGGTATATT Forward Surveyor primer for CR28 or
    CR29
    237 CelI-CR28/29-R CCTTGTCCAAATACCGAAATACAT Reverse Surveyor primer for CR28 or
    CR29
    238 CelI-CR33-F CACATAATTCATGAACTTGGCTTC Forward Surveyor primer for CR33
    239 CelI-CR33-R TAGTAGCTGGGGAGGAAGATACAG Reverse Surveyor primer for CR33
    240 CelI-CR34-F TTTTTGTTTTAATTGCGACTGTGT Forward Surveyor primer for CR34
    241 CelI-CR34-R AGAAAAGGGGTTTTCTTTTGACTT Reverse Surveyor primer for CR34
    242 CelI-CR35-F CATTGTGACTGGATGAGAAGAAAC Forward Surveyor primer for CR35
    243 CelI-CR35-R AACGGCTGTTATTAAAGTCCTCAG Reverse Surveyor primer for CR35
    244 CelI-CR36-F CAAGTCAGAAGTCACTTGCTTTGT Forward Surveyor primer for CR36
    245 CelI-CR36-R TTTTATGTGCAGGAATCAGTCTGT Reverse Surveyor primer for CR36
    246 Dys-E44-F TGGCGGCGTTTTCATTAT Forward RT-PCR primer binding in
    exon 44
    247 Dys-E52-R TTCGATCCGTAATGATTGTTCTAGCC Reverse RT-PCR primer binding in
    exon 52
    248 Dys-E60-R GGTCTTCCAGAGTGCTGAGG Reverse RT-PCR primer binding in
    exon 60
    249 CR3-CelI-OT1-F TGTGTGCTTCTGTACACATCATCT Forward Surveyor primer for CR3 off-
    target 1
    250 CR3-CelI-OT1-R AGATTTCAACCCTCAAAAACTGAG Reverse Surveyor primer for CR3 off-
    target 1
    251 CR3-CelI-OT2-F TAAACTCTTTCTTTTCCGCAATTC Forward Surveyor primer for CR3 off-
    target 2
    252 CR3-CelI-OT2-R CAAGGTGACCTGCTACCTAAAAAT Reverse Surveyor primer for CR3 off-
    target 2
    253 CR3-CelI-OT3-F TATGACCAAGGCTATGTGTTCACT Forward Surveyor primer for CR3 off-
    target 3
    254 CR3-CelI-OT3-R ACAGCCTCTCTCCAGTAACATTCT Reverse Surveyor primer for CR3 off-
    target 3
    255 CR3-CelI-OT4-F TATTCTTGCAGTGGTTTCACATTT Forward Surveyor primer for CR3 off-
    target 4
    256 CR3-CelI-OT4-R ATATTTTAAGCCAAGACCCAACAA Reverse Surveyor primer for CR3 off-
    target 4
    257 CR3-CelI-OT5-F CTTTCAACTGTCTGTCTGATTGCT Forward Surveyor primer for CR3 off-
    target 5
    258 CR3-CelI-OT5-R AACAGCCTCTCTTCATTGTTCTCT Reverse Surveyor primer for CR3 off-
    target 5
    259 CR3-CelI-OT6-F CTCTGGAACTTGTCTCTGTCTTGA Forward Surveyor primer for CR3 off-
    target 6
    260 CR3-CelI-OT6-R CTTTCCTGCGTTCTCATGTTACTA Reverse Surveyor primer for CR3 off-
    target 6
    261 CR3-CelI-OT7-F CCTTATATCCGTATCGCTCACTCT Forward Surveyor primer for CR3 off-
    target 7
    262 CR3-CelI-OT7-R CATATCTGTCTAACTTCCGCACAC Reverse Surveyor primer for CR3 off-
    target 7
    263 CR3-CelI-OT8-F ACAGGTGTTATGTTGTCTGCATCT Forward Surveyor primer for CR3 off-
    target 8
    264 CR3-CelI-OT8-R ACTCCATTCCCAGATTAGTTATGC Reverse Surveyor primer for CR3 off-
    target 8
    265 CR3-CelI-OT9-F CTGTTTTCTTTGTGAGAGTGGAGA Forward Surveyor primer for CR3 off-
    target 9
    266 CR3-CelI-OT9-R TGTAAGGTGGTCAAACTTGCTCTA Reverse Surveyor primer for CR3 off-
    target 9
    267 CR3-CelI-OT10-F TTTTTCCTAGTACCCACAGATTTTT Forward Surveyor primer for CR3 off-
    target 10
    268 CR3-CelI-OT10-R TCCCTGATTCTCTCATTTGTGTTA Reverse Surveyor primer for CR3 off-
    target 10
    269 CR1-CelI-OT1-F TTGGGAACATCAGAGAAAGTATGA Forward Surveyor primer for CR1 off-
    target 1
    270 CR1-CelI-OT1-R ACAAATTACAGTCTCCTGGGAAAG Reverse Surveyor primer for CR1 off-
    target 1
    271 CR1-CelI-OT2-F AGTAGCTTACCTTGGCAGAGAAAA Forward Surveyor primer for CR1 off-
    target 2
    272 CR1-CelI-OT2-R TGACATACTGTTACCCTTTGCAGT Reverse Surveyor primer for CR1 off-
    target 2
    273 CR1-CelI-OT3-F GAAAGGCTCAGTGAATGTTTGTT Forward Surveyor primer for CR1 off-
    target 3
    274 CR1-CelI-OT3-R CACTGCATCATCTCATTAAATCAA Reverse Surveyor primer for CR1 off-
    target 3
    275 CR1-CelI-OT4-F CCCATATATTCATGATTACCCACA Forward Surveyor primer for CR1 off-
    target 4
    276 CR1-CelI-OT4-R TATCAGAACGAGCACTAAAAGCAC Reverse Surveyor primer for CR1 off-
    target 4
    277 CR1-CelI-OT5-F TTGGGAGGCTGAGGTACAAG Forward Surveyor primer for CR1 off-
    target 5
    278 CR1-CelI-OT5-R GAATGAAAAACAAACAGAAGGTGA Reverse Surveyor primer for CR1 off-
    target 5
    279 CR1-CelI-OT6-F CTCCTCATCTGTACCCTTCAATCT Forward Surveyor primer for CR1 off-
    target 6
    280 CR1-CelI-OT6-R AGAGTGGCATCTAGTGTCAGTGAG Reverse Surveyor primer for CR1 off-
    target 6
    281 CR1-CelI-OT7-F TACCAAAAGCTTCTCCTGTTTACC Forward Surveyor primer for CR1 off-
    target 7
    282 CR1-CelI-OT7-R GTAAGTTGGATGGCCTATTCTTTG Reverse Surveyor primer for CR1 off-
    target 7
    283 CR1-CelI-OT8-F GAAGGAAATGCAAGGATACAAGAT Forward Surveyor primer for CR1 off-
    target 8
    284 CR1-CelI-OT8-R TGATTGAAAGAATCATTCCAGAAA Reverse Surveyor primer for CR1 off-
    target 8
    285 CR1-CelI-OT9-F TCAGAAGGAAAATTGAAATTGGTT Forward Surveyor primer for CR1 off-
    target 9
    286 CR1-CelI-OT9-R CAGATGTGTTCTTCATCATTCCTC Reverse Surveyor primer for CR1 off-
    target 9
    287 CR1-CelI-OT10-F TTCTCTTTAGGGAAAGCTCTCAAA Forward Surveyor primer for CR1 off-
    target 10
    288 CR1-CelI-OT10-R GGGTATAGATCATATGGAGGGAAG Reverse Surveyor primer for CR1 off-
    target 10
    289 CR5-CelI-OT1-F AGATGATCTGCCCACCTCAG Forward Surveyor primer for CR5 off-
    target 1
    290 CR5-CelI-OT1-R CTTTCTTCCTCATTTAGTGGCAAT Reverse Surveyor primer for CR5 off-
    target 1
    291 CR5-CelI-OT2-F ATGAATTGCAGATTGATGGTACTG Forward Surveyor primer for CR5 off-
    target 2
    292 CR5-CelI-OT2-R TCTCACCAAGAACCAAATTGTCTA Reverse Surveyor primer for CR5 off-
    target 2
    293 CR5-CelI-OT3-F GTAGGATACCTTGGCAACAGTCTT Forward Surveyor primer for CR5 off-
    target 3
    294 CR5-CelI-OT3-R TTAACGAATTGTGAGATTTGCTGT Reverse Surveyor primer for CR5 off-
    target 3
    295 CR5-CelI-OT4-F TCAGAAAGTCAAGTAGCACACACA Forward Surveyor primer for CR5 off-
    target 4
    296 CR5-CelI-OT4-R AGAAGCACACACTCAGGTAAAGC Reverse Surveyor primer for CR5 off-
    target 4
    297 CR5-CelI-OT5-F TCTTTGGGGGAATAATGACTAAAA Forward Surveyor primer for CR5 off-
    target 5
    298 CR5-CelI-OT5-R TTTGGCATTTATGGGAATAAAACT Reverse Surveyor primer for CR5 off-
    target 5
    299 CR5-CelI-OT6-F ACTAATTCTGGTCAAGCCCATCA Forward Surveyor primer for CR5 off-
    target 6
    300 CR5-CelI-OT6-R TTAAGACATCGGATGAACAGAAAG Reverse Surveyor primer for CR5 off-
    target 6
    301 CR5-CelI-OT7-F AGAAGCTTTCTGACATGATCTGC Forward Surveyor primer for CR5 off-
    target 7
    302 CR5-CelI-OT7-R TCAATTGCATTAGGACTTAGACCA Reverse Surveyor primer for CR5 off-
    target 7
    303 CR5-CelI-OT8-F GTTAAATTACCTGTGAAGCCCTTG Forward Surveyor primer for CR5 off-
    target 8
    304 CR5-CelI-OT8-R CGGAAAACAGATCCACTTTATGAT Reverse Surveyor primer for CR5 off-
    target 8
    305 CR5-CelI-OT9-F AAATCCACTGGAAACATCTTGAGT Forward Surveyor primer for CR5 off-
    target 9
    306 CR5-CelI-OT9-R AGTCTCTTCAGAATCATGCCCTAT Reverse Surveyor primer for CR5 off-
    target 9
    307 CR5-CelI-OT10-F GCTTGGTGGCACATACCTGTAG Forward Surveyor primer for CR5 off-
    target 10
    308 CR5-CelI-OT1O-R GGTAGGTAGATTTGCTTGCTTGTT Reverse Surveyor primer for CR5 off-
    target 10
    309 CR6-CelI-OT1-F AGCTCTCAGCAGAGTAGGGATTTA Forward Surveyor primer for CR6 off-
    target 1
    310 CR6-CelI-OT1-R GTGAGTCTACTGCACCCCATC Reverse Surveyor primer for CR6 off-
    target 1
    311 CR6-CelI-OT2-F TGACACTGTGAAGTCAATTCTGTC Forward Surveyor primer for CR6 off-
    target 2
    312 CR6-CelI-OT2-R TCAAGAACTTGACAATGAGCAAAT Reverse Surveyor primer for CR6 off-
    target 2
    313 CR6-CelI-OT3-F TATCCGATCCACTGTTGTGTGT Forward Surveyor primer for CR6 off-
    target 3
    314 CR6-CelI-OT3-R CAGGAGACCCAAAACCACTCTAC Reverse Surveyor primer for CR6 off-
    target 3
    315 CR6-CelI-OT4-F TTGTTCTACAAATAGGGCTTCCTT Forward Surveyor primer for CR6 off-
    target 4
    316 CR6-CelI-OT4-R TGTTAAGTTTGGGCTTATGTTCCT Reverse Surveyor primer for CR6 off-
    target 4
    317 CR6-CelI-OT5-F CACAAGTCTCACTGCACAAACAT Forward Surveyor primer for CR6 off-
    target 5
    318 CR6-CelI-OT5-R TGACCCATGATTATCTCTCTTTGA Reverse Surveyor primer for CR6 off-
    target 5
    319 CR6-CelI-OT6-F TTCAGCTTCTGATTGGTTTTAATG Forward Surveyor primer for CR6 off-
    target 6
    320 CR6-CelI-OT6-R CCAATTCCTTAATTTTCCCTACAG Reverse Surveyor primer for CR6 off-
    target 6
    321 CR6-CelI-OT7-F ATCTCAGACCAGGAGGGAGAC Forward Surveyor primer for CR6 off-
    target 7
    322 CR6-CelI-OT7-R CCTCAGGGTCAGTACATTTTTCAG Reverse Surveyor primer for CR6 off-
    target 7
    323 CR6-CelI-OT8-F TTCTTAGGACATTGCTCCACATAC Forward Surveyor primer for CR6 off-
    target 8
    324 CR6-CelI-OT8-R GCAAACATAATGCAACTCGTAATC Reverse Surveyor primer for CR6 off-
    target 8
    325 CR6-CelI-OT9-F GCAAGGGAGTCTGTGTCTTTG Forward Surveyor primer for CR6 off-
    target 9
    326 CR6-CelI-OT9-R TCATTTAAGTGGCTGTTCTGTGTT Reverse Surveyor primer for CR6 off-
    target 9
    327 CR6-CelI-OT10-F ACAAAACAGAGAGAAAAGGCAGAG Forward Surveyor primer for CR6 off-
    target 10
    328 CR6-CelI-OT10-R GTTTTGATTTCTGGTGCCTACAG Reverse Surveyor primer for CR6 off-
    target 10
    329 CR36-CelI-OT1-F ACTGAAGCTGAAGCCCAGTC Forward Surveyor primer for CR36
    off-target 1
    330 CR36-CelI-OT1-R ACATGAGCTCTCAGGTTTCTGAC Reverse Surveyor primer for CR36
    off-target 1
    331 CR36-CelI-OT2-F TCAAACTTAGATGGTTCCCTATGTT Forward Surveyor primer for CR36
    off-target 2
    332 CR36-CelI-OT2-R GTACCCTGAAAATGTAGGGTGACT Reverse Surveyor primer for CR36
    off-target 2
    333 CR36-CelI-OT3-F CACTTCCCAAGTGAGGCAAT Forward Surveyor primer for CR36
    off-target 3
    334 CR36-CelI-OT3-R CTATACTTGGGGCTGACTTGCTAC Reverse Surveyor primer for CR36
    off-target 3
    335 CR36-CelI-OT4-F TCGTATAGGTTACTTTGGCTCACA Forward Surveyor primer for CR36
    off-target 4
    336 CR36-CelI-OT4-R AGGGATCTTTACTCCTCAGTGTGT Reverse Surveyor primer for CR36
    off-target 4
    337 CR36-CelI-OT5-F TGTAGAAGTTGGAATATCCTGCTG Forward Surveyor primer for CR36
    off-target 5
    338 CR36-CelI-OT5-R GTCAACAATTTGATCTCAGGCTTC Reverse Surveyor primer for CR36
    off-target 5
    339 CR36-CelI-OT6-F CTCAGTACTAAAGATGGACGCTTG Forward Surveyor primer for CR36
    off-target 6
    340 CR36-CelI-OT6-R AATCATTTCAGTCTTCCCAACAAT Reverse Surveyor primer for CR36
    off-target 6
    341 CR36-CelI-OT7-F GGGAATCACAGTAGATGTTTGTCA Forward Surveyor primer for CR36
    off-target 7
    342 CR36-CelI-OT7-R AGACCAGGAGGTAAGAACATTTTG Reverse Surveyor primer for CR36
    off-target 7
    343 CR36-CelI-OT8-F CCACATAGAAAGAGACTTGCAGAA Forward Surveyor primer for CR36
    off-target 8
    344 CR36-CelI-OT8-R AGAGATGCCAAAAGAACAGTCAAT Reverse Surveyor primer for CR36
    off-target 8
    345 CR36-CelI-OT9-F TGTGCCTTAGGCTATGTAAACTGT Forward Surveyor primer for CR36
    off-target 9
    346 CR36-CelI-OT9-R AAACCCTTGTAACCAAAATTACCA Reverse Surveyor primer for CR36
    off-target 9
    347 CR36-CelI-OT10-F TAACTGCATCAGAAGTCCTTGCTA Forward Surveyor primer for CR36
    off-target 10
    348 CR36-Cell-OT10-R GGAGACCAAGCTGCTAAAGTCA Reverse Surveyor primer for CR36
    off-target 10
    349 CelI-CR3-F-nested GTGGTGccgcggGAGTTTGGCTCAAAT Nested PCR first round primers
    TGTTACTCTT
    350 CelI-CR3-R-nested GTGGTGccgcggGGGAAATGGTCTAGG Nested PCR first round primers
    AGAGTAAAGT
    351 CelI-CR1-F-nested GTGGTGccgcggGAGAGGTTATGTGGC Nested PCR first round primers
    TTTACCA
    352 CelI-CR1-R-nested GTGGTGccgcggCTCATTCTCATGCCTG Nested PCR first round primers
    GACA
    353 CelI-CR5-F-nested GTGGTGccgcggCGGGCTTGGACAGAA Nested PCR first round primers
    CTTAC
    354 CelI-CR5-R-nested GTGGTGccgcggCTGCGTAGTGCCAAA Nested PCR first round primers
    ACAAA
    355 CelI-CR6-F-nested GTGGTGccgcggTAATTTCATTGAAGA Nested PCR first round primers
    GTGGCTGAA
    356 CelI-CR6-R-nested GTGGTGccgcggAAGCCCTGTGTGGTA Nested PCR first round primers
    GTAGTCAGT
    357 CelI-CR36-F-nested GTGGTGccgcggCAAGTCAGAAGTCAC Nested PCR first round primers
    TTGCTTTGT
    358 CelI-CR36-R-nested GTGGTGccgcggTTTTATGTGCAGGAA Nested PCR first round primers
    TCAGTCTGT
    359 CR3-CelI-OT1-F-nested GTGGTGccgcggTGTGTGCTTCTGTACA Nested PCR first round primers
    CATCATCT
    360 CR3-CelI-OT1-R-nested GTGGTGccgcggAGATTTCAACCCTCA Nested PCR first round primers
    AAAACTGAG
    361 CR1-CelI-OT1-F-nested GTGGTGccgcggTTGGGAACATCAGAG Nested PCR first round primers
    AAAGTATGA
    362 CR1-CelI-OT1-R-nested GTGGTGccgcggACAAATTACAGTCTC Nested PCR first round primers
    CTGGGAAAG
    363 CR36-CelI-OT3-F-nested GTGGTGccgcggCACTTCCCAAGTGAG Nested PCR first round primers
    GCAAT
    364 CR36-CelI-OT3-R-nested GTGGTGccgcggCTATACTTGGGGCTG Nested PCR first round primers
    ACTTGCTAC
    365 CR3-P1/P3-F GTGGTGccgcggTTGGCTCTTTAGCTTG Nested PCR second round primers
    TGTTTC
    366 CR3-P1/P3-R GTGGTGccgcggTGAGACTCCCAAAGG Nested PCR second round primers
    CAATC
    367 CR3-P1/P4-F GTGGTGccgcggTTGGCTCTTTAGCTTG Nested PCR second round primers
    TGTTTC
    368 CR3-P1/P4-R GTGGTGccgcggACTGAGGGGTGATCT Nested PCR second round primers
    TGGTG
    369 CR3-P2/P3-F GTGGTGccgcggGCAGAGAAAGCCAGT Nested PCR second round primers
    CGGTA
    370 CR3-P2/P3-R GTGGTGccgcggTGAGACTCCCAAAGG Nested PCR second round primers
    CAATC
    371 CR3-P2/P4-F GTGGTGccgcggGCAGAGAAAGCCAGT Nested PCR second round primers
    CGGTA
    372 CR3-P2/P4-R GTGGTGccgcggACTGAGGGGTGATCT Nested PCR second round primers
    TGGTG
    373 CR1-P1/P5-F GTGGTGccgcggCCAGAGTTCCTAGGG Nested PCR second round primers
    CAGAG
    374 CR1-P1/P5-R GTGGTGccgcggAGCTAGTCCCCACAT Nested PCR second round primers
    TCCAC
    375 CR1-P1/P6-F GTGGTGccgcggCCAGAGTTCCTAGGG Nested PCR second round primers
    CAGAG
    376 CR1-P1/P6-R GTGGTGccgcggGGTGGAGGGAAACTT Nested PCR second round primers
    TAGGC
    377 CR1-P2/P5-F GTGGTGccgcggCTCATTCTCATGCCTG Nested PCR second round primers
    GACA
    378 CR1-P2/P5-R GTGGTGccgcggAGCTAGTCCCCACAT Nested PCR second round primers
    TCCAC
    379 CR1-P2/P6-F GTGGTGccgcggTCTCATGCCTGGACA Nested PCR second round primers
    AGTAACT
    380 CR1-P2/P6-R GTGGTGccgcggGGTGGAGGGAAACTT Nested PCR second round primers
    TAGGC
    381 CR5-P3/P5-F GTGGTGccgcggGGCTTGGACAGAACT Nested PCR second round primers
    TACCG
    382 CR5-P3/P5-R GTGGTGccgcggCACCACTGTCTGCCT Nested PCR second round primers
    AAGGA
    383 CR5-P4/P6-F GTGGTGccgcggGGCTTGGACAGAACT Nested PCR second round primers
    TACCG
    384 CR5-P4/P6-R GTGGTGccgcggGGTGGAGGGAAACTT Nested PCR second round primers
    TAGGC
    385 CR5-P3/P5-F GTGGTGccgcggCGTAGTGCCAAAACA Nested PCR second round primers
    AACAGT
    386 CR5-P3/P5-R GTGGTGccgcggCACCACTGTCTGCCT Nested PCR second round primers
    AAGGA
    387 CR5-P4/P6-F GTGGTGccgcggCGTAGTGCCAAAACA Nested PCR second round primers
    AACAGT
    388 CR5-P4/P6-R GTGGTGccgcggGGTGGAGGGAAACTT Nested PCR second round primers
    TAGGC
    389 CR6-P1/P5-F GTGGTGccgcggGCGAGGGCCTACTTG Nested PCR second round primers
    ATATG
    390 CR6-P1/P5-R GTGGTGccgcggCTTCCCAAGTGAGGC Nested PCR second round primers
    AATGC
    391 CR6-P1/P6-F GTGGTGccgcggACGTTTTGTGCTGCTG Nested PCR second round primers
    TAACA
    392 CR6-P1/P6-R GTGGTGccgcggCTGCAGGCACATTCT Nested PCR second round primers
    CTTCC
    393 CR6-P2/P5-F GTGGTGccgcggGCCCTGTGTGGTAGT Nested PCR second round primers
    AGTCA
    394 CR6-P2/P5-R GTGGTGccgcggCTTCCCAAGTGAGGC Nested PCR second round primers
    AATGC
    395 CR6-P2/P6-F GTGGTGccgcggCAGTATTAAGGGGTG Nested PCR second round primers
    GGAGCT
    396 CR6-P2/P6-R GTGGTGccgcggTCTCTTCCTCACACAG Nested PCR second round primers
    CTGA
    397 CR36-P3/P5-F GTGGTGccgcggGGAGCTTGGAGGGAA Nested PCR second round primers
    GAGAA
    398 CR36-P3/P5-R GTGGTGccgcggCTTCCCAAGTGAGGC Nested PCR second round primers
    AATGC
    399 CR36-P4/P6-F GTGGTGccgcggATGGATGGGGAAGAC Nested PCR second round primers
    ACTGG
    400 CR36-P4/P6-R GTGGTGccgcggCTGCAGGCACATTCT Nested PCR second round primers
    CTTCC
    401 CR36-P3/P5-F GTGGTGccgcggGGATGAAACAGGGCA Nested PCR second round primers
    GGAAC
    402 CR36-P3/P5-R GTGGTGccgcggTTCCCAAGTGAGGCA Nested PCR second round primers
    ATGC
    403 CR36-P4/P6-F GTGGTGccgcggTTTGCAGAGCCATGA Nested PCR second round primers
    TGAGG
    404 CR36-P4/P6-R GTGGTGccgcggCGACAGCCAAAACAG Nested PCR second round primers
    CCG
  • Western blot analysis. To assess dystrophin protein expression, immortalized myoblasts were differentiated into myofibers by replacing the growth medium with DMEM supplemented with 1% insulin-transferrin-selenium (Invitrogen) and 1% antibiotic/antimycotic (Invitrogen) for 4-7 days, such as 6 or 7 days. Fibroblasts were transdifferentiated into myoblasts by inducing MyoD overexpression and incubating the cells in DMEM supplemented with 1% insulin-transferrin-selenium (Invitrogen), 1% antibiotic/antimycotic (Invitrogen) and 3 μg/mL doxycycline for 15 days. Dystrophin expression was assessed at 3 days after transfecting HEK293T cells. Cells were trypsinized, collected and lysed in RIPA buffer (Sigma) supplemented with a protease inhibitor cocktail (Sigma) and the total protein amount was quantified using the bicinchoninic acid assay according to the manufacturer's instructions (Pierce). Samples were then mixed with NuPAGE loading buffer (Invitrogen) and 5% β-mercaptoethanol and heated to 85° C. for 10 minutes. Twenty-five micrograms of protein were separated on 4-12% NuPAGE Bis-Tris gels (Invitrogen) with MES buffer (Invitrogen). Proteins were transferred to nitrocellulose membranes for 1-2 hrs in transfer buffer containing 10-20% methanol, such as 10% methanol, and 0.01% SDS. The blot was then blocked for 1 hr with 5% milk-TBST at room temperature. Blots were probed with the following primary antibodies: MANDYS8 to detect dystrophin (1:100, Sigma D8168) and rabbit anti-GAPDH (1:5000, Cell Signaling 2118S). Blots were then incubated with mouse or rabbit horseradish peroxidase-conjugated secondary antibodies (Santa Cruz) and visualized using the ChemiDoc chemilumescent system (BioRad) and Western-C ECL substrate (BioRad).
  • Transplantation into immunodeficient mice. All animal experiments were conducted under protocols approved by the Duke Institutional Animal Care & Use Committee. Cells were trypsinized, collected and washed in 1× Hank's Balanced Salt Solution (HBSS, Sigma). Two million cells were pelleted and resuspended in five μL 1×HBSS (Sigma) supplemented with cardiotoxin (Sigma #C9759) immediately prior to injection. These cells were transplanted into the hind limb tibialis anterior (TA) muscle of NOD.SCID.gamma (NSG) mice (Duke CCIF Breeding Core) by intramuscular injection. Four weeks after injection, mice were euthanized and the TA muscles were harvested.
  • Immunofluorescence staining. Harvested TA muscles were incubated in 30% glycerol overnight at 4° C. before mounting and freezing in Optimal Cutting Temperature compound. Serial 10 micron sections were obtained by cryosectioning of the embedded muscle tissue at −20° C. Cryosections were then washed in PBS to remove the OCT compound and subsequently blocked for 30-60 minutes at room temperature in PBS containing 10% heat-inactivated fetal bovine serum for spectrin detection or 5% heat-inactivated fetal bovine serum for dystrophin detection. Cryosections were incubated overnight at 4° C. with the following primary antibodies that are specific to human epitopes only: anti-spectrin (1:20, Leica NCL-SPEC1) or anti-dystrophin (1:2, Leica NCL-DYS3). After primary staining, spectrin or dystrophin expression was detected using a tyramide-based immunofluorescence signal amplification detection kit (Life Technologies, TSA Kit #22, catalog #T-20932,). Briefly, cryosections were incubated with 1:200 goat anti-mouse biotin-XX secondary (Life Technologies #B2763) in blocking buffer for 1 hr at room temperature. The signal was then amplified using streptavidin-HRP conjugates (1:100, from TSA Kit) in blocking buffer for 1 hr at room temperature. Finally, cryosections were incubated with tyramide-AlexaFluor488 conjugates (1:100, TSA kit) in manufacturer-provided amplification buffer for 10 minutes at room temperature. Stained cryosections were then mounted in ProLong AntiFade (Life Technologies #P36934) and visualized with conventional fluorescence microscopy.
  • Cytotoxicity assay. To quantitatively assess potential sgRNA or SpCas9 nuclease-associated cytotoxicity, HEK293T cells were transfected with 10 ng of a GFP reporter and 100 ng SpCas9 expression vector and 100 ng sgRNA expression vector using Lipofectamine 2000 according to the manufacturer's instructions (Invitrogen). The percentage of GFP positive cells was assessed at 2 and 5 days by flow cytometry. The survival rate was calculated as the decrease in GFP positive cells from days 2 to 5 and normalized to cells transfected with an empty nuclease expression vector as described (Cornu et al., Meth Mol Biol 649:237-245 (2010)).
  • Example 4 CRISPRs Targeting the Dystrophin Gene—Results
  • The CRISPR/Cas9-based system was designed to target the dystrophin gene. Various gRNAs were chosen to target different regions of the human and mouse dystrophin gene based on NNNNN NNNNN NNNNN NNNNN NGG (SEQ ID NO: 677) and GNNNN NNNNN NNNNN NNNNN NGG (SEQ ID NO: 678) (see Tables 6, 7 and 8).
  • TABLE 6
    Name
    (SEQ ID 19 bp for chimeric (add G on
    NO) Species Gene Target Strand 5′ end) PAM
    DCR1 Human DMD Intron 50 + attggctttgatttcccta (SEQ ID GGG
    (628) NO: 65)
    DCR2 Human DMD Intron 50 tgtagagtaagtcagccta (SEQ ID TGG
    (66) NO: 679)
    DCR3 Human DMD Exon 51-55′ + cctactcagactgttactc (SEQ ID TGG
    (629) NO: 67)
    DCR4 Human DMD Exon 51-53′ + ttggacagaacttaccgac (SEQ ID TGG
    (68) NO: 680)
    DCR5 Human DMD Intron 51 cagttgcctaagaactggt (SEQ ID GGG
    (630) NO: 69)
    DCR6 Human DMD Intron 44 GGGCTCCACCCTCACGAG GGG
    (631) T (SEQ ID NO: 70)
    DCR7 Human DMD Intron 55 + TTTGCTTCGCTATAAAACG AGG
    (71) (SEQ ID NO: 681)
    DCR8 Human DMD Exon 41 + TCTGAGGATGGGGCCGCA TGG
    (72) A (SEQ ID NO: 682)
    DCR9 Human DMD Exon 44 GATCTGTCAAATCGCCTGC AGG
    (73) (SEQ ID NO: 683)
    DCR10 Human DMD Exon 45 + CCAGGATGGCATTGGGCA CGG
    (74) G (SEQ ID NO: 684)
    DCR11 Human DMD Exon 45 + CTGAATCTGCGGTGGCAG AGG
    (75) G (SEQ ID NO: 685)
    DCR12 Human DMD Exon 46 TTCTTTTGTTCTTCTAGCc TGG
    (76) (SEQ ID NO: 686)
    DCR13 Human DMD Exon 46 + GAAAAGCTTGAGCAAGTC AGG
    (77) A (SEQ ID NO: 687)
    DCR14 Human DMD Exon 47 + GAAGAGTTGCCCCTGCGC AGG
    (78) C (SEQ ID NO: 688)
    DCR15 Human DMD Exon 47 + ACAAATCTCCAGTGGATA AGG
    (79) A (SEQ ID NO: 689)
    DCR16 Human DMD Exon 48 TGTTTCTCAGGTAAAGCTC TGG
    (80) (SEQ ID NO: 690)
    DCR17 Human DMD Exon 48 + GAAGGACCATTTGACGTTa AGG
    (81) (SEQ ID NO: 691)
    DCR18 Human DMD Exon 49 AACTGCTATTTCAGTTTCc TGG
    (82) (SEQ ID NO: 692)
    DCR19 Human DMD Exon 49 + CCAGCCACTCAGCCAGTG AGG
    (83) A (SEQ ID NO: 693)
    DCR20 Human DMD Exon 50 + gtatgcttttctgttaaag (SEQ ID AGG
    (84) NO: 694)
    DCR21 Human DMD Exon 50 + CTCCTGGACTGACCACTAT TGG
    (85) (SEQ ID NO: 695)
    DCR22 Human DMD Exon 52 + GAACAGAGGCGTCCCCAG TGG
    (86) T (SEQ ID NO: 696)
    DCR23 Human DMD Exon 52 + GAGGCTAGAACAATCATT CGG
    (87) A (SEQ ID NO: 697)
    DCR24 Human DMD Exon 53 + ACAAGAACACCTTCAGAA CGG
    (88) C (SEQ ID NO: 698)
    DCR25 Human DMD Exon 53 GGTTTCTGTGATTTTCTTT TGG
    (89) (SEQ ID NO: 699)
    DCR26 Human DMD Exon 54 + GGCCAAAGACCTCCGCCA TGG
    (90) G (SEQ ID NO: 700)
    DCR27 Human DMD Exon 54 + TTGGAGAAGCATTCATAA AGG
    (91) A (SEQ ID NO: 701)
    DCR28 Human DMD Exon 55 TCGCTCACTCACCctgcaa AGG
    (92) (SEQ ID NO: 702)
    DCR29 Human DMD Exon 55 + AAAAGAGCTGATGAAACA TGG
    (93) A (SEQ ID NO: 703)
    DCR30 Human DMD 5′UTR/Exon 1 + TAcACTTTTCaAAATGCTT TGG
    (94) (SEQ ID NO: 704)
    DCR31 Human DMD Exon 51 + gagatgatcatcaagcaga (SEQ ID AGG
    (95) NO: 705)
    DCR32 Mouse DMD mdx + ctttgaaagagcaaTaaaa (SEQ ID TGG
    (96) mutation NO: 706)
    DCR33 Human DMD Intron 44 CACAAAAGTCAAATCGGA TGG
    (97) A (SEQ ID NO: 707)
    DCR34 Human DMD Intron 44 ATTTCAATATAAGATTCGG AGG
    (98) (SEQ ID NO: 708)
    DCR35 Human DMD Intron 55 CTTAAGCAATCCCGAACTC TGG
    (99) (SEQ ID NO: 709)
    DCR36 Human DMD Intron 55 CCTTCTTTATCCCCTATCG AGG
    (632) (SEQ ID NO: 100)
    DCR40 Mouse DMD Exon 23 aggccaaacctcggcttac (SEQ ID NNGRR
    (104) NO: 710)
    DCR41 Mouse DMD Exon 23 + TTCGAAAATTTCAGgtaag NNGRR
    (105) (SEQ ID NO: 711)
    DCR42 Mouse DMD Exon 23 + gcagaacaggagataacag (SEQ ID NNGRRT
    (106) NO: 712)
    DCR43 Mouse ACVR2B Exon 1 + gcggccctcgcccttctct (SEQ ID ggggat
    (107) NO: 713)
    DCR48 Human DMD Intron 45 TAGTGATCGTGGATACGA AGG
    (108) G (SEQ ID NO: 714)
    DCR49 Human DMD Intron 45 TACAGCCCTCGGTGTATAT TGG
    (109) (SEQ ID NO: 715)
    DCR50 Human DMD Intron 52 GGAAGGAATTAAGCCCGA TGG
    (110) A (SEQ ID NO: 716)
    DCR51 Human DMD Intron 53 GGAACAGCTTTCGTAGTTG AGG
    (111) (SEQ ID NO: 718)
    DCR52 Human DMD Intron 54 + ATAAAGTCCAGTGTCGAT AGG
    (112) C (SEQ ID NO: 719)
    DCR53 Intron 54 + AAAACCAGAGCTTCGGTC AGG
    (113) A (SEQ ID NO: 720)
    DCR54 Mouse Rosa26 ZFN + GAGTCTTCTGGGCAGGCTT TGG
    (114) region AAAGGCTAACC (SEQ ID
    NO: 720)
    DCR55 Mouse Rosa26 mRNA TCGGGTGAGCATGTCTTTA TGG
    (115) ATCTACCTCGA (SEQ ID
    NO: 721)
    DCR49 Human DMD Ex 51 gtgtcaccagagtaacagt (SEQ ID ctgagt
    (116) NO: 722)
    DCR50 Human DMD Ex 51 + tgatcatcaagcagaaggt (SEQ ID atgag
    (117) NO: 723)
    DCR60 Mouse DMD Exon 23 + AACTTCGAAAATTTCAGgta agccgagg
    (118) (SEQ ID NO: 724)
    DCR61 Mouse DMD Intron 22 + gaaactcatcaaatatgcgt (SEQ ID gttagtgt
    (119) NO: 725)
    DCR62 Mouse DMD Intron 22 tcatttacactaacacgcat (SEQ ID atttgatg
    (120) NO: 726)
    DCR63 Mouse DMD Intron 22 + gaatgaaactcatcaaatat (SEQ ID gcgtgtta
    (121) NO: 727)
    DCR64 Mouse DMD Intron 23 tcatcaatatctttgaagga (SEQ ID ctctgggt
    (122) NO: 728)
    DCR65 Mouse DMD Intron 23 tgttttcataggaaaaatag (SEQ ID gcaagttg
    (123) NO: 729)
    DCR66 Mouse DMD Intron 23 + aattggaaaatgtgatggga (SEQ ID aacagata
    (124) NO: 730)
    DCR67 Human DMD Exon 51 + atgatcatcaagcagaaggt (SEQ ID atgagaaa
    (125) NO: 731)
    DCR68 Human DMD Exon 51 + agatgatcatcaagcagaag (SEQ ID gtatgaga
    (126) NO: 732)
    DCR69 Human DMD Exon 51 cattttttctcataccttct (SEQ ID gcttgatg
    (127) NO: 733)
    DCR70 Human DMD Exon 51 + tcctactcagactgttactc (SEQ ID tggtgaca
    (128) NO: 734)
    DCR71 Human DMD Exon 51 acaggttgtgtcaccagagt (SEQ ID aacagtct
    (129) NO: 735)
    DCR72 Human DMD Exon 51 ttatcattttttctcatacc (SEQ ID ttctgctt
    (130) NO: 736)
    DCR73 Human DMD Intron 51 ttgcctaagaactggtggga (SEQ ID aatggtct
    (131) NO: 737)
    DCR74 Human DMD Intron 51 aaacagttgcctaagaactg (SEQ ID gtgggaaa
    (132) NO: 738)
    DCR75 Human DMD Intron 51 + tttcccaccagttcttaggc (SEQ ID aactgttt
    (133) NO: 739)
    DCR76 Human DMD Intron 50 + tggctttgatttccctaggg (SEQ ID tccagctt
    (134) NO: 740)
    DCR77 Human DMD Intron 50 tagggaaatcaaagccaatg (SEQ ID aaacgttc
    (135) NO: 741)
    DCR78 Human DMD Intron 50 gaccctagggaaatcaaagc (SEQ ID caatgaaa
    (136) NO: 742)
    DCR79 Human DMD Intron 44 TGAGGGCTCCACCCTCAC GTGGGTTT
    (137) GA (SEQ ID NO: 743)
    DCR80 Human DMD Intron 44 AAGGATTGAGGGCTCCAC TCACGAGT
    (138) CC (SEQ ID NO: 744)
    DCR81 Human DMD Intron 44 GCTCCACCCTCACGAGTG TTTGGTTC
    (139) GG (SEQ ID NO: 745)
    DCR82 Human DMD Intron 55 TATCCCCTATCGAGGAAA ACGAGTTT
    (140) CC (SEQ ID NO: 746)
    DCR83 Human DMD Intron 55 + GATAAAGAAGGCCTATTT TAGAGTTG
    (141) CA (SEQ ID NO: 747)
    DCR84 Human DMD Intron 55 AGGCCTTCTTTATCCCCTA CGAGGAAA
    (142) T (SEQ ID NO: 748)
    DCR85 Human DMD Intron 44 TGAGGGCTCCACCCTCAC GTGGGT
    (143) GA (SEQ ID NO: 749)
    DCR86 Human DMD Intron 55 + GATAAAGAAGGCCTATTT TAGAGT
    (144) CA (SEQ ID NO: 750)
  • TABLE 7
    Name Notes % Mod
    DCR1 Delete exon 51 6.6
    DCR2 Delete exon 51 10.3
    DCR3 Frameshift 13
    DCR4 Delete exon 51 11.9
    DCR5 Delete exon 51 12.4
    DCR6 As close to exon 44 as possible in intron 44 16.1
    (in case of patient deletions)
    DCR7 As close to exon 56 as possible in intron 55 6.8
    (in case of patient deletions)
    DCR8 Can correct exon 42-43 deletion (−1/+2) only, 17.3
    (−2/+1) is not correctable by this
    DCR9 Skip exon 44 (5′) 14.4
    DCR10 Frameshift 14.9
    DCR11 Correct downstream of exon 45 <1
    DCR12 5′ splice acceptor/frameshift <1
    DCR13 Correct downstream of exon 46 16.9
    DCR14 Frameshift 17.2
    DCR15 Correct downstream of exon 47 15.4
    DCR16 Frameshift 11.5
    DCR17 Correct downstream of exon 48 <1
    DCR18 5′ splice acceptor/frameshift 1.8
    DCR19 Correct downstream of exon 49 33.7
    DCR20 5′ splice acceptor 14.9
    DCR21 Correct downstream of exon 50 24.1
    DCR22 Frameshift 25.9
    DCR23 Correct downstream of exon 52 25.2
    DCR24 Frameshift (can only correct +1 frame) 24.8
    DCR25 Correct downstream of exon 53 2.6
    DCR26 Frameshift 24.5
    DCR27 Correct downstream of exon 54 13.4
    DCR28 5′ splice acceptor 21.6
    DCR29 Correct downstream of exon 55 19.2
    DCR30 Integrate minidys in exon 1 not
    tested
    DCR31 Correct downstream of exon 51 18.9
    DCR32 Delete stop codon not
    tested
    DCR33 Alternative to CR6 1.3
    DCR34 Alternative to CR6 13.2
    DCR35 Alternative to CR7 22.5
    DCR36 Alternative to CR7 26.4
    DCR40 Disrupt exon 23 5′ splice donor (correct mdx
    mutation)
    DCR41 Disrupt exon 23 5′ splice donor (correct mdx
    mutation)
    DCR42 Delete exon 53 mdx4cv mutation
    DCR43 Disrupt myostatin receptor
  • TABLE 8
    Name Cas9 Notes Cas9 used
    DCR49 S. Aureus Frameshift in exon 51 SaCas9 (from Zhang pX441)
    (NNGRRT PAM)
    DCR50 S. Aureus Disrupt 5′ end of exon 51 SaCas9 (from Zhang pX441)
    (NNGRR PAM)
    DCR60 N. NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN
    Meningitidis 23 to bypass mdx mutation PAM)
    DCR61 N. NNNNGNNT Delete exon 23 and bypass NmCas9 (NNNNGNNT
    Meningitidis mdx mutation PAM)
    DCR62 N. NNNNGANN Delete exon 23 and bypass NmCas9 (NNNNGANN
    Meningitidis mdx mutation PAM)
    DCR63 N. NNNNGTTN Delete exon 23 and bypass NmCas9 (NNNNGTTN
    Meningitidis mdx mutation PAM)
    DCR64 N. NNNNGNNT Delete exon 23 and bypass NmCas9 (NNNNGNNT
    Meningitidis mdx mutation PAM)
    DCR65 N. NNNNGTTN Delete exon 23 and bypass NmCas9 (NNNNGTTN
    Meningitidis mdx mutation PAM)
    DCR66 N. NNNNGANN Delete exon 23 and bypass NmCas9 (NNNNGANN
    Meningitidis mdx mutation PAM)
    DCR67 N. NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN
    Meningitidis 51 to skip exon PAM)
    DCR68 N. NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN
    Meningitidis 51 to skip exon PAM)
    DCR69 N. NNNNGANN Target 3′ splice donor of exon NmCas9 (NNNNGANN
    Meningitidis 51 to skip exon PAM)
    DCR70 N. NNNNGANN Frameshift in exon 51 NmCas9 (NNNNGANN
    Meningitidis PAM)
    DCR71 N. NNNNGNNT Frameshift in exon 51 NmCas9 (NNNNGNNT
    Meningitidis PAM)
    DCR72 N. NNNNGNNT Target 3′ splice donor of exon NmCas9 (NNNNGNNT
    Meningitidis 51 to skip exon PAM)
    DCR73 N. NNNNGNNT Delete exon 51 (bind as close NmCas9 (NNNNGNNT
    Meningitidis to DCR5 as possible) PAM)
    DCR74 N. NNNNGANN Delete exon 51 (bind as close NmCas9 (NNNNGANN
    Meningitidis to DCR5 as possible) PAM)
    DCR75 N. NNNNGTTN Delete exon 51 (bind as close NmCas9 (NNNNGTTN
    Meningitidis to DCR5 as possible) PAM)
    DCR76 N. NNNNGNNT Delete exon 51 (bind as close NmCas9 (NNNNGNNT
    Meningitidis to DCR1/2 as possible) PAM)
    DCR77 N. NNNNGTTN Delete exon 51 (bind as close NmCas9 (NNNNGTTN
    Meningitidis to DCR1/2 as possible) PAM)
    DCR78 N. NNNNGANN Delete exon 51 (bind as close NmCas9 (NNNNGANN
    Meningitidis to DCR1/2 as possible) PAM)
    DCR79 N. NNNNGNNT Delete exons 45-55 - overlaps NmCas9 (NNNNGNNT
    Meningitidis NNNNGTTN PAM, bind as PAM)
    close to DCR6 as possible
    DCR80 N. NNNNGANN Delete exons 45-55, bind as NmCas9 (NNNNGANN
    Meningitidis close to DCR6 as possible PAM)
    DCR81 N. NNNNGTTN Delete exons 45-55, bind as NmCas9 (NNNNGTTN
    Meningitidis close to DCR6 as possible PAM)
    DCR82 N. NNNNGNNT Delete exons 45-55, bind as NmCas9 (NNNNGNNT
    Meningitidis close to DCR36 as possible - PAM)
    overlaps NNNNGTTN PAM
    DCR83 N. NNNNGTTN Delete exons 45-55, bind as NmCas9 (NNNNGTTN
    Meningitidis close to DCR36 as possible PAM)
    DCR84 N. NNNNGANN Delete exons 45-55, bind as NmCas9 (NNNNGANN
    Meningitidis close to DCR36 as possible PAM)
    DCR85 S. Aureus NNGRRT Delete exons 45-55, bind as SaCas9 (from Zhang pX441)
    close to DCR6 as possible (NNGRRT PAM)
    DCR86 S. Aureus NNGRRT Delete exons 45-55, bind as SaCas9 (from Zhang pX441)
    close to DCR36 as possible (NNGRRT PAM)
  • In particular, 400 ng of Cas9 was co-transfected into HEK 293T cells with either 400 ng of empty vector or gRNA that targets the region encompassing Exon 51, i.e., CR1, CR2, CR3, CR4, and CR5 (see FIG. 11B). Genomic DNA was harvested at 2 days post-transfection and analyzed using the Surveyor assay (see FIG. 11A and FIG. 11C).
  • The CRISPR/Cas9-based system was used in DMD 8036 (del148-50) cells to determine if the system could repair a mutant dystrophin gene. 5 μg of Cas9 was co-transfected into DMD 8036 (del48-50) cells with either 7.5 μg of empty vector or gRNA. In particular, 7.5 μg of CR1 (“DCR1”), 7.5 μg of CR5 (“DCR5”), 15 μg of CR3 (“DCR3”) or 7.5 μg of a combination of CR1 and CR5 (DCR1+DCR5) were used. Genomic DNA was harvested at 3 days post-transfection and analyzed using the Surveyor assay (FIG. 12) or PCR analysis across the entire locus (FIG. 13). This locus was amplified by PCR using primers flanking the region containing the genomic targets for CR1 and CR5 (the forward primer: 5′-gagaggttatgtggctttacca (SEQ ID NO:457), the reverse primer: 5′-ctgcgtagtgccaaaacaaa (SEQ ID NO:458)), resulting in a 1447 bp band for the wild-type locus or an expected size of approximately 630 bp for the deleted locus. After 7 days of differentiation, western blot of the treated cells shows expression of dystrophin protein (see FIG. 14).
  • Example 5 Targeting CRISPR/Cas9 to Hotspot Mutations in the Human Dystrophin Gene
  • To utilize the CRISPR/Cas9 gene editing platform for correcting a wide range of dystrophin mutations, dozens of sgRNAs targeted to the hotspot mutation region between exons 45-55 were created (FIGS. 16 A-16D). The S. pyogenes system that utilizes a human-codon optimized SpCas9 nuclease and a chimeric single-guide RNA (sgRNA) expression vector to guide efficient site-specific gene editing was used. Similar to Example 4 targeting exon 51 with TALENs, protospacers were selected to target the 5′ and 3′ ends of exons 45 through 55 which meet the 5′-NRG-3′ PAM requirement of SpCas9. Small insertions or deletions created by NHEJ-based DNA repair within these exons can generate targeted frameshift mutations that address various dystrophin mutations surrounding each exon (FIGS. 16A-16B). For example, CR3 was designed to correct dystrophin mutations or deletions surrounding exon 51 by introducing small insertions or deletions in the 5′ end of exon 51 to restore the downstream dystrophin reading frame (FIG. 16B). Additionally, sgRNAs were designed to employ the multiplex capability of the CRISPR/Cas9 system and specifically delete individual exons or a series of exons to restore the dystrophin reading frame, similar to the methods of oligonucleotide-based exon skipping. For this purpose, sgRNAs were targeted to the intronic regions surrounding exon 51 (FIG. 16C) or exons 45-55 (FIG. 16D). These sgRNAs were intentionally targeted to sites nearest to the downstream or upstream exon intended to be included in the resulting transcript to minimize the likelihood that the background patient deletion would include the intronic sgRNA target sites.
  • Example 6 Screening of sgRNAs Targeted to the Dystrophin Gene in Human Cells
  • Gene editing frequency in the human HEK293T cell line was assessed to rapidly determine different sgRNA targeting efficiencies. HEK293 Ts were transfected with constructs encoding human codon-optimized SpCas9 and the indicated sgRNA. Each sgRNA was designed to modify the dystrophin gene as indicated. The frequency of gene modification at day 3 or day 10 post-transfection was determined by the Surveyor assay. The ratio of measured Surveyor signal at day 3 and day 10 was calculated to quantify the stability of gene editing frequencies for each sgRNA in human cells. As quantified by the Surveyor assay 3 days post-transfection, 29/32 (˜90%) of the sgRNAs tested were able to mediate highly efficient gene modification at the intended locus (Table 9, FIG. 17). The gene editing frequencies were stable for almost all of the sgRNAs (<25% signal change from day 3 to day 10, Table 9, FIG. 18), indicating that gene editing mediated by each individual sgRNA was well-tolerated. A notable exception is CR33, which had no detectable activity at day 10, although activity may be below the sensitivity of the Surveyor assay (est. ˜1%).
  • TABLE 9
    Measured activity of sgRNAs in human cells
    % modified alleles % modified alleles % change
    Target sgRNA # at day 3 at day 10 day 10/day 3
    Multiplex deletion of exon 51
    Int 50 CR1 6.6 9.3 41.8
    Int 50 CR2 10.3 14.0 36.2
    Ex 51 CR4 11.9 14.4 21.3
    Int 51 CR5 12.4 13.3 7.8
    Multiplex deletion of exons 45-55
    Int 44 CR6 16.1 16.9 4.3
    Int 44 CR33 1.3 <1 n.d.
    Int 44 CR34 13.2 11.0 −16.6
    Int 55 CR7 6.8 7.1 5.3
    Int 55 CR35 22.5 20.9 −7.1
    Int 55 CR36 26.4 24.7 −6.4
    Targeted frameshifts
    Ex 45 CR10 14.9 16.3 9.3
    Ex 45 CR11 <1 <1 n.d.
    Ex 46 CR12 <1 <1 n.d.
    Ex 46 CR13 16.9 18.4 9.2
    Ex 47 CR14 17.2 17.6 2.9
    Ex 47 CR15 15.4 15.3 −0.9
    Ex 48 CR16 11.5 10.9 −5.0
    Ex 48 CR17 <1 <1 n.d.
    Ex 49 CR18 1.8 2.2 20.1
    Ex 49 CR19 33.7 38.4 13.9
    Ex 50 CR20 14.9 13.7 −7.6
    Ex 50 CR21 24.1 20.8 −13.5
    Ex 51 CR3 13.0 16.7 28.0
    Ex 51 CR31 18.9 16.9 −10.2
    Ex 52 CR22 25.9 20.3 −21.6
    Ex 52 CR23 25.2 24.0 −4.8
    Ex 53 CR24 24.8 23.6 −4.6
    Ex 53 CR25 2.6 2.9 9.5
    Ex 54 CR26 24.5 22.0 −10.1
    Ex 54 CR27 13.4 12.6 −5.9
    Ex 55 CR28 21.6 19.8 −8.4
    Ex 55 CR29 19.2 19.6 2.2
  • Example 7 Enrichment of Gene-Edited Cells Using a Fluorescence-Based Reporter System
  • sgRNAs were selected to correct specific mutations in DMD patient myoblast cell lines. After transfection into DMD myoblasts, unexpectedly low or undetectable gene modification activity was observed as measured by the Surveyor assay (FIG. 19C, bulk population). Flow cytometry was used to select for transfected cells co-expressing GFP through a 2A ribosomal skipping peptide linked to the SpCas9 protein (FIG. 19A). The addition of this fluorescent reporter to the SpCas9 expression vector did not seem to significantly impact gene editing activity in HEK293T cells (FIG. 19B). A low percentage of transfected myoblasts (˜0.5-2%) expressed the fluorescent reporter at 3 days after electroporation, despite high transfection efficiencies of control GFP expression plasmids (typically >70%, FIG. 19D, pmaxGFP). Given the high levels of CRISPR/Cas9 activity in the easily transfected HEK293T line, inefficient transgene expression after electroporation of SpCas9-T2A-GFP and sgRNA constructs into the DMD cells may explain the low observed gene editing efficiencies in unsorted cells. After sorting the GFP-positive DMD myoblasts, a substantial increase was observed in detectable activity at most sgRNA target loci (FIG. 19C). Therefore, all subsequent experiments used cells sorted for SpCas9 expression by expression of this fluorescent reporter.
  • Example 8 Restoration of Dystrophin Expression by Targeted Frameshifts
  • Small insertions and deletions created by NHEJ DNA repair may be used to create targeted frameshifts to correct aberrant reading frames. A sgRNA, CR3, was designed to restore the dystrophin reading frame by introducing small insertions and deletions within exon 51 (FIG. 16B and FIG. 20A). The types of insertions and deletions generated by CRISPR/Cas9 at this locus were assessed by Sanger sequencing of alleles from the genomic DNA of HEK293T cells co-transfected with expression plasmids for SpCas9 and the CR3 sgRNA (FIG. 20B). Notably, the insertions and deletions resulted in conversion to all three reading frames (FIG. 20B, FIG. 20C). To demonstrate genetic correction in a relevant patient cell line, expression plasmids for SpCas9 and the CR3 sgRNA were electroporated into a DMD myoblast line with a deletion of exons 48-50 that is correctable by creating frameshifts in exon 51. The treated cells were sorted, verified to have gene modification activity by the Surveyor assay (CR3, FIG. 19C sorted population), and differentiated into myotubes to test for restored dystrophin expression. Expression of dystrophin protein was observed concomitant with the detectable nuclease activity (FIG. 20D). The S. pyogenes CRISPR/Cas9 system presents a powerful method to quickly generate targeted frameshifts to address a variety of patient mutations and restore expression of the human dystrophin gene.
  • Example 9 Multiplex CRISPR/Cas9 Gene Editing Mediates Genomic Deletion of Exon 51 and Rescues Dystrophin Protein Expression
  • The multiplexing capability of the CRISPR/Cas9 system presents a novel method to efficiently generate genomic deletions of specific exons for targeted gene correction. DMD patient myoblasts with background deletions correctable by exon 51 skipping were treated with two combinations of sgRNAs flanking exon 51 (CR1/CR5 or CR2/CR5) and sorted to enrich for gene-edited cells as in FIGS. 19A-19D. As detected by end-point PCR of the genomic DNA from these treated cells, the expected genomic deletions were only present when both sgRNAs were electroporated into the cells with SpCas9 (FIG. 21A). Sanger sequencing confirmed the expected junction of the distal chromosomal segments (FIG. 21B) for both deletions. After differentiating the sorted myoblasts, a deletion of exon 51 from the mRNA transcript was detected only in the cells treated with both sgRNAs (FIG. 21C). Finally, restored dystrophin protein expression was detected in the treated cells concomitant with observed genome- and mRNA-level deletions of exon 51 (FIG. 21D).
  • Example 10 Dystrophin Rescue by a Multi-Exon Large Genomic Deletion
  • Although addressing patient-specific mutations is a powerful use of the CRISPR/Cas9 system, it would be advantageous to develop a single method that can address a myriad of common patient deletions. For example, a promising strategy is to exclude the entire exon 45-55 region as a method to correct up to 62% of known patient deletions. Multiplex CRISPR/Cas9-based gene editing was tested to determine if it may be able to generate efficient deletion of the exon 45-55 locus in human cells. After transfection into HEK293T cells, the expected deletion of ˜336,000 bp was detected by PCR of the genomic DNA (FIG. 22A). Similarly, this deletion was detected by PCR of the genomic DNA from SpCas9/sgRNA-treated DMD patient cells harboring a background deletion of exons 48-50 of unknown length (FIG. 22A). Sanger sequencing of this deletion band from the genomic DNA of treated DMD cells revealed the expected junctions of intron 44 and intron 55 immediately adjacent to the sgRNA target sites (FIG. 22B). After differentiation of treated DMD cells, the expected deletion of exons 45-55 was detected in the dystrophin mRNA transcript and verified to be a fusion of exons 44 and 56 by Sanger sequencing (FIG. 22C). Restored protein expression was observed by western blot in the sorted cell populations containing the CRISPR/Cas9-induced deletion of exons 45-55 from the genome and resulting mRNA transcripts (FIG. 22D). These data demonstrate that multiplex CRISPR/Cas9 editing presents a single universal method to restore the dystrophin reading frame in more than 60% of DMD patient mutations.
  • Example 11 Transplantation of Corrected Myoblasts into Immunodeficient Mice
  • A promising method for DMD therapy is to correct a population of autologous patient muscle progenitor cells that can be engrafted into the patient's skeletal muscle tissue to rescue dystrophin expression. To demonstrate the ability of the corrected cells to express human dystrophin in vivo, a population of DMD myoblasts that were treated with sgRNAs CR1 and CR5, which flank exon 51, was transplanted and sorted for expression of GFP as before (FIGS. 19A-19D, FIG. 23). After 4 weeks, muscle fibers positive for human spectrin, which is expressed by both corrected and uncorrected cells, were detected in cryosections of injected muscle tissue (FIG. 24). A number of these fibers were also positive for human dystrophin with expression localized to the sarcolemma, demonstrating functional gene correction in these cells (FIG. 24, FIGS. 25A-25F). No fibers positive for human dystrophin were observed in sections from mice injected with the untreated DMD myoblasts (FIG. 24, FIGS. 25A-25F), indicating that the CRISPR/Cas9-modified cells were the source of human dystrophin expression.
  • Example 12 Off-Target and Cytotoxicity Analysis
  • The relative cytotoxicity of the CRISPR/Cas9 system was assessed in human cells for select sgRNAs by adapting a flow cytometry-based GFP retention assay as previously described (Ousterout et al., Mol Ther 21:1718-1726 (2013)). Minimal cytotoxicity was observed for SpCas9 co-expressed with or without sgRNAs after transfection into human cells (FIG. 26A). Publicly available tools are available to assess and prioritize potential CRISPR/Cas9 activity at off-target loci based on predicted positional bias of a given mismatch in the sgRNA protospacer sequence and the total number of mismatches to the intended target site (Hsu et al., Nat Biotechnol 31:827-826 (2013)). This public webserver was used to predict the most likely off-target sites for the sgRNAs used to correct the dystrophin gene in this study (Table 4). The top ten potential off-target sites were assessed by the Surveyor assay in HEK293T cells treated with SpCas9 and individual sgRNA expression cassettes for CR1, CR3, CR5, CR6, or CR36. CR1, CR3 and CR36 each had one of these ten predicted off-target loci demonstrate significant levels of gene modification (Table 4 and FIG. 27). Interestingly, the CR3 off-target sequence had substantial homology and similar modification frequencies to the intended on-target (9.3% at OT-1 vs. 13.3% at intended site (Table 4 and FIG. 27). Notably, CR3-OT1 was the only one of these three off-target sites to show significant levels of activity in the sorted hDMD cells by the Surveyor assay (FIG. 26B).
  • Nuclease activity at off-target sites may cause unintended chromosomal rearrangements by distal re-ligation between cleaved target and off-target loci on distinct chromosomes. This presents a significant concern for deletion-based gene correction strategies due to the increased potential for off-target activity by using two or more nucleases, such as in multiplex CRISPR/Cas9 gene editing. Potential translocations were probed for using a highly sensitive nested genomic PCR assay to detect translocations at the validated off-target loci (Table 4) during both single and multiplex CRISPR/Cas9 editing strategies. Using this assay, translocations were readily detected between on-target and off-target sites in the model HEK293T cell line that also shows high levels of off-target activity (FIG. 26C and FIG. 28A, 28B). Sanger sequencing of the PCR amplicons confirmed the identity of the predicted translocation event for each primer pair (FIGS. 29-30). A subset of the translocations detected in the HEK293T cells were also detectable by nested PCR in the sorted hDMD myoblasts, although the signal was considerably weaker and the sequence identity was not confirmed due to low yield of product (FIG. 26D, FIG. 28A, and FIG. 28C). Translocations were not detected using this assay in HEK293T or sorted hDMD cells treated with CR6 or CR6/CR36, respectively, (FIGS. 28A-28C) that had low levels of off-target activity at CR6-OT3 only in HEK293T cells (Table 4). These results underscore the importance of selecting highly specific sgRNAs, particularly for multiplex editing applications, and show that this approach can benefit from ongoing efforts to improve the specificity of the CRISPR/Cas9 system. These data suggest that the selected sgRNAs are able to correct the dystrophin gene without significant toxicity and with only a single strongly predicted off-target site with detectable levels of activity.
  • Example 13 Discussion
  • Genome editing is a powerful tool for correcting genetic disease and the recent development of the CRISPR/Cas9 system is dramatically accelerating progress in this area. The correction of DMD, the most common genetic disease that also currently has no approved therapeutic options, was demonstrated. Many gene- and cell-based therapies for DMD are in preclinical development and clinical trials, and genome editing methods are compatible with many of these approaches. For example, genome editing may be combined with patient-specific cell-based therapies for DMD. The CRISPR/Cas9 system may function in human pluripotent stem cells and other human cell lines, as well as human skeletal myoblasts, as shown. Importantly, gene editing with CRISPR/Cas9 did not abolish the myogenic capacity of these cells, as demonstrated by efficient dystrophin expression in vitro and in vivo after transplantation into immunodeficient mice. Thus, this strategy should be compatible with cell-based therapies for DMD.
  • Additionally, an enriched pool of gene-corrected cells demonstrated expression of human dystrophin in vivo following engraftment into immunodeficient mice. CRISPR/Cas9 gene editing did not have significant toxic effects in human myoblasts as observed by stable gene editing frequencies and minimal cytotoxicity of several sgRNAs. However, gene editing activity was confirmed at three out of 50 predicted off-target sites across five sgRNAs and CRISPR/Cas9-induced chromosomal translocations between on-target and off-target sites were detectable. The CRISPR/Cas9 technology is an efficient and versatile method for correcting a significant fraction of dystrophin mutations and can serve as a general platform for treating genetic disease.
  • Additionally, direct transfection of the sgRNA and Cas9 mRNA, in contrast to the plasmid-based delivery method used here, may be used to increase specificity and safety by reducing the duration of Cas9 expression and eliminating the possibility of random plasmid integration. Alternatively, delivery of the CRISPR/Cas9 system directly to skeletal and/or cardiac muscle by viral, plasmid, or RNA delivery vectors may be used for in vivo genome editing and translation of this approach. The large size of S. pyogenes Cas9 gene (˜4.2 kilobases) presents a challenge to its use in size-restricted adeno-associated viral vectors. However, Cas9 genes from other species, such as N. meningitidis and S. thermophilus, are short enough to efficiently package both Cas9 and sgRNA expression cassettes into single AAV vectors for in vivo gene editing applications.
  • The CRISPR/Cas9 system enabled efficient modification of nearly 90% of tested targets, consistent with other reports of robust activity of this system at diverse loci. The robustness and versatility of this technology is a significant advancement towards at-will creation of patient-specific gene editing. Low levels of dystrophin, including as little as 4% of wild-type expression, may be sufficient to improve survival, motor function, and cardiac function in a mouse model. The levels of CRISPR/Cas9 activity may be sufficient for therapeutic benefit.
  • The use of multiplexing with CRISPR/Cas9 to delete exons also presents a unique set of opportunities and challenges. The deletion of complete exons from the genome to restore dystrophin expression was performed, in contrast to restoring the reading frame of the dystrophin gene with small indels generated by NHEJ-based DNA repair following the action of a single nuclease. The protein product of the edited gene is predictable and already characterized in Becker muscular dystrophy patients with the naturally occurring deletion, in contrast to the random indels created by intraexonic action of a single nuclease that will lead to the creation of novel epitopes from each DNA repair event. Furthermore, the product resulting from the exon deletions will lead to restored dystrophin for every successful gene editing event, whereas modifying the gene with random indels within exons will only restore the reading frame in the one-third of editing events that leads to the correct reading frame.
  • All of the sgRNAs tested were not associated with significant cytotoxic effects in human cells. Three potential off-target sites out of 50 total tested sites for the five sgRNAs used were identified to restore dystrophin expression. Furthermore, chromosomal translocations between the intended on-target sites and these off-target sites were detectable by highly sensitive nested PCR assays in HEK293T cells expressing high levels of Cas9 and sgRNAs. Notably, the off-target activity and translocations identified in HEK293T cells, which is an immortalized and aneuploid cell line that expresses very high levels of Cas9 and sgRNA, did not occur at as high a level and in some cases were undetectable in the hDMD myoblasts. Importantly, this level of specificity may be tolerable given the severity of DMD, the lack of an apparent cytotoxic effect in human cells
  • Example 14
  • An engineered AAV capsid, termed SASTG (FIG. 34; SEQ ID NOs: 436 and 437), was developed for enhanced cardiac and skeletal muscle tissue tropism (Piacentino et al. (2012) Human Gene Therapy 23:635-646). A ZFN targeting the Rosa26 locus (“Rosa26 ZFN”; FIG. 33; SEQ ID NO: 434 and 435) was shown to be highly active in mouse cells (Perez-Pinera et al. Nucleic Acids Research (2012) 40:3741-3752). AAV-SASTG vectors encoding the Rosa26 ZFN protein were designed and subsequently generated and purified by the UNC Viral Vector Core. The Surveyor assay (Guschin et al., Methods Mol Biol 649, 247-256 (2010)) was used to demonstrate NHEJ mutagenesis at the Rosa26 locus following delivery of AAV-SASTG Rosa26 ZFNs in cultured C2C12 myoblasts that were actively cycling or forced into differentiation by serum removal (not shown).
  • To verify that adult post-mitotic skeletal muscle were efficiently targeted by the Rosa26 ZFN following AAV transfer, AAV-SASTG vectors encoding the Rosa26 ZFN were injected directly into the tibialis anterior (TA) muscle of 6 week old C57BL6/J mice at titers of 1e10 vector genomes (vg) or 2.5e10 vg per muscle. Mice were sacrificed 4 weeks after injection and the TA muscles were harvested and partitioned into several fragments for genomic DNA extraction and analysis (FIG. 31). Genomic DNA was PCR amplified and subjected to the Surveyor assay to detect NHEJ mutations characteristic of ZFN mutagenesis at the Rosa26 target site (FIGS. 32A-32C). FIGS. 32A-32C shows Surveyor analysis of Rosa26 ZFN activities in skeletal muscle in vitro and in vivo following delivery of AAV-SASTG-ROSA. Proliferating C2C12s were transduced with the indicated amount of virus and harvested at 4 days post-infection (FIG. 32A). C2C12s were incubated in differentiation medium for 5 days and then transduced with the indicated amount of AAV-SASTG-ROSA virus in 24 well plates (FIG. 32B). Samples were collected at 10 days post-transduction. The indicated amount of AAV-SASTG-ROSA was injected directly into the tibialis anterior of C57BL/6J mice and muscles were harvested 4 weeks post-infection. The harvested TA muscles were partitioned into 8 separate pieces for genomic DNA analysis, each shown in a separate lane (FIG. 32C). Notably, high levels of gene modification were detected in all fragments at the highest dose (2.5e10 vg).
  • Example 15 AAV-CRISPR Constructs for Targeting Mutant Dystrophin Genes
  • AAV constructs are designed to therapeutically correct mutations of the dystrophin gene that cause Duchenne muscular dystrophy and skeletal and cardiac muscle degeneration. CRISPR/Cas9 systems can be delivered using the AAV to restore the dystrophin reading frame by deleting exon 51, deleting exons 45-55, disrupting splice donor or acceptor sites, or creating frameshifts within exon 51 (Ousterout et al., Molecular Therapy 2013) to restore the dystrophin reading frame and protein expression. The CRISPR/Cas9 system will include a Cas9 having a sequence of SEQ ID NO: 64 or 114 (See FIGS. 40 and 41). gRNAs that could be combined with these Cas9s, targeting their respective PAM sequences, are provided (see FIGS. 40 and 41; see also Tables 2 and 3).
  • Example 16 Generation of Induced Neurons (iNs)
  • The generation of induced neurons (iNs) from other cell lineages has potential applications in regenerative medicine and the study of neurological diseases. The direct conversion of mouse embryonic fibroblasts (MEFs) to functional neuronal cells may occur through the delivery of a cocktail of three neuronal transcription factors—BRN2, ASCL1, and MYT1L (BAM factors, FIG. 48). Other methods may include additional factors to induce various neuronal subtypes. These experiments require transcription factors to be delivered ectopically, and the activation of the corresponding endogenous loci to sustain the neuronal phenotype. The CRISPR/Cas9 system was engineered as a versatile transcription factor to activate endogenous genes in mammalian cells with the capacity to target any promoter in the genome through an RNA-guided mechanism (FIGS. 49A-49B).
  • Materials & Methods. The CRISPR/Cas9-transcription factor was used to activate the endogenous genes encoding ASCL1 and BRN2 to directly reprogram MEFs to functional induced neurons.
  • Cell Culture: MEFs were seeded in either 24-well TCPS plates or on poly-D-lysine/laminin-coated coverslips. Following transduction of dCas9-VP64 and transfection of the gRNAs (see Tables 10 and 11 for sequences of gRNAs), the cells were cultured in MEF medium (Adler et al. Mol Ther Nucleic Acids 1:e32 (2012)) for 24 hrs and then transferred to N3 neural induction medium (Vierbuchen et al. Nature 463:1035-1041 (2010)) for the duration of the experiment (FIG. 49B).
  • TABLE 10
    gRNAs for mouse ASCL1 (CR13):
    SEQ
    5′ ID
    Oligo (5′ to 3′) overhang ASCL1 Target Sequence NO
    CR13-1_S: cacc G CAGCCGCTCGCTGCAGCAG (SEQ ID NO: 468) 492
    CR13-1_AS: AAAC CTGCTGCAGCGAGCGGCTG (SEQ ID NO: 469) C 493
    CR13-2_S: cacc G GCTGGGTGTCCCATTGAAA (SEQ ID NO: 470) 494
    CR13-2_AS: AAAC TTTCAATGGGACACCCAGC (SEQ ID NO: 471) C 495
    CR13-3_S: cacc G GTTTATTCAGCCGGGAGTC (SEQ ID NO: 472) 496
    CR13-3_AS: AAAC GACTCCCGGCTGAATAAAC (SEQ ID NO: 473) C 497
    CR13-4_S: cacc G TGGAGAGTTTGCAAGGAGC (SEQ ID NO: 474) 498
    CR13-4_AS: AAAC GCTCCTTGCAAACTCTCCA (SEQ ID NO: 475) C 499
    CR13-5_S: cacc G CCCTCCAGACTTTCCACCT (SEQ ID NO: 476) 500
    CR13-5_AS: AAAC AGGTGGAAAGTCTGGAGGG (SEQ ID NO: 477) C 501
    CR13-6_S: cacc G AATTTTCTTCCAAGTTCTC (SEQ ID NO: 478) 502
    CR13-6_AS: AAAC GAGAACTTGGAAGAAAATT (SEQ ID NO: 479) C 503
    CR13-7_S: cacc G CTGCGGAGAGAAGAAAGGG (SEQ ID NO: 480) 504
    CR13-7_AS: AAAC CCCTTTCTTCTCTCCGCAG (SEQ ID NO: 481) C 505
    CR13-8_S: cacc G AGAGCCACCCCCTGGCTCC (SEQ ID NO: 482) 506
    CR13-8_AS: AAAC GGAGCCAGGGGGTGGCTCT (SEQ ID NO: 483) C 507
    CR13-9_S: cacc G cgaagccaaccgcggcggg (SEQ ID NO: 484) 508
    CR13-9_AS: AAAC cccgccgcggttggcttcg (SEQ ID NO: 485) C 509
    CR13-10_S: cacc G agagggaagacgatcgccc (SEQ ID NO: 486) 510
    CR13-10_AS: AAAC gggcgatcgtcttccctct (SEQ ID NO: 487) C 511
    CR13-11_S: cacc G cccctttaactttcctccg (SEQ ID NO: 488) 512
    CR13-11_AS: AAAC cggaggaaagttaaagggg (SEQ ID NO: 489) C 513
    CR13-12_S: cacc G gcagccccgcttccttcaa (SEQ ID NO: 490) 514
    CR13-12_AS: AAAC ttgaaggaagcggggctgc (SEQ ID NO: 491) C 515
  • TABLE 11
    gRNAs for mouse BRN2 (CR16):
    SEQ
    5′ ID
    Oligo (5′ to 3′) overhang BRN2 Target Sequence NO
    CR16-1_S: cacc G CGAGAGCGAGAGGAGGGAG (SEQ ID NO: 516) 540
    CR16-1_AS: AAAC CTCCCTCCTCTCGCTCTCG (SEQ ID NO: 517) C 541
    CR16-2_S: cacc G GAGAGAGCTTGAGAGCGCG (SEQ ID NO: 518) 542
    CR16-2_AS: AAAC CGCGCTCTCAAGCTCTCTC (SEQ ID NO: 519) C 543
    CR16-3_S: cacc G GGTGGAGGGGGCGGGGCCC (SEQ ID NO: 520) 544
    CR16-3_AS: AAAC GGGCCCCGCCCCCTCCACC (SEQ ID NO: 521) C 545
    CR16-4_S: cacc G GGTATCCACGTAAATCAAA (SEQ ID NO: 522) 546
    CR16-4_AS: AAAC TTTGATTTACGTGGATACC (SEQ ID NO: 523) C 547
    CR16-5_S: cacc G CCAATCACTGGCTCCGGTC (SEQ ID NO: 524) 548
    CR16-5_AS: AAAC GACCGGAGCCAGTGATTGG (SEQ ID NO: 525) C 549
    CR16-6_S: cacc G GGCGCCCGAGGGAAGAAGA (SEQ ID NO: 526) 550
    CR16-6_AS: AAAC TCTTCTTCCCTCGGGCGCC (SEQ ID NO: 527) C 551
    CR16-7_S: cacc G GGGTGGGGGTACCAGAGGA (SEQ ID NO: 528) 552
    CR16-7_AS: AAAC TCCTCTGGTACCCCCACCC (SEQ ID NO: 529) C 553
    CR16-8_S: cacc G CCGGGGACAGAAGAGAGGG (SEQ ID NO: 530) 554
    CR16-8_AS: AAAC CCCTCTCTTCTGTCCCCGG (SEQ ID NO: 531) C 555
    CR16-9_S: cacc G gagagagagtgggagaagc (SEQ ID NO: 532) 556
    CR16-9_AS: AAAC gcttctcccactctctctc (SEQ ID NO: 533) C 557
    CR16-10_S: cacc G aaagtaactgtcaaatgcg (SEQ ID NO: 534) 558
    CR16-10_AS: AAAC cgcatttgacagttacttt (SEQ ID NO: 535) C 559
    CR16-11_S: cacc G ttaaccagagcgcccagtc (SEQ ID NO: 536) 560
    CR16-11_AS: AAAC gactgggcgctctggttaa (SEQ ID NO: 537) C 561
    CR16-12_S: cacc G cgtcggagctgcccgctag (SEQ ID NO: 538) 562
    CR16-12_AS: AAAC ctagcgggcagctccgacg (SEQ ID NO: 539) C 563
  • qRT-PCR & IF: Activation of endogenous ASCL1 was assessed by qRT-PCR and immunofluorescence in MEFs on day 3 following delivery of either dCas9-VP64 and gRNAs, ASCL1 cDNA, or a negative control vector encoding luciferase. The generation of iNs was evaluated by TUJ1 and MAP2 co-staining and identification of cells with neuronal morphology and extended processes.
  • Live Cell Reporters: After 7-8 days in N3 medium, MEFs cultured on poly-D-lysine/laminin-coated coverslips were transduced with viruses carrying hSyn-RFP and MAP2-GCamP5 reporters to identify the most mature iNs for functional characterization via calcium imaging and electrophysiology (FIG. 49B).
  • Results. dCas9-VP64 and gRNAs targeted to the ASCL1 promoter activated the endogenous gene in MEFs. Co-delivery of 8 gRNAs activated the endogenous gene 400-fold, a significant increase (p<0.05) over the 100-fold activation induced by the co-delivery of 4 gRNAs (FIG. 50A). Nuclear-localized Ascl1 protein was detected by immunofluorescence in MEFs. Ectopic Ascl1 expression produced more Ascl1 protein than dCas9-VP64 with either gRNA cocktail, but did not activate the endogenous locus by day 3 (FIGS. 50A-50B). TUJ1 and MAP2 co-positive cells with extended processes were identified by immunofluorescence after 13 days in neurogenic medium following delivery of dCas9-VP64 and gRNAs targeting the ASCL1 and BRN2 promoters (FIG. 51A first row). A similar number of TUJ1 and MAP2 co-positive cells were identified with ectopic expression of the BAM factors (FIG. 51A second row). Cells with a neuronal morphology expressing the hSyn-RFP reporter were visible in culture as early as day 11 in neurogenic medium (FIG. 51B). A cell expressing the MAP2-GCaMP5 calcium indicator exhibited KCl-induced depolarization detected with a fluorescent microscope (FIGS. 52A-52B).
  • The direct conversion of mouse embryonic fibroblasts to TUJ1 and MAP2 co-positive cells with a neuronal morphology was accomplished through activation of endogenous BRN2 and ASCL1 by CRISPR/Cas9-based transcription factors. Though dCas9-VP64 produces less protein than ectopic expression of ASCL1 (FIG. 50B), the generation of neuronal-like cells is similar. The activation of the endogenous loci may induce a reprogramming cascade of events that is not mechanistically identical to that generated with ectopic expression.
  • dCas9-VP64 was able to penetrate heterochromatin and activated stably silenced endogenous genes, a characteristic of only a subset of “pioneer” transcription factors. As a result, converting cell lineage with CRISPR/Cas9-transcription factors may better overcome epigenetic barriers to reprogramming than ectopic expression of transcription factors, particularly in hard-to-reprogram cell-types, such as adult human cells. This may have clinical importance in the field of regenerative medicine, as it is often desired to use autologous sources in cell replacement therapies.
  • Example 17 Multiplex CRISPR/Cas9-Based Genome Engineering—Materials and Methods
  • Plasmid constructs. The expression cassettes for the S. pyogenes sgRNA and human codon optimized Cas9 (hCas9) nuclease were used, as described above. Additional promoters for mU6 (Ohshima et al., Nucleic Acids Res 9:5145-5158 (1981)), H1 (Myslinski et al., Nucleic Acids Res 29:2502-2509 (2001)), and 7SK (Murphy et al., Cell 51:81-87 (1987)) pol-III promoters were synthesized using GeneBlocks (IDT) and cloned in place of the hU6 sgRNA expression cassette. A GeneBlock (IDT) was cloned onto the 3′ end of the Cas9 coding sequence to fuse a T2A skipping peptide and eGFP gene immediately after Cas9 to monitor vector expression. The coding region for hCas9-T2A-GFP (SEQ ID NO: 145) was then transferred into a lentiviral expression vector containing the human ubiquitin C (hUbC) promoter to drive expression of hCas9-T2A-GFP, as well as restriction sites to facilitate Golden Gate cloning of sgRNA expression cassettes immediately upstream of the hUbC promoter (FIG. 42A).
  • Protocol for assembly of custom lentiviral vectors. Assembly of custom lentiviral vectors expressing up to four sgRNAs of choice and active Cas9, dCas9, or dCas9-VP64 was accomplished in less than five days. The cloning method used the Golden Gate cloning and type IIS restriction enzymes that cleave outside their recognition sequence to create unique overhangs. Golden Gate assembly expedited cloning as all four expression cassettes were ligated into the final lentiviral vector in one step. The lentiviral vector expressed active Cas9, cCas9, or dCas9-VP64 in addition to one, two, three, or four sgRNAs expressed from independent promoters.
  • Step 1: Single stranded oligos containing each 20 bp protospacer were annealed in such a fashion to create sticky ends and were ligated into the desired pZDonor-promoter vector. Order two single stranded oligos for each desired genomic target. To anneal the complimentary oligos, mix 8 μL sense oligo+8 μL antisense oligo (both at 10 mM)+2 μL 10× ligase buffer. The oligos are melted and reannealed in a PCR machine with the program: 96° C. for 300 seconds, followed by 85° C. for 20 seconds, 75° C. for 20 seconds, 65° C. for 20 seconds, 55° C. for 20 seconds, 45° C. for 20 seconds, 35° C. for 20 seconds, and 25° C. for 20 seconds with a −0.3° C./second rate between steps. To phosphorylate the sticky ends, add 1 μL 25 mM ATP+1 microliter T4 Polynucleotide Kinase (NEB) and incubate at 37° C. for 60 minutes followed by 65° C. for 20 minutes to heat inactivate the enzyme. Each protospacer was ligated into the desired expression vector using T4 DNA ligase (NEB) incubated at 16° C. for 60 minutes using 50 ng of vector and 1 μL of annealed oligonucleotides in a 10 μL reaction volume according to manufacturer's instructions. Five microliters of each ligation was transformed into XL1 blue chemically competent bacteria (Agilent) following the manufacturer's instructions. Plate transformation onto LB agar plates containing 50 μg/mL kanamycin (Sigma) and incubate overnight at 37° C. In our experience, >90% of the colonies will contain the desired ligation product. Sequencing using the M13 reverse standard sequencing primer was performed to validate each final sgRNA construct prior to moving onto step 2.
  • Step 2: Construct the four promoter-gRNA cassettes into a lentiviral destination vector using Golden Gate assembly. After completion of step 1, there are four independent plasmids each expressing a different sgRNA from a different promoter. To assemble the four different promoter-sgRNA constructs into the desired destination vector, combine 200 ng of each sgRNA expression plasmid and desired lentiviral destination vector with 1 μL of T4 DNA ligase (NEB), 1 μL BsmBI FastDigest (Fisher Scientific), and 2 μL 10× T4 ligase buffer (NEB) in a 20 μL reaction volume. Incubate the reaction as follows: 37° C. for 10 minutes, 16° C. for 15 minutes, 37° C. for 30 minutes, 80° C. for 5 minutes. Transform 5 μL of ligation reaction into SURE 2 chemically competent cells (Agilent) following the manufacturer's instructions. Plate transformations onto LB agar plates containing 100 μg/mL ampicillin and incubate overnight at 37° C. Optionally, colonies can be screened by lacZ-based blue/white screening using IPTG and X-gal; however, in our experience, >90% of the transformants contain the proper ligation product. Due to the inverted repeats formed by the opposing sgRNA expression cassettes, the final constructs may be unstable and thus we recommend maintaining these plasmids in the SURE 2 cell line and screening the final plasmid with a test PCR using the sense primer 5′-TCGGGTTTATTACAGGGACAGCAG-3′ (SEQ ID NO:464) and antisense primer 5′-TCTAAGGCCGAGTCTTATGAGCAG-3′ (SEQ ID NO:465). These primers amplify across the four promoter-gRNA region. Due to the repetitive nature, a distinct banding pattern should be observed with the largest product approximately 1800 bp in size.
  • Cell culture and transfection. HEK293T cells were obtained from the American Tissue Collection Center (ATCC, Manassas, Va.) through the Duke University Cancer Center Facilities and were maintained in DMEM supplemented with 10% FBS and 1% penicillin streptomycin. Primary human dermal fibroblasts (Catalog ID: GM03348) were obtained from Coriell Institute (Camden, N.J.) and were maintained in DMEM supplemented with 10% FBS and 1% penicillin streptomycin. All cells were cultured at 37° C. with 5% CO2. HEK293T cells were transfected with Lipofectamine 2000 (Life Technologies) with 200 ng of each sgRNA expression vector (800 ng total pDNA) according to the manufacturer's protocol in 24 well plates.
  • Viral production and transduction. All lentiviral vectors used is this study are second generation and were produced using standard viral production methods. Briefly, 3.5 million HEK293 Ts were plated per 10 cm dish. The following day, cells were transfected by the calcium phosphate transfection method with 20 μg of transfer vector, 6 μg of pMD2G, and 10 μg psPAX2. The media was changed 12-14 hrs post transfection. The viral supernatant was collected 24 and 48 hrs after this media change, passed through a 0.45 micron filter and pooled. For transduction, the cell medium was replaced with viral supernatant supplemented with 4 μg/mL polybrene. The viral supernatant was exchanged for fresh medium 12-24 hrs later.
  • Reverse Transcription PCR. RNA was isolated using the miRNeasy Mini RNA isolation kit (Qiagen). DNAse digestion was performed using the DNA-free Kit (Applied Biosystems). cDNA synthesis was performed using the SuperScript VILO cDNA Synthesis Kit (Invitrogen). cDNA was PCR amplified using Taq DNA polymerase (NEB) and the resulting product was run on TAE agarose gels. Images were captured using a ChemiDoc XRS+ System and processed using ImageLab software (Bio-Rad).
  • Quantitative Real Time PCR. RNA was isolated using the RNeasy Plus RNA isolation kit (Qiagen). cDNA synthesis was performed using the SuperScript VILO cDNA Synthesis Kit (Invitrogen). Real-time PCR using PerfeCTa SYBR Green FastMix (Quanta Biosciences) was performed with the CFX96 Real-Time PCR Detection System (Bio-Rad). Primer specificity was confirmed by agarose gel electrophoresis and melting curve analysis. Reaction efficiencies over the appropriate dynamic range were calculated to ensure linearity of the standard curve. The results are expressed as fold-increase mRNA expression of the gene of interest normalized to β-Actin expression using the ΔΔCt method. Reported values are the mean and S.E.M. from two independent experiments (n=2) where technical replicates were averaged for each experiment.
  • Western Blot. Cells were lysed in RIPA Buffer (Sigma) supplemented with protease inhibitor cocktail (Sigma). Protein concentration was measured using BCA protein assay reagent (Thermo Scientific) and BioTek Synergy 2 Multi-Mode Microplate Reader. Lysates were mixed with loading buffer and boiled for 5 min; 25 g of protein were run in NuPage 10% Bis-Tris Gel polyacrylamide gels (Bio-Rad) and transferred to nitrocellulose membranes. Nonspecific antibody binding was blocked with TBST (50 mM Tris, 150 mM NaCl and 0.1% Tween-20) with 5% nonfat milk for 1 hr at room temperature. The membranes were incubated with primary antibodies: (anti-MyoD (1:250, Santa Cruz Sc-32758) in 5% BSA in TBST overnight at 4° C.; anti-Myogenin (1:250, Santa Cruz Sc-12732) in 5% BSA overnight at 4° C.; anti-FLAG-HRP (1:1000, Cell Signaling 2044) in 5% milk in TBST for 60 min at room temperature; anti-GAPDH (1:5000, Cell Signaling, clone 14C10) in 5% milk in TBST for 30 min at room temperature. Membranes were then washed three times with TBST for 15 minutes total. Membranes were incubated with anti-rabbit HRP-conjugated antibody (Sigma, A 6154) or anti-mouse HRP-conjugated antibody (Santa Cruz, SC-2005) diluted 1:5,000 for 30 min and washed with TBST three times for 15 min each. Membranes were visualized using the ImmunStar WesternC Chemiluminescence Kit (Bio-Rad) and images were captured using a ChemiDoc XRS+ System and processed using ImageLab software (Bio-Rad).
  • Cel-I quantification of endogenous gene modification. CRISPR/Cas9 nuclease lesions at the endogenous target site were quantified using the Surveyor nuclease assay, which can detect mutations characteristic of nuclease-mediated NHEJ. After transfection or transduction, cells were incubated for 3-10 days at 37° C. and genomic DNA was extracted using the DNeasy Blood and Tissue kit (Qiagen). The target locus was amplified by 35 cycles of PCR with the AccuPrime High Fidelity PCR kit (Invitrogen). The resulting PCR products were randomly melted and reannealed in a PCR machine with the program: 95° C. for 240 seconds, followed by 85° C. for 60 seconds, 75° C. for 60 seconds, 65° C. for 60 seconds, 55° C. for 60 seconds, 45° C. for 60 seconds, 35° C. for 60 seconds, and 25° C. for 60 seconds with a −0.3° C./second rate between steps. Following re-annealing, 8 μL of PCR product was mixed with 1 μL of Surveyor Nuclease S and 1 μL of Enhancer S (Transgenomic, Omaha, Nebr.) and incubated at 42° C. for 1 hr. After incubation, 6 μL of digestion product was loaded onto a 10% TBE polyacrylamide gel and run at 200 V for 30 minutes. The gels were stained with ethidium bromide and quantified using ImageLab (Bio-Rad) by densitometry (Perez-Pinera et al., Nucleic Acids Res 40:3741-3751 (2012)).
  • Statistical Analysis. At least two independent experiments were compiled as means and standard errors of the mean. Effects were evaluated with multivariate ANOVA and Dunnett's post hoc test using JMP 10 Pro.
  • Example 18 Development of a Single Lentiviral Vector for Multiplex CRISPR/Cas9 Applications
  • A limitation of current CRISPR/Cas9 gene editing systems, particularly transactivator systems, is the simultaneous and efficient delivery of multiple sgRNAs and Cas9 protein for multiplex gene editing and synergistic gene activation applications, especially in difficult to transfect cell types. To overcome this limitation, we developed a single lentiviral vector that efficiently expresses Cas9 and up to four sgRNAs. In order to maximize the expression efficiency of each sgRNA, this vector expresses four sgRNAs from four independent pol III promoters (human U6 promoter, mouse U6 promoter, 7SK, and H1). We validated sgRNA expression from each promoter using end-point RT-PCR to detect a sgRNA targeting the AAVS1 locus (FIG. 42A). To test the activity of each sgRNA expression construct, we co-transfected each promoter construct expressing an sgRNA targeting AAVS1 independently with an active Cas9 expression construct into human HEK293T cells. Notably, we detected consistent and high levels of gene modification at the target locus for each sgRNA that are comparable to a well-characterized zinc-finger nuclease with high activity at the AAVS1 locus (FIG. 42B). Furthermore, lentiviral delivery of different Cas9-based constructs, including an active Cas9 nuclease, dead Cas9, and dead Cas9 fused to the VP64 transactivator domain, resulted in expression of full-length Cas9 protein in HEK293T cells as determined by western blot (FIG. 42C).
  • Using these components, we developed a Golden Gate cloning method to facilitate rapid and efficient cloning of multiple sgRNA expression cassettes into a single lentiviral vector expressing the desired Cas9 effector (FIG. 43). In the first step, oligonucleotides encoding sgRNA protospacer sequences are cloned independently into different expression vectors, each with a distinct promoter driving sgRNA expression. In the second step, each sgRNA expression construct is subcloned into a lentiviral Cas9 expression vector of choice by Golden Gate assembly. This strategy allows for robust and rapid cloning of up to four sgRNAs into a single lentiviral vector for gene editing or activation applications. To express less than four sgRNAs, a PolyT terminator sequence is cloned down-stream of unused promoters to prevent transcription from the unused promoters. Each vector co-expresses the choice Cas9 with eGFP via a 2A skipping peptide to enable fluorescence-activated flow sorting and enrichment of cells with a high multiplicity of infection. Finally, the entire region containing the sgRNA and Cas9 expression cassettes is flanked by loxP sites to mediate removal by Cre-lox excision.
  • Example 19 Validation of a Single Lentiviral sgRNA/Cas9 Expression Vector for Multiplex Genome Engineering
  • To validate the independent activity of each sgRNA, we assembled a single lentiviral vector expressing active Cas9 and four sgRNAs, each targeting an independent loci (FIG. 44A). As control vectors, we assembled constructs expressing only one sgRNA along with polyT protospacers in the other three positions. We transduced HEK293 Ts and primary fibroblasts with lentiviral vectors expressing the indicated sgRNAs and monitored gene modification frequencies at 7 or 10 days post-transduction, respectively (FIG. 44B). In both cell types, the single lentiviral vector mediated highly efficient multiplex editing at all four loci (FIG. 44B). Interestingly, expression of all four sgRNAs together resulted in higher modification frequencies than a single sgRNA alone at 3 out of 4 loci in fibroblasts (FIG. 44B). We observed efficient multiplex gene editing in fibroblasts, which are conventionally a difficult to transfect cell type. These data demonstrate that a single lentivirus can express four active sgRNAs efficiently and that this lentiviral platform can be used to target four distinct loci for multiplex CRISPR/Cas9 gene editing.
  • Example 20 Transient RNA-Guided Gene Activation in Cell Lines Stably Expressing a Lentiviral Cas9-Based Transactivator
  • Next, we were interested in developing a system that enables transient gene activation by transfecting sgRNAs into model cell lines stably expressing Cas9. HEK293 Ts were transduced with different Cas9-T2A-GFP and GFP expression was monitored using flow cytometry. Following normal passaging every 2-3 days, each cell line exhibited stable GFP expression for up to 35 days post transduction. Transduced HEK293 Ts were then transfected with one to four separate sgRNA expression constructs targeting either the IL1RN or HBG1 promoter. Transient transfection of these sgRNA constructs in stable dCas9-VP64 expressing cells lines resulted in tunable endogenous gene activation (FIGS. 45A-45B). Gene activation following transient transfection of sgRNA constructs in cells expressing dCas9-VP64 reached a maximum level of activation approximately 3-6 post-transfection and fell to undetectable levels by 20 days post-transfection (FIGS. 45C-45D). Furthermore, we were able to re-activate each gene by a second transfection of all four sgRNA constructs targeting each promoter, although activation levels were significantly lower than observed from the first transfection (FIGS. 45C-45D). This reduction in activity after the second transfection may be due to reduced vector expression or competitive growth of untransduced cells. Despite this, these data demonstrate that lentiviral Cas9 combined with transient sgRNA delivery can be used as a versatile system to tunably and transiently activate and re-activate target genes in a Cas9 stably tranduced cell line.
  • Example 21 Stable Gene Activation in HEK293T Cells Using a Single Lentiviral sgRNA/Cas9 Transactivator Expression Vector
  • Lentiviral delivery may enable stable, long-term gene activation by CRISPR/Cas9 transactivation. To test this, HEK293 Ts were transduced using a single lentiviral vector encoding dCas9-VP64 and one to four sgRNA expression cassettes. Similar to our transient transfection results (FIGS. 45A-45D), we were able to tunably and robustly activate expression of endogenous IL1RN and HBG1 genes (FIGS. 46A-46B). Gene activation induced by co-transfection of HEK293T cells with dCas9-VP64 and four sgRNAs targeted to the IL1RN and HBG1 promoters peaked three-five days post-transfection and gene expression returned to background levels 15-20 days post-transfection (FIGS. 46A-46B). In contrast, lentiviral delivery of dCas9-VP64 and the same four IL1RN or HBG1-targeted sgRNAs induced sustained gene activation for more than 20 days post-transduction (FIGS. 46C-46D). Thus, single lentiviral delivery of multiplex dCas9-VP64 transactivators is a useful platform to efficiently and stably upregulate target endogenous genes.
  • Example 22 dCas9-KRAB—Targeting the HS2 Enhancer
  • The HS2 enhancer is a well-characterized distal regulatory element necessary for activation of the globin gene locus. dCas9-KRAB with gRNAs targeted to the HS2 enhancer were delivered to determine if this system would repress γ-, ε-, and β-globin expression in the K562 human erythroid leukemia cell line (FIG. 54). A panel of gRNAs was created targeting different sites along the core region of the HS2 enhancer SEQ ID NO: 467). See Table 12.
  • TABLE 12
    HS2 gRNA Target Sequences
    Cr# Protospacer Complete gRNA Sequence
    1 gagacacacagaaatgtaac gagacacacagaaatgtaacgtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 564) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 585)
    2 ggtggggcactgaccccgac ggtggggcactgaccccgacgtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 565) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 586)
    3 ctagagtgatgactcctatc ctagagtgatgactcctatcgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 566) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 587)
    4 gactaaaactccacctcaaa gactaaaactccacctcaaagtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 567) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 588)
    5 aatatgtcacattctgtctc aatatgtcacattctgtctcgtttTAGAGCTAGAAATAGCAAGTTAAAATAAG
    (SEQ ID NO: 568) GCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTG
    CTTTTTTTCC (SEQ ID NO: 589)
    6 ggactatgggaggtcactaa ggactatgggaggtcactaagttttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 569) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 590)
    7 gctcatgcttggactatggg gctcatgcttggactatggggtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 570) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 591)
    8 gttctggccaggcccctgtc gttctggccaggcccctgtcgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 571) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 592)
    9 agtgccccacccccgccttc agtgccccacccccgccttcgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 572) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 593)
    10 gtggggcactgaccccgaca gtggggcactgaccccgacagtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 573) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 594)
    11 aaccttctaagcaaaccttc aaccttctaagcaaaccttcgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 574) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 595)
    12 gttacacagaaccagaaggc gttacacagaaccagaaggcgtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 575) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 596)
    13 gaaggttacacagaaccaga gaaggttacacagaaccagagtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 576) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 597)
    14 agtcatgatgagtcatgctg agtcatgatgagtcatgctggtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 577) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 598)
    15 gatgagtcatgctgaggctt gatgagtcatgctgaggcttgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 578) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 599)
    16 actctaggctgagaacatct actctaggctgagaacatctgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 579) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 600)
    17 gtccccagcaggatgcttac gtccccagcaggatgcttacgtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 580) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 601)
    18 gccctgtaagcatcctgctg gccctgtaagcatcctgctggtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 581) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 602)
    19 cagggcagatggcaaaaaaa cagggcagatggcaaaaaaagtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 582) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 603)
    20 gaggtggagttttagtcagg gaggtggagttttagtcagggtttTAGAGCTAGAAATAGCAAGTTAAAATAA
    (SEQ ID NO: 583) GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGT
    GCTTTTTTTCC (SEQ ID NO: 604)
    21 aaacggcatcataaagaaaa aaacggcatcataaagaaaagtttTAGAGCTAGAAATAGCAAGTTAAAATA
    (SEQ ID NO: 584) AGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG
    TGCTTTTTTTCC (SEQ ID NO: 605)
  • Screening single gRNAs at the globin locus by CRISPR/dCas9. dCas9 and dCas9-KRAB effectors were delivered lentivirally 5-8 days prior to electroporation with 5 μg of a plasmid encoding the U6-sgRNA expression (FIG. 55A). Cells that were not electroporated with gRNA (no gRNA) and cells treated with a gRNA targeting a different locus (IL1RN) were included as controls. Multiple gRNAs effected potent repression of ε-, γ-, and β-globin genes when assayed 3 days post-transfection, with up to 80% knockdown achieved (FIGS. 55B, 55C, 55D). Expressing a gRNA with either dCas9 or dCas9-KRAB inhibited gene expression at the globin locus. Generally, treatment with dCas9-KRAB resulted in stronger repression for a given gRNA compared to dCas9 alone, suggesting an important role for the KRAB domain in recruiting heterochromatin factors that enhance repression. The repression levels achieved are dependent on the amount of gRNA plasmid delivered by transfection only in the dCas9-KRAB treated cells (FIGS. 56A, 56B, 56C). Increasing the dose of Cr4 gRNA plasmid up to 10 μg increases silencing levels of the globin genes in dCas9-KRAB-treated cells.
  • Stable silencing of globin genes by dCas9-KRAB. dCas9/dCas9-KRAB were co-expressed with single gRNAs lentivirally in K562s (FIG. 57A). Cells that were not treated with lentivirus (NT), treated with dCas9/dCas9-KRAB without a gRNA (no gRNA), and with dCas9/dCas9-KRAB and gRNA targeting a different locus (IL1RN) were included as controls. Cells treated with lentivirus were selected from days 4 to 7. Multiple gRNAs effected potent transcriptional repression of ε-, γ-, and β-globin genes when assayed 7 days after transduction, with up to 95% knockdown achieved (FIGS. 57B, 57C, 57D). Expression of β-globin was silenced the most in response gRNAs targeted to the HS2 enhancer. Treatment with dCas9-KRAB with a gRNA resulted in dramatically more repression than treatment with dCas9 and gRNA.
  • These findings demonstrate that dCas9-KRAB targeted to the HS2 enhancer by gRNAs effects potent repression of the distal globin genes. This is the first example of targeted epigenetic control of distal regulatory elements in mammalian cells by the CRISPR/Cas9 system. Enhancers regulate development and disease, and this disclosure provides a method to probe and control enhancer function and may be used to determine the effects of dCas9-KRAB on local chromatin accessibility and genome-wide expression.
  • Example 23 dCas9-p300
  • A dCas9-p300 fusion protein was designed and compared to dCas9-VP64 fusion protein (see FIG. 59). The amino acid constructs of dCas9 constructions are shown in FIGS. 61A-61C. Cells from the Human Embryonic Kidney tissue culture line HEK293T (ATCC; CRL-11268) were seeded at a density of 1.5e5 cells per well in 24-well tissue culture dishes one day prior to transfection with Lipofectamine 2000 transfection reagent (Life Technologies). 24 hrs later cells were transfected with 1 μL Lipofectamine 2000, 375 ng dCas9 expression construct (dCas9, dCas9VP64, or dCas9p300 respectively), and 125 ng of pooled gRNA expression plasmids (4 each at equimolar ratios). Table 13 shows the gRNA information.
  • TABLE 13
    gRNA information
    Genomic
    Location
    (GRCh38
    Target Protospacer Sequence Primary
    Location (5′-3′) Assembly) Reference
    IL1RN TGTACTCTCTGAGGTGCTC Chr2: Perez-Pinera et
    Promoter (SEQ ID NO: 606) 113117865-113117883 al., Nat Methods,
    2013
    IL1RN ACGCAGATAAGAACCAGTT Chr2: Perez-Pinera et
    Promoter (SEQ ID NO: 607) 113117714-113117732 al., Nat Methods,
    2013
    IL1RN CATCAAGTCAGCCATCAGC Chr2: Perez-Pinera et
    Promoter (SEQ ID NO: 608) 113117781-113117799 al., Nat Methods,
    2013
    IL1RN GAGTCACCCTCCTGGAAAC Chr2: Perez-Pinera et
    Promoter (SEQ ID NO: 609) 113117749-113117767 al., Nat Methods,
    2013
    MyoD Promoter CCTGGGCTCCGGGGCGTTT Chr11: Perez-Pinera et
    (SEQ ID NO: 610) 17719509-17719527 al., Nat Methods,
    2013
    MyoD Promoter GGCCCCTGCGGCCACCCCG Chr11: Perez-Pinera et
    (SEQ ID NO: 611) 17719422-17719440 al., Nat Methods,
    2013
    MyoD Promoter CTCCCTCCCTGCCCGGTAG Chr11: Perez-Pinera et
    (SEQ ID NO: 612) 17719350-17719368 al., Nat Methods,
    2013
    MyoD Promoter AGGTTTGGAAAGGGCGTGC Chr11: Perez-Pinera et
    (SEQ ID NO: 613) 17719290-17719308 al., Nat Methods,
    2013
    Oct4 Promoter ACTCCACTGCACTCCAGTCT Chr6: Hu et al., Nucleic
    (SEQ ID NO: 614) 31170953-31170934 Acids Res, 2014
    Oct4 Promoter TCTGTGGGGGACCTGCACTG Chr6: Hu et al., Nucleic
    (SEQ ID NO: 615) 31170885-31170866 Acids Res, 2014
    Oct4 Promoter GGGGCGCCAGTTGTGTCTCC Chr6: Hu et al., Nucleic
    (SEQ ID NO: 616) 31170855-31170836 Acids Res, 2014
    Oct4 Promoter ACACCATTGCCACCACCATT Chr6: Hu et al., Nucleic
    (SEQ ID NO: 617) 31170816-31170797 Acids Res, 2014
  • The 3 days post-transfection cells were harvested and assayed by RT-QPCR for mRNA expression. The RT-QPCR primer sequences are listed in Table 14.
  • TABLE 14
    RT-QPCR Primers
    Primer Primer Sequence
    Target (5′-3′) Reference
    GAPDH CAATGACCCCTTCATTGACC Perez-Pinera et al.,
    Forward (SEQ ID NO: 618) Nat Methods, 2013
    GAPDH TTGATTTTGGAGGGATCTCG Perez-Pinera et al.,
    Reverse (SEQ ID NO: 619) Nat Methods, 2013
    IL1RN GGAATCCATGGAGGGAAGAT Perez-Pinera et al.,
    Forward (SEQ ID NO: 620) Nat Methods, 2013
    IL1RN TGTTCTCGCTCAGGTCAGTG Perez-Pinera et al.,
    Reverse (SEQ ID NO: 621) Nat Methods, 2013
    MyoD CTCTCTGCTCCTTTGCCACA Perez-Pinera et al.,
    Forward (SEQ ID NO: 622) Nat Methods, 2013
    MyoD GTGCTCTTCGGGTTTCAGGA Perez-Pinera et al.,
    Reverse (SEQ ID NO: 623) Nat Methods, 2013
    Oct4 CGAAAGAGAAAGCGAACCAGTAT Hu et al., Nucleic
    Forward CGAGAAC (SEQ ID NO: 624) Acids Res, 2014
    Oct4 CGTTGTGCATAGTCGCTGCTTGA Hu et al., Nucleic
    Reverse TCGC (SEQ ID NO: 625) Acids Res, 2014
  • RT-QPCR was normalized to GAPDH expression using the ΔΔCt method. Results are expressed as fold-increase expression of the gene of interest relative to cells treated with Lipofectamine only without DNA transfected (“No DNA”) (See FIGS. 60A-60C).
  • FIG. 62 shows that mutating residues in the p300 HAT domain causes a loss of its ability to activate gene expression. FIGS. 63A-63B shows that multiple gRNAs work synergistically with dCas-9-p300, as showed with dCas-9-VP64.
  • Example 24
  • FIGS. 64A-64C shows TALEN mediated integration of minidystrophin at the 5′UTR of the Dp427m skeletal muscle isoform of dystrophin in skeletal myoblast cell lines derived from human DMD patients carrying different deletions in the dystrophin gene. DMD patient cells were electroporated with constructs encoding a TALEN pair active at the 5′UTR locus and a donor template carrying the minidystrophin gene. FIG. 64A shows a schematic of how minidystrophin was integrated into the 5′UTR. FIG. 64B shows that hygromycin-resistant clonal cell lines were isolated and screened by PCR for successful site-specific integrations at the 5′UTR using the primers shown in FIG. 64A. Asterisks indicate clones selected for further analysis in FIG. 64C. FIG. 64C shows that clonally isolated DMD myoblasts with detected integration events were differentiated for 6 days and assessed for expression of an HA tag fused to the C terminus of minidystrophin.
  • It is understood that the foregoing detailed description and accompanying examples are merely illustrative and are not to be taken as limitations upon the scope of the invention, which is defined solely by the appended claims and their equivalents.
  • Various changes and modifications to the disclosed embodiments will be apparent to those skilled in the art. Such changes and modifications, including without limitation those relating to the chemical structures, substituents, derivatives, intermediates, syntheses, compositions, formulations, or methods of use of the invention, may be made without departing from the spirit and scope thereof.
  • APPENDIX
    hCas9-T2A-GFP DNA sequence: SEQ ID NO: 145 (SpCas9 human optimized sequence, 
    Figure US20210002665A1-20210107-P00001
    Figure US20210002665A1-20210107-P00002
    , T2A peptide, eGFP sequence)
    gccaccATGGACAAGAAGTACTCCATTGGGCTCGATATCGGCACAAACAGCGTCGGCTGGGCCGTCATTACGGACGAGTA
    CAAGGTGCCGAGCAAAAAATTCAAAGTTCTGGGCAATACCGATCGCCACAGCATAAAGAAGAACCTCATTGGCGCCCTCC
    TGTTCGACTCCGGGGAGACGGCCGAAGCCACGCGGCTCAAAAGAACAGCACGGCGCAGATATACCCGCAGAAAGAATCGG
    ATCTGCTACCTGCAGGAGATCTTTAGTAATGAGATGGCTAAGGTGGATGACTCTTTCTTCCATAGGCTGGAGGAGTCCTT
    TTTGGTGGAGGAGGATAAAAAGCACGAGCGCCACCCAATCTTTGGCAATATCGTGGACGAGGTGGCGTACCATGAAAAGT
    ACCCAACCATATATCATCTGAGGAAGAAGCTTGTAGACAGTACTGATAAGGCTGACTTGCGGTTGATCTATCTCGCGCTG
    GCGCATATGATCAAATTTCGGGGACACTTCCTCATCGAGGGGGACCTGAACCCAGACAACAGCGATGTCGACAAACTCTT
    TATCCAACTGGTTCAGACTTACAATCAGCTTTTCGAAGAGAACCCGATCAACGCATCCGGAGTTGACGCCAAAGCAATCC
    TGAGCGCTAGGCTGTCCAAATCCCGGCGGCTCGAAAACCTCATCGCACAGCTCCCTGGGGAGAAGAAGAACGGCCTGTTT
    GGTAATCTTATCGCCCTGTCACTCGGGCTGACCCCCAACTTTAAATCTAACTTCGACCTGGCCGAAGATGCCAAGCTTCA
    ACTGAGCAAAGACACCTACGATGATGATCTCGACAATCTGCTGGCCCAGATCGGCGACCAGTACGCAGACCTTTTTTTGG
    CGGCAAAGAACCTGTCAGACGCCATTCTGCTGAGTGATATTCTGCGAGTGAACACGGAGATCACCAAAGCTCCGCTGAGC
    GCTAGTATGATCAAGCGCTATGATGAGCACCACCAAGACTTGACTTTGCTGAAGGCCCTTGTCAGACAGCAACTGCCTGA
    GAAGTACAAGGAAATTTTCTTCGATCAGTCTAAAAATGGCTACGCCGGATACATTGACGGCGGAGCAAGCCAGGAGGAAT
    TTTACAAATTTATTAAGCCCATCTTGGAAAAAATGGACGGCACCGAGGAGCTGCTGGTAAAGCTTAACAGAGAAGATCTG
    TTGCGCAAACAGCGCACTTTCGACAATGGAAGCATCCCCCACCAGATTCACCTGGGCGAACTGCACGCTATCCTCAGGCG
    GCAAGAGGATTTCTACCCCTTTTTGAAAGATAACAGGGAAAAGATTGAGAAAATCCTCACATTTCGGATACCCTACTATG
    TAGGCCCCCTCGCCCGGGGAAATTCCAGATTCGCGTGGATGACTCGCAAATCAGAAGAGACCATCACTCCCTGGAACTTC
    GAGGAAGTCGTGGATAAGGGGGCCTCTGCCCAGTCCTTCATCGAAAGGATGACTAACTTTGATAAAAATCTGCCTAACGA
    AAAGGTGCTTCCTAAACACTCTCTGCTGTACGAGTACTTCACAGTTTATAACGAGCTCACCAAGGTCAAATACGTCACAG
    AAGGGATGAGAAAGCCAGCATTCCTGTCTGGAGAGCAGAAGAAAGCTATCGTGGACCTCCTCTTCAAGACGAACCGGAAA
    GTTACCGTGAAACAGCTCAAAGAAGACTATTTCAAAAAGATTGAATGTTTCGACTCTGTTGAAATCAGCGGAGTGGAGGA
    TCGCTTCAACGCATCCCTGGGAACGTATCACGATCTCCTGAAAATCATTAAAGACAAGGACTTCCTGGACAATGAGGAGA
    ACGAGGACATTCTTGAGGACATTGTCCTCACCCTTACGTTGTTTGAAGATAGGGAGATGATTGAAGAACGCTTGAAAACT
    TACGCTCATCTCTTCGACGACAAAGTCATGAAACAGCTCAAGAGGCGCCGATATACAGGATGGGGGCGGCTGTCAAGAAA
    ACTGATCAATGGGATCCGAGACAAGCAGAGTGGAAAGACAATCCTGGATTTTCTTAAGTCCGATGGATTTGCCAACCGGA
    ACTTCATGCAGTTGATCCATGATGACTCTCTCACCTTTAAGGAGGACATCCAGAAAGCACAAGTTTCTGGCCAGGGGGAC
    AGTCTTCACGAGCACATCGCTAATCTTGCAGGTAGCCCAGCTATCAAAAAGGGAATACTGCAGACCGTTAAGGTCGTGGA
    TGAACTCGTCAAAGTAATGGGAAGGCATAAGCCCGAGAATATCGTTATCGAGATGGCCCGAGAGAACCAAACTACCCAGA
    AGGGACAGAAGAACAGTAGGGAAAGGATGAAGAGGATTGAAGAGGGTATAAAAGAACTGGGGTCCCAAATCCTTAAGGAA
    CACCCAGTTGAAAACACCCAGCTTCAGAATGAGAAGCTCTACCTGTACTACCTGCAGAACGGCAGGGACATGTACGTGGA
    TCAGGAACTGGACATCAATCGGCTCTCCGACTACGACGTGGATCATATCGTGCCCCAGTCTTTTCTCAAAGATGATTCTA
    TTGATAATAAAGTGTTGACAAGATCCGATAAAAATAGAGGGAAGAGTGATAACGTCCCCTCAGAAGAAGTTGTCAAGAAA
    ATGAAAAATTATTGGCGGCAGCTGCTGAACGCCAAACTGATCACACAACGGAAGTTCGATAATCTGACTAAGGCTGAACG
    AGGTGGCCTGTCTGAGTTGGATAAAGCCGGCTTCATCAAAAGGCAGCTTGTTGAGACACGCCAGATCACCAAGCACGTGG
    CCCAAATTCTCGATTCACGCATGAACACCAAGTACGATGAAAATGACAAACTGATTCGAGAGGTGAAAGTTATTACTCTG
    AAGTCTAAGCTGGTCTCAGATTTCAGAAAGGACTTTCAGTTTTATAAGGTGAGAGAGATCAACAATTACCACCATGCGCA
    TGATGCCTACCTGAATGCAGTGGTAGGCACTGCACTTATCAAAAAATATCCCAAGCTTGAATCTGAATTTGTTTACGGAG
    ACTATAAAGTGTACGATGTTAGGAAAATGATCGCAAAGTCTGAGCAGGAAATAGGCAAGGCCACCGCTAAGTACTTCTTT
    TACAGCAATATTATGAATTTTTTCAAGACCGAGATTACACTGGCCAATGGAGAGATTCGGAAGCGACCACTTATCGAAAC
    AAACGGAGAAACAGGAGAAATCGTGTGGGACAAGGGTAGGGATTTCGCGACAGTCCGGAAGGTCCTGTCCATGCCGCAGG
    TGAACATCGTTAAAAAGACCGAAGTACAGACCGGAGGCTTCTCCAAGGAAAGTATCCTCCCGAAAAGGAACAGCGACAAG
    CTGATCGCACGCAAAAAAGATTGGGACCCCAAGAAATACGGCGGATTCGATTCTCCTACAGTCGCTTACAGTGTACTGGT
    TGTGGCCAAAGTGGAGAAAGGGAAGTCTAAAAAACTCAAAAGCGTCAAGGAACTGCTGGGCATCACAATCATGGAGCGAT
    CAAGCTTCGAAAAAAACCCCATCGACTTTCTCGAGGCGAAAGGATATAAAGAGGTCAAAAAAGACCTCATCATTAAGCTT
    CCCAAGTACTCTCTCTTTGAGCTTGAAAACGGCCGGAAACGAATGCTCGCTAGTGCGGGCGAGCTGCAGAAAGGTAACGA
    GCTGGCACTGCCCTCTAAATACGTTAATTTCTTGTATCTGGCCAGCCACTATGAAAAGCTCAAAGGGTCTCCCGAAGATA
    ATGAGCAGAAGCAGCTGTTCGTGGAACAACACAAACACTACCTTGATGAGATCATCGAGCAAATAAGCGAATTCTCCAAA
    AGAGTGATCCTCGCCGACGCTAACCTCGATAAGGTGCTTTCTGCTTACAATAAGCACAGGGATAAGCCCATCAGGGAGCA
    GGCAGAAAACATTATCCACTTGTTTACTCTGACCAACTTGGGCGCGCCTGCAGCCTTCAAGTACTTCGACACCACCATAG
    ACAGAAAGCGGTACACCTCTACAAAGGAGGTCCTGGACGCCACACTGATTCATCAGTCAATTACGGGGCTCTATGAAACA
    AGAATCGACCTCTCTCAGCTCGGTGGAGACAGCAGGGCTGAC
    Figure US20210002665A1-20210107-P00003
    Figure US20210002665A1-20210107-P00004
    GCTAGCG AGGGCAGAGG
    AAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTGgtacC
    Figure US20210002665A1-20210107-P00005
    Figure US20210002665A1-20210107-P00006
    Figure US20210002665A1-20210107-P00007
    Figure US20210002665A1-20210107-P00008
    Figure US20210002665A1-20210107-P00009
    Figure US20210002665A1-20210107-P00010
    Figure US20210002665A1-20210107-P00011
    Figure US20210002665A1-20210107-P00012
    Figure US20210002665A1-20210107-P00013
    Figure US20210002665A1-20210107-P00014
    Figure US20210002665A1-20210107-P00015
    Figure US20210002665A1-20210107-P00016
    Figure US20210002665A1-20210107-P00017
    Figure US20210002665A1-20210107-P00018
    Figure US20210002665A1-20210107-P00019
    Figure US20210002665A1-20210107-P00020
    Figure US20210002665A1-20210107-P00021
    Figure US20210002665A1-20210107-P00022
    Figure US20210002665A1-20210107-P00023
    Figure US20210002665A1-20210107-P00024
    Figure US20210002665A1-20210107-P00025
    Figure US20210002665A1-20210107-P00026
    Figure US20210002665A1-20210107-P00027
    Figure US20210002665A1-20210107-P00028
    Figure US20210002665A1-20210107-P00029
    Figure US20210002665A1-20210107-P00030
    Figure US20210002665A1-20210107-P00031
    Figure US20210002665A1-20210107-P00032
    Figure US20210002665A1-20210107-P00033
    Figure US20210002665A1-20210107-P00034
    Figure US20210002665A1-20210107-P00035
    Figure US20210002665A1-20210107-P00036
    Figure US20210002665A1-20210107-P00037
    Figure US20210002665A1-20210107-P00038
    Figure US20210002665A1-20210107-P00039
    Figure US20210002665A1-20210107-P00040
    Figure US20210002665A1-20210107-P00041
    Figure US20210002665A1-20210107-P00042
    Figure US20210002665A1-20210107-P00043
    Figure US20210002665A1-20210107-P00044
    Figure US20210002665A1-20210107-P00045
    Figure US20210002665A1-20210107-P00046
    Figure US20210002665A1-20210107-P00047
    Figure US20210002665A1-20210107-P00048
    Figure US20210002665A1-20210107-P00049
    Figure US20210002665A1-20210107-P00050
    Figure US20210002665A1-20210107-P00051
    Figure US20210002665A1-20210107-P00052
    Figure US20210002665A1-20210107-P00053
    Figure US20210002665A1-20210107-P00054
    Figure US20210002665A1-20210107-P00055
    Figure US20210002665A1-20210107-P00056
    Figure US20210002665A1-20210107-P00057
    Figure US20210002665A1-20210107-P00058
    Figure US20210002665A1-20210107-P00059
    Figure US20210002665A1-20210107-P00060
    Figure US20210002665A1-20210107-P00061
    Figure US20210002665A1-20210107-P00062
    Figure US20210002665A1-20210107-P00063
    AccggTTAG
    AAV/Rosa26 construct (SEQ ID NO: 456)
    ggggggggggggggggggttggccactccctctctgcgcgctcgctcgctcactgaggccgggcgaccaaaggtcgcccg
    acgcccgggctttgcccgggcggcctcagtgagcgagcgagcgcgcagagagggagtggccaactccatcactaggggtt
    cctagatctgaattcggtacccgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccat
    tgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacgg
    taaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcc
    cgcctggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagtcatcgctatta
    ccatggtgatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccacccc
    attgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgac
    gcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagatcgcctggagac
    gccatccacgctgttttgacctccatagaagacaccgggaccgatccagcctccggactctagaggatccggtactcgag
    gaactgaaaaaccagaaagttaactggtaagtttagtctttttgtcttttatttcaggtcccggatccggtggtggtgca
    aatcaaagaactgctcctcagtggatgttgcctttacttctaggcctgtacggaagtgttacttctgctctaaaagctgc
    ggaattgtacccgcggcccgggatccaccggTGGCTAGCgtctataggcccacccccTTGGTGGAATTCGCCATGAGGTC
    TGACTACAAAGACCATGACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGATGGCCCCCAAGA
    AGAAGaggaaggtgggcctcgaGCCCGGAGAAAAACCGTACAAGTGCCCTGAGTGCGGGAAATCATTCTCCGACCCTGGG
    GCGCTCGTCCGGCACCAAAGGACGCATACAGGGGAAAAGCCGTATAAGTGCCCCGAGTGTGGAAAGAGCTTCTCGCAGAG
    AGCCCACCTTGAACGACACCAAAGAACACACACTGGTGAGAAACCCTATAAGTGTCCAGAGTGCGGCAAATCGTTTAGCA
    GATCCGATGACTTGGTGCGCCACCAGCGGACACACACGGGTGAAAAGCCCTACAAATGCCCGGAGTGTGGGAAGTCGTTT
    TCAAGGTCGGATCATCTGACTACCCATCAGCGCACCCATACGGGAGCggccgcccgcgccctGGTGAAGAGCGAGCTGGA
    GGAGAAGAAGTCCGAGCTGCGGCACAAGCTGAAGTACGTGCCCCACGAGTACATCGAGCTGATCGAGATCGCCAGGAACC
    CCACCCAGGACCGCATCCTGGAGATGAAGGTGATGGAGTTCTTCATGAAGGTGTACGGCTACAGGGGAGAGCACCTGGGC
    GGAAGCAGAAAGCCTGACGGCGCCATCTATACAGTGGGCAGCCCCATCGATTACGGCGTGATCGTGGACACAAAGGCCTA
    CAGCGGCGGCTACAATCTGCCTATCGGCCAGGCCGACGAGATGCAGAGATACGTGAAGGAGAACCAGACCCGGAATAAGC
    ACATCAACCCCAACGAGTGGTGGAAGGTGTACCCTAGCAGCGTGACCGAGTTCAAGTTCCTGTTCGTGAGCGGCCACTTC
    AAGGGCAACTACAAGGCCCAGCTGACCAGGCTGAACCGCAAAACCAACTGCAATGGCGCCGTGCTGAGCGTGGAGGAGCT
    GCTGATCGGCGGCGAGATGATCAAAGCCGGCACCCTGACACTGGAGGAGGTGCGGCGCAAGTTCAACAACGGCGAGATCA
    ACTTCGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTAgatcTGACTACAAAGACCAT
    GACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGATGGCCCCCAAGAAGAAGaggaaggtggg
    cctcgagccGGGAGAGAAGCCGTACAAGTGTCCCGAATGTGGAAAGAGCTTCTCACAGTCGGGGGACCTTCGGCGCCACC
    AGCGCACACATACTGGTGAAAAGCCGTATAAGTGTCCAGAATGTGGCAAATCATTCTCCACATCAGGGAGCCTGGTCAGG
    CACCAGCGAACCCACACGGGTGAGAAGCCCTATAAGTGCCCCGAATGCGGGAAGTCCTTTTCGCAGAGAGCCCACTTGGA
    GAGGCACCAGAGGACCCATACGGGGGAGAAACCTTACAAGTGCCCTGAATGCGGAAAGTCGTTCTCGACCCATCTGGATC
    TCATCAGACATCAGAGAACGCACACTGGAGAGAAACCCTACAAATGTCCCGAGTGTGGGAAGTCGTTTAGCCGAAAGGAC
    AATCTCAAAAACCATCAACGGACACACACGGGTGAAAAACCATACAAATGCCCGGAGTGCGGCAAATCGTTTTCCCAACT
    TGCGCACTTGCGGGCACACCAACGCACGCATACTGGAGCGGCCGCccgcgccCTGGTGAAGAGCGAGCTGGAGGAGAAGA
    AGTCCGAGCTGCGGCACAAGCTGAAGTACGTGCCCCACGAGTACATCGAGCTGATCGAGATCGCCAGGAACCCCACCCAG
    GACCGCATCCTGGAGATGAAGGTGATGGAGTTCTTCATGAAGGTGTACGGCTACAGGGGAGAGCACCTGGGCGGAAGCAG
    AAAGCCTGACGGCGCCATCTATACAGTGGGCAGCCCCATCGATTACGGCGTGATCGTGGACACAAAGGCCTACAGCGGCG
    GCTACAATCTGCCTATCGGCCAGGCCGACGAGATGGAGAGATACGTGGAGGAGAACCAGACACGGGATAAGCACCTCAAC
    CCCAACGAGTGGTGGAAGGTGTACCCTAGCAGCGTGACCGAGTTCAAGTTCCTGTTCGTGAGCGGCCACTTCAAGGGCAA
    CTACAAGGCCCAGCTGACCAGGCTGAACCACATCACCAACTGCAATGGCGCCGTGCTGAGCGTGGAGGAGCTGCTGATCG
    GCGGCGAGATGATCAAAGCCGGCACCCTGACACTGGAGGAGGTGCGGCGCAAGTTCAACAACGGCGAGATCAACTTCTGA
    TTAATTAACTAATCTAGAGTcgactagagctcgctgatcagcctcgactgtgccttctagttgccagccatctgttgttt
    gcccctcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcg
    cattgtctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaagacaatag
    caggcatgctggggagagatctaggaacccctagtgatggagttggccactccctctctgcgcgctcgctcgctcactga
    ggccgcccgggcaaagcccgggcgtcgggcgacctttggtcgcccggcctcagtgagcgagcgagcgcgcagagagggag
    tggccaacccccccccccccccccctgcagcccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgt
    attgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactc
    aaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggcca
    ggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctca
    agtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgt
    tccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgta
    ggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgcc
    ttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggat
    tagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtat
    ttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgct
    ggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttc
    tacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacct
    agatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgc
    ttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataac
    tacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttat
    cagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaat
    tgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggt
    gtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgt
    gcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatg
    gcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcatt
    ctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactt
    taaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatg
    taacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggca
    aaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagca
    tttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcaca
    tttccccgaaaagtgccacctgacgtctaagaaaccattattatcatgacattaacctataaaaataggcgtatcacgag
    gccctttcgtctcgcgcgtttcggtgatgacggtgaaaacctctgacacatgcagctcccggagacggtcacagcttgtc
    tgtaagcggatgccgggagcagacaagcccgtcagggcgcgtcagcgggtgttggcgggtgtcggggctggcttaactat
    gcggcatcagagcagattgtactgagagtgcaccatatgcggtgtgaaataccgcacagatgcgtaaggagaaaataccg
    catcaggaaattgtaaacgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctcattttttaaccaata
    ggccgaaatcggcaaaatcccttataaatcaaaagaatagaccgagatagggttgagtgttgttccagtttggaacaaga
    gtccactattaaagaacgtggactccaacgtcaaagggcgaaaaaccgtctatcagggcgatggcccactacgtgaacca
    tcaccctaatcaagttttttggggtcgaggtgccgtaaagcactaaatcggaaccctaaagggagcccccgatttagagc
    ttgacggggaaagccggcgaacgtggcgagaaaggaagggaagaaagcgaaaggagcgggcgctagggcgctggcaagtg
    tagcggtcacgctgcgcgtaaccaccacacccgccgcgcttaatgcgccgctacagggcgcgtcgcgccattcgccattc
    aggctacgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccagctggctgca
    HS2 Enhancer Target Sequence (SEQ ID NO: 467)
    taagcttcagtttttccttagttcctgttacatttctgtgtgtctccattagtgacctcccatagtccaagcatgagcag
    ttctggccaggcccctgtcggggtcagtgccccacccccgccttctggttctgtgtaaccttctaagcaaaccttctggc
    tcaagcacagcaatgctgagtcatgatgagtcatgctgaggcttagggtgtgtgcccagatgctctcagcctagagtgat
    gactcctatctgggtccccagcaggatgcttacagggcagatggcaaaaaaaaggagaagctgaccacctgactaaaact
    ccacctcaaacggcatcataaagaaaatggatgcctgagacagaatgtgacatattctagaatatatt
    dSpCas9-KRAB Sequence (SEQ ID NO: 466)
    ATGGACTACAAAGACCATGACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGatggcccccaa
    gaagaagaggaaggtgggccgcggaATGGACAAGAAGTACTCCATTGGGCTCGCCATCGGCACAAACAGCGTCGGCTGGG
    CCGTCATTACGGACGAGTACAAGGTGCCGAGCAAAAAATTCAAAGTTCTGGGCAATACCGATCGCCACAGCATAAAGAAG
    AACCTCATTGGCGCCCTCCTGTTCGACTCCGGGGAAACCGCCGAAGCCACGCGGCTCAAAAGAACAGCACGGCGCAGATA
    TACCCGCAGAAAGAATCGGATCTGCTACCtgcaGGAGATCTTTAGTAATGAGATGGCTAAGGTGGATGACTCTTTCTTCC
    ATAGGCTGGAGGAGTCCTTTTTGGTGGAGGAGGATAAAAAGCACGAGCGCCACCCAATCTTTGGCAATATCGTGGACGAG
    GTGGCGTACCATGAAAAGTACCCAACCATATATCATCTGAGGAAGAAGCTTGTAGACAGTACTGATAAGGCTGACTTGCG
    GTTGATCTATCTCGCGCTGGCGCATATGATCAAATTTCGGGGACACTTCCTCATCGAGGGGGACCTGAACCCAGACAACA
    GCGATGTCGACAAACTCTTTATCCAACTGGTTCAGACTTACAATCAGCTTTTCGAAGAGAACCCGATCAACGCATCCGGA
    GTTGACGCCAAAGCAATCCTGAGCGCTAGGCTGTCCAAATCCCGGCGGCTCGAAAACCTCATCGCACAGCTCCCTGGGGA
    GAAGAAGAACGGCCTGTTTGGTAATCTTATCGCCCTGTCACTCGGGCTGACCCCCAACTTTAAATCTAACTTCGACCTGG
    CCGAAGATGCCAAGCTTCAACTGAGCAAAGACACCTACGATGATGATCTCGACAATCTGCTGGCCCAGATCGGCGACCAG
    TACGCAGACCTTTTTTTGGCGGCAAAGAACCTGTCAGACGCCATTCTGCTGAGTGATATTCTGCGAGTGAACACGGAGAT
    CACCAAAGCTCCGCTGAGCGCTAGTATGATCAAGCGCTATGATGAGCACCACCAAGACTTGACTTTGCTGAAGGCCCTTG
    TCAGACAGCAACTGCCTGAGAAGTACAAGGAAATTTTCTTCGATCAGTCTAAAAATGGCTACGCCGGATACATTGACGGC
    GGAGCAAGCCAGGAGGAATTTTACAAATTTATTAAGCCCATCTTGGAAAAAATGGACGGCACCGAGGAGCTGCTGGTAAA
    GCTTAACAGAGAAGATCTGTTGCGCAAACAGCGCACTTTCGACAATGGAAGCATCCCCCACCAGATTCACCTGGGCGAAC
    TGCACGCTATCCTCAGGCGGCAAGAGGATTTCTACCCCTTTTTGAAAGATAACAGGGAAAAGATTGAGAAAATCCTCACA
    TTTCGGATACCCTACTATGTAGGCCCCCTCGCCCGGGGAAATTCCAGATTCGCGTGGATGACTCGCAAATCAGAAGAGAC
    CATCACTCCCTGGAACTTCGAGGAAGTCGTGGATAAGGGGGCCTCTGCCCAGTCCTTCATCGAAAGGATGACTAACTTTG
    ATAAAAATCTGCCTAACGAAAAGGTGCTTCCTAAACACTCTCTGCTGTACGAGTACTTCACAGTTTATAACGAGCTCACC
    AAGGTCAAATACGTCACAGAAGGGATGAGAAAGCCAGCATTCCTGTCTGGAGAGCAGAAGAAAGCTATCGTGGACCTCCT
    CTTCAAGACGAACCGGAAAGTTACCGTGAAACAGCTCAAAGAAGACTATTTCAAAAAGATTGAATGTTTCGACTCTGTTG
    AAATCAGCGGAGTGGAGGATCGCTTCAACGCATCCCTGGGAACGTATCACGATCTCCTGAAAATCATTAAAGACAAGGAC
    TTCCTGGACAATGAGGAGAACGAGGACATTCTTGAGGACATTGTCCTCACCCTTACGTTGTTTGAAGATAGGGAGATGAT
    TGAAGAACGCTTGAAAACTTACGCTCATCTCTTCGACGACAAAGTCATGAAACAGCTCAAGAGGCGCCGATATACAGGAT
    GGGGGCGGCTGTCAAGAAAACTGATCAATGGgatcCGAGACAAGCAGAGTGGAAAGACAATCCTGGATTTTCTTAAGTCC
    GATGGATTTGCCAACCGGAACTTCATGCAGTTGATCCATGATGACTCTCTCACCTTTAAGGAGGACATCCAGAAAGCACA
    AGTTTCTGGCCAGGGGGACAGTCTTCACGAGCACATCGCTAATCTTGCAGGTAGCCCAGCTATCAAAAAGGGAATACTGC
    AGACCGTTAAGGTCGTGGATGAACTCGTCAAAGTAATGGGAAGGCATAAGCCCGAGAATATCGTTATCGAGATGGCCCGA
    GAGAACCAAACTACCCAGAAGGGACAGAAGAACAGTAGGGAAAGGATGAAGAGGATTGAAGAGGGTATAAAAGAACTGGG
    GTCCCAAATCCTTAAGGAACACCCAGTTGAAAACACCCAGCTTCAGAATGAGAAGCTCTACCTGTACTACCTGCAGAACG
    GCAGGGACATGTACGTGGATCAGGAACTGGACATCAATCGGCTCTCCGACTACGACGTGGATGCCATCGTGCCCCAGTCT
    TTTCTCAAAGATGATTCTATTGATAATAAAGTGTTGACAAGATCCGATAAAAATAGAGGGAAGAGTGATAACGTCCCCTC
    AGAAGAAGTTGTCAAGAAAATGAAAAATTATTGGCGGCAGCTGCTGAACGCCAAACTGATCACACAACGGAAGTTCGATA
    ATCTGACTAAGGCTGAACGAGGTGGCCTGTCTGAGTTGGATAAAGCCGGCTTCATCAAAAGGCAGCTTGTTGAGACACGC
    CAGATCACCAAgcacGTGGCCCAAATTCTCGATTCACGCATGAACACCAAGTACGATGAAAATGACAAACTGATTCGAGA
    GGTGAAAGTTATTACTCTGAAGTCTAAGCTGGTCTCAGATTTCAGAAAGGACTTTCAGTTTTATAAGGTGAGAGAGATCA
    ACAATTACCACCATGCGCATGATGCCTACCTGAATGCAGTGGTAGGCACTGCACTTATCAAAAAATATCCCAAGCTTGAA
    TCTGAATTTGTTTACGGAGACTATAAAGTGTACGATGTTAGGAAAATGATCGCAAAGTCTGAGCAGGAAATAGGCAAGGC
    CACCGCTAAGTACTTCTTTTACAGCAATATTATGAATTTTTTCAAGACCGAGATTACACTGGCCAATGGAGAGATTCGGA
    AGCGACCACTTATCGAAACAAACGGAGAAACAGGAGAAATCGTGTGGGACAAGGGTAGGGATTTCGCGACAGTCCGGAAG
    GTCCTGTCCATGCCGCAGGTGAACATCGTTAAAAAGACCGAAGTACAGACCGGAGGCTTCTCCAAGGAAAGTATCCTCCC
    GAAAAGGAACAGCGACAAGCTGATCGCACGCAAAAAAGATTGGGACCCCAAGAAATACGGCGGATTCGATTCTCCTACAG
    TCGCTTACAGTGTACTGGTTGTGGCCAAAGTGGAGAAAGGGAAGTCTAAAAAACTCAAAAGCGTCAAGGAACTGCTGGGC
    ATCACAATCATGGAGCGATCAAGCTTCGAAAAAAACCCCATCGACTTTCTCGAGGCGAAAGGATATAAAGAGGTCAAAAA
    AGACCTCATCATTAAGCTTCCCAAGTACTCTCTCTTTGAGCTTGAAAACGGCCGGAAACGAATGCTCGCTAGTGCGGGCG
    AGCTGCAGAAAGGTAACGAGCTGGCACTGCCCTCTAAATACGTTAATTTCTTGTATCTGGCCAGCCACTATGAAAAGCTC
    AAAGGGTCTCCCGAAGATAATGAGCAGAAGCAGCTGTTCGTGGAACAACACAAACACTACCTTGATGAGATCATCGAGCA
    AATAAGCGAATTCTCCAAAAGAGTGATCCTCGCCGACGCTAACCTCGATAAGGTGCTTTCTGCTTACAATAAGCACAGGG
    ATAAGCCCATCAGGGAGCAGGCAGAAAACATTATCCACTTGTTTACTCTGACCAACTTGGGCGCGCCTGCAGCCTTCAAG
    TACTTCGACACCACCATAGACAGAAAGCGGTACACCTCTACAAAGGAGGTCCTGGACGCCACACTGATTCATCAGTCAAT
    TACGGGGCTCTATGAAACAAGAATCGACCTCTCTCAGCTCGGTGGAGACAGCAGGGCTGACCCCAAGAAGAAGAGGAAGG
    TGGctagCGATGCTAAGTCACTGACTGCCTGGTCCCGGACACTGGTGACCTTCAAGGATGTGTTTGTGGACTTCACCAGG
    GAGGAGTGGAAGCTGCTGGACACTGCTCAGCAGATCCTGTACAGAAATGTGATGCTGGAGAACTATAAGAACCTGGTTTC
    CTTGGGTTATCAGCTTACTAAGCCAGATGTGATCCTCCGGTTGGAGAAGGGAGAAGAGCCCTGGCTGGTGGAGAGAGAAA
    TTCACCAAGAGACCCATCCTGATTCAGAGACTGCATTTGAAATCAAATCATCAGTTCCGAAAAAGAAACGCAAAGttGct
    agCG

Claims (9)

What is claimed is:
1. A DNA targeting system for deleting exon 51 of a dystrophin gene, the system comprising Cas9 and at least one guide RNA (gRNA), wherein the at least one gRNA binds and targets a polynucleotide sequence comprising SEQ ID NO: 67, SEQ ID NO: 70, SEQ ID NO: 100, or SEQ ID NO: 680.
2. An isolated polynucleotide encoding the DNA targeting system of claim 1.
3. A vector comprising the isolated polynucleotide of claim 2.
4. A cell comprising the isolated polynucleotide of claim 2.
5. A method of treating a subject in need thereof having a mutant dystrophin gene, the method comprising administering to the subject the DNA targeting system of claim 1.
6. The method of claim 5, wherein the subject is suffering from Duchenne muscular dystrophy.
7. A method of correcting a mutant dystrophin gene in a cell, the method comprising administering to a cell containing a mutant dystrophin gene the DNA targeting system of claim 1.
8. A composition for genome editing in a muscle of a subject, the composition comprising a modified adeno-associated virus (AAV) vector and a nucleotide sequence encoding the DNA targeting system of claim 1, wherein the muscle is skeletal muscle or cardiac muscle.
9. The composition of claim 8, wherein the modified AAV vector has enhanced cardiac and skeletal muscle tissue tropism.
US16/858,689 2013-06-05 2020-04-26 Rna-guided gene editing and gene regulation Pending US20210002665A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/858,689 US20210002665A1 (en) 2013-06-05 2020-04-26 Rna-guided gene editing and gene regulation

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201361831481P 2013-06-05 2013-06-05
US201361839127P 2013-06-25 2013-06-25
US201361904911P 2013-11-15 2013-11-15
US201461967466P 2014-03-19 2014-03-19
US201461981575P 2014-04-18 2014-04-18
PCT/US2014/041190 WO2014197748A2 (en) 2013-06-05 2014-06-05 Rna-guided gene editing and gene regulation
US201514895316A 2015-12-02 2015-12-02
US16/858,689 US20210002665A1 (en) 2013-06-05 2020-04-26 Rna-guided gene editing and gene regulation

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US14/895,316 Continuation US10704060B2 (en) 2013-06-05 2014-06-05 RNA-guided gene editing and gene regulation
PCT/US2014/041190 Continuation WO2014197748A2 (en) 2013-06-05 2014-06-05 Rna-guided gene editing and gene regulation

Publications (1)

Publication Number Publication Date
US20210002665A1 true US20210002665A1 (en) 2021-01-07

Family

ID=52008753

Family Applications (4)

Application Number Title Priority Date Filing Date
US14/895,316 Active US10704060B2 (en) 2013-06-05 2014-06-05 RNA-guided gene editing and gene regulation
US15/991,333 Active US10745714B2 (en) 2013-06-05 2018-05-29 RNA-guided gene editing and gene regulation
US16/858,689 Pending US20210002665A1 (en) 2013-06-05 2020-04-26 Rna-guided gene editing and gene regulation
US16/927,679 Pending US20210032654A1 (en) 2013-06-05 2020-07-13 Rna-guided gene editing and gene regulation

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US14/895,316 Active US10704060B2 (en) 2013-06-05 2014-06-05 RNA-guided gene editing and gene regulation
US15/991,333 Active US10745714B2 (en) 2013-06-05 2018-05-29 RNA-guided gene editing and gene regulation

Family Applications After (1)

Application Number Title Priority Date Filing Date
US16/927,679 Pending US20210032654A1 (en) 2013-06-05 2020-07-13 Rna-guided gene editing and gene regulation

Country Status (9)

Country Link
US (4) US10704060B2 (en)
EP (5) EP3004370B1 (en)
JP (5) JP7085716B2 (en)
KR (4) KR20230136697A (en)
CN (3) CN114230675B (en)
AU (5) AU2014274840B2 (en)
CA (1) CA2914519A1 (en)
ES (3) ES2991293T3 (en)
WO (1) WO2014197748A2 (en)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190134221A1 (en) * 2016-05-05 2019-05-09 Duke University Crispr/cas-related methods and compositions for treating duchenne muscular dystrophy
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
US11155796B2 (en) 2015-02-09 2021-10-26 Duke University Compositions and methods for epigenome editing
US11421251B2 (en) 2015-10-13 2022-08-23 Duke University Genome engineering with type I CRISPR systems in eukaryotic cells
US11427817B2 (en) 2015-08-25 2022-08-30 Duke University Compositions and methods of improving specificity in genomic engineering using RNA-guided endonucleases
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
WO2024206714A1 (en) * 2023-03-31 2024-10-03 Mammoth Biosciences, Inc. Engineered effector proteins, compositions, systems and methods of use thereof
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use

Families Citing this family (278)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9217155B2 (en) 2008-05-28 2015-12-22 University Of Massachusetts Isolation of novel AAV'S and uses thereof
US8734809B2 (en) 2009-05-28 2014-05-27 University Of Massachusetts AAV's and uses thereof
EP3318635A1 (en) 2011-04-21 2018-05-09 University of Massachusetts Raav-based compositions and methods for treating alpha-1 anti-trypsin deficiencies
CA2853829C (en) 2011-07-22 2023-09-26 President And Fellows Of Harvard College Evaluation and improvement of nuclease cleavage specificity
GB201122458D0 (en) * 2011-12-30 2012-02-08 Univ Wageningen Modified cascade ribonucleoproteins and uses thereof
US9737480B2 (en) 2012-02-06 2017-08-22 President And Fellows Of Harvard College ARRDC1-mediated microvesicles (ARMMs) and uses thereof
KR102596302B1 (en) * 2012-11-01 2023-11-01 팩터 바이오사이언스 인크. Methods and products for expressing proteins in cells
WO2014093701A1 (en) 2012-12-12 2014-06-19 The Broad Institute, Inc. Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof
EP2931892B1 (en) 2012-12-12 2018-09-12 The Broad Institute, Inc. Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
BR112015013784A2 (en) 2012-12-12 2017-07-11 Massachusetts Inst Technology application, manipulation and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
MX373959B (en) * 2013-03-15 2020-07-13 Sarepta Therapeutics Inc Improved compositions for treating muscular dystrophy
KR20230136697A (en) * 2013-06-05 2023-09-26 듀크 유니버시티 Rna-guided gene editing and gene regulation
AU2014281026B2 (en) 2013-06-17 2020-05-28 Massachusetts Institute Of Technology Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation
EP3011030B1 (en) 2013-06-17 2023-11-08 The Broad Institute, Inc. Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation
CA2915795C (en) 2013-06-17 2021-07-13 The Broad Institute, Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components
KR20240172759A (en) 2013-06-17 2024-12-10 더 브로드 인스티튜트, 인코퍼레이티드 Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy
WO2014204727A1 (en) 2013-06-17 2014-12-24 The Broad Institute Inc. Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof
CN105517579B (en) * 2013-07-10 2019-11-15 哈佛大学校长及研究员协会 Orthogonal Cas9 proteins for RNA-guided gene regulation and editing
US20150044192A1 (en) 2013-08-09 2015-02-12 President And Fellows Of Harvard College Methods for identifying a target site of a cas9 nuclease
US9359599B2 (en) 2013-08-22 2016-06-07 President And Fellows Of Harvard College Engineered transcription activator-like effector (TALE) domains and uses thereof
US9228207B2 (en) 2013-09-06 2016-01-05 President And Fellows Of Harvard College Switchable gRNAs comprising aptamers
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
ES3013744T3 (en) 2013-09-18 2025-04-15 Kymab Ltd Methods, cells and organisms
CN106459995B (en) 2013-11-07 2020-02-21 爱迪塔斯医药有限公司 CRISPR-related methods and compositions using dominant gRNAs
WO2015089364A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Crystal structure of a crispr-cas system, and uses thereof
SG10201804973TA (en) 2013-12-12 2018-07-30 Broad Inst Inc Compositions and Methods of Use of Crispr-Cas Systems in Nucleotide Repeat Disorders
KR20160089530A (en) 2013-12-12 2016-07-27 더 브로드 인스티튜트, 인코퍼레이티드 Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders
WO2015089473A1 (en) 2013-12-12 2015-06-18 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation
JP6793547B2 (en) 2013-12-12 2020-12-02 ザ・ブロード・インスティテュート・インコーポレイテッド Optimization Function Systems, methods and compositions for sequence manipulation with the CRISPR-Cas system
US20150165054A1 (en) 2013-12-12 2015-06-18 President And Fellows Of Harvard College Methods for correcting caspase-9 point mutations
IL289736B2 (en) 2013-12-12 2025-09-01 Massachusetts Inst Technology Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing
WO2015127128A2 (en) 2014-02-19 2015-08-27 University Of Massachusetts Recombinant aavs having useful transcytosis properties
WO2015134812A1 (en) 2014-03-05 2015-09-11 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating usher syndrome and retinitis pigmentosa
WO2015138510A1 (en) 2014-03-10 2015-09-17 Editas Medicine., Inc. Crispr/cas-related methods and compositions for treating leber's congenital amaurosis 10 (lca10)
US11141493B2 (en) 2014-03-10 2021-10-12 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
US11339437B2 (en) 2014-03-10 2022-05-24 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
WO2015138739A2 (en) * 2014-03-12 2015-09-17 Precision Biosciences, Inc. Dystrophin gene oxon deletion using engineered nucleases
EP3750907A3 (en) 2014-03-18 2021-04-28 University of Massachusetts Raav-based compositions and methods for treating amyotrophic lateral sclerosis
EP3981876A1 (en) 2014-03-26 2022-04-13 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating sickle cell disease
EP3126495A1 (en) 2014-04-02 2017-02-08 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating primary open angle glaucoma
EP3134522B1 (en) 2014-04-25 2021-10-06 University of Massachusetts Recombinant aav vectors useful for reducing immunity against transgene products
CA2946881A1 (en) 2014-04-28 2015-11-05 Recombinetics, Inc. Multiplex gene editing in swine
EP3177718B1 (en) 2014-07-30 2022-03-16 President and Fellows of Harvard College Cas9 proteins including ligand-dependent inteins
JP6837429B2 (en) * 2014-08-11 2021-03-03 ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム Prevention of muscular dystrophy by editing CRISPR / CAS9-mediated genes
WO2016049024A2 (en) 2014-09-24 2016-03-31 The Broad Institute Inc. Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo
US10711270B2 (en) 2014-10-03 2020-07-14 University Of Massachusetts High efficiency library-identified AAV vectors
US10370432B2 (en) 2014-10-03 2019-08-06 University Of Massachusetts Heterologous targeting peptide grafted AAVS
WO2016057961A1 (en) 2014-10-10 2016-04-14 Editas Medicine, Inc. Compositions and methods for promoting homology directed repair
CA2964272A1 (en) 2014-10-21 2016-04-28 Guangping Gao Recombinant aav variants and uses thereof
GB201418965D0 (en) 2014-10-24 2014-12-10 Ospedale San Raffaele And Fond Telethon
US9816080B2 (en) 2014-10-31 2017-11-14 President And Fellows Of Harvard College Delivery of CAS9 via ARRDC1-mediated microvesicles (ARMMs)
EP3215617B1 (en) 2014-11-07 2024-05-08 Editas Medicine, Inc. Systems for improving crispr/cas-mediated genome-editing
JP6529110B2 (en) * 2014-12-01 2019-06-12 国立大学法人 東京大学 Method for producing a DNA cassette in which a plurality of units are multiply linked and a vector comprising the cassette
US20170266320A1 (en) 2014-12-01 2017-09-21 President And Fellows Of Harvard College RNA-Guided Systems for In Vivo Gene Editing
WO2016094867A1 (en) 2014-12-12 2016-06-16 The Broad Institute Inc. Protected guide rnas (pgrnas)
EP3237615B2 (en) 2014-12-24 2023-07-26 The Broad Institute, Inc. Crispr having or associated with destabilization domains
WO2016104716A1 (en) 2014-12-26 2016-06-30 国立研究開発法人理化学研究所 Gene knockout method
CA2972454A1 (en) * 2014-12-31 2016-07-07 Synthetic Genomics, Inc. Compositions and methods for high efficiency in vivo genome editing
EP3256170B1 (en) 2015-02-13 2020-09-23 University of Massachusetts Compositions and methods for transient delivery of nucleases
CA2977455A1 (en) 2015-02-23 2019-09-01 Crispr Therapeutics Ag Materials and methods for treatment of hemoglobinopathies
US12129471B2 (en) 2015-02-23 2024-10-29 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of human genetic diseases including hemoglobinopathies
EP3064587B1 (en) 2015-03-06 2019-08-14 Leibniz-Institut für Pflanzenbiochemie (IPB) Library of synthetic promoters for coordinated gene expression in eukaryotic cells or organisms
HK1244838A1 (en) * 2015-04-01 2018-08-17 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating duchenne muscular dystrophy and becker muscular dystrophy
GB201506509D0 (en) 2015-04-16 2015-06-03 Univ Wageningen Nuclease-mediated genome editing
US11674144B2 (en) * 2015-04-16 2023-06-13 California Institute Of Technology Fractional regulation of transcription
EP3286571B1 (en) 2015-04-24 2021-08-18 Editas Medicine, Inc. Evaluation of cas9 molecule/guide rna molecule complexes
US11046955B2 (en) 2015-04-24 2021-06-29 University Of Massachusetts Modified AAV constructs and uses thereof
WO2016182959A1 (en) 2015-05-11 2016-11-17 Editas Medicine, Inc. Optimized crispr/cas9 systems and methods for gene editing in stem cells
WO2016201047A1 (en) 2015-06-09 2016-12-15 Editas Medicine, Inc. Crispr/cas-related methods and compositions for improving transplantation
EP3800255A3 (en) * 2015-06-18 2021-06-23 Robert D. Bowles Rna-guided transcriptional regulation and methods of using the same for the treatment of back pain
AU2016280893B2 (en) 2015-06-18 2021-12-02 Massachusetts Institute Of Technology CRISPR enzyme mutations reducing off-target effects
WO2016205759A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation
US10648020B2 (en) 2015-06-18 2020-05-12 The Broad Institute, Inc. CRISPR enzymes and systems
US9790490B2 (en) * 2015-06-18 2017-10-17 The Broad Institute Inc. CRISPR enzymes and systems
CN105255886B (en) * 2015-07-09 2018-09-14 青岛市畜牧兽医研究所 The sgRNA of a pair of targeting pig RelA genes
ES3009026T3 (en) * 2015-07-22 2025-03-25 Univ Duke High-throughput screening of regulatory element function with epigenome editing technologies
US11661583B2 (en) 2015-08-27 2023-05-30 University Of Washington Drug discovery platform for Duchenne cardiomyopathy
JP6937513B2 (en) * 2015-09-11 2021-09-22 国立研究開発法人理化学研究所 Transcription factor binding site-specific DNA demethylation method
WO2017049407A1 (en) * 2015-09-23 2017-03-30 UNIVERSITé LAVAL Modification of the dystrophin gene and uses thereof
CA2999500A1 (en) 2015-09-24 2017-03-30 Editas Medicine, Inc. Use of exonucleases to improve crispr/cas-mediated genome editing
WO2017053729A1 (en) 2015-09-25 2017-03-30 The Board Of Trustees Of The Leland Stanford Junior University Nuclease-mediated genome editing of primary cells and enrichment thereof
AU2016335698B2 (en) 2015-10-08 2022-12-01 President And Fellows Of Harvard College Multiplexed genome editing
WO2017070525A1 (en) 2015-10-22 2017-04-27 University Of Massachusetts Methods and compositions for treating metabolic imbalance in neurodegenerative disease
US11426469B2 (en) 2015-10-22 2022-08-30 University Of Massachusetts Prostate-targeting adeno-associated virus serotype vectors
WO2017070633A2 (en) 2015-10-23 2017-04-27 President And Fellows Of Harvard College Evolved cas9 proteins for gene editing
EP3368054A4 (en) 2015-10-28 2019-07-03 Voyager Therapeutics, Inc. REGULATORY EXPRESSION USING AN ADENO-ASSOCIATED VIRUS (AAV)
CA3000931A1 (en) * 2015-10-28 2017-05-04 Crispr Therapeutics Ag Materials and methods for treatment of duchenne muscular dystrophy
ES2942309T3 (en) 2015-11-04 2023-05-31 Vertex Pharma Materials and methods for the treatment of hemoglobinopathies
WO2017095967A2 (en) * 2015-11-30 2017-06-08 Duke University Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
US12110490B2 (en) 2015-12-18 2024-10-08 The Broad Institute, Inc. CRISPR enzymes and systems
WO2017123556A1 (en) 2016-01-11 2017-07-20 The Board Of Trustees Of The Leland Stanford Junior University Chimeric proteins and methods of immunotherapy
NZ743983A (en) 2016-01-11 2025-08-29 Univ Leland Stanford Junior Chimeric proteins and methods of regulating gene expression
US12049625B2 (en) 2016-01-14 2024-07-30 The Brigham And Women's Hospital, Inc. Genome editing for treating glioblastoma
WO2017136536A1 (en) 2016-02-02 2017-08-10 University Of Massachusetts Method to enhance the efficiency of systemic aav gene delivery to the central nervous system
JP6998313B2 (en) * 2016-02-11 2022-02-04 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア Methods and Compositions for Modifying Mutant Dystrophin Genes in Cellular Genome
EP4094780A3 (en) 2016-02-12 2023-02-08 University of Massachusetts Anti-angiogenic mirna therapeutics for inhibiting corneal neovascularization
US20200255857A1 (en) * 2016-03-14 2020-08-13 Editas Medicine, Inc. Crispr/cas-related methods and compositions for treating beta hemoglobinopathies
EP3219799A1 (en) 2016-03-17 2017-09-20 IMBA-Institut für Molekulare Biotechnologie GmbH Conditional crispr sgrna expression
EP3433364A1 (en) 2016-03-25 2019-01-30 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (a1at) deficiency
US11597924B2 (en) 2016-03-25 2023-03-07 Editas Medicine, Inc. Genome editing systems comprising repair-modulating enzyme molecules and methods of their use
CN117731805A (en) * 2016-03-30 2024-03-22 因特利亚治疗公司 Lipid nanoparticle formulations for CRISPR/CAS components
MA45328A (en) 2016-04-01 2019-02-06 Avidity Biosciences Llc NUCLEIC ACID-POLYPEPTIDE COMPOSITIONS AND USES THEREOF
US11207426B2 (en) 2016-04-05 2021-12-28 University Of Massachusetts Compositions and methods for selective inhibition of grainyhead-like protein expression
US11236313B2 (en) 2016-04-13 2022-02-01 Editas Medicine, Inc. Cas9 fusion molecules, gene editing systems, and methods of use thereof
US11413356B2 (en) 2016-04-15 2022-08-16 University Of Massachusetts Methods and compositions for treating metabolic imbalance
CA3026112A1 (en) 2016-04-19 2017-10-26 The Broad Institute, Inc. Cpf1 complexes with reduced indel activity
KR20240091006A (en) 2016-04-19 2024-06-21 더 브로드 인스티튜트, 인코퍼레이티드 The novel CRISPR enzyme and system
DK3272867T3 (en) * 2016-06-02 2019-12-02 Sigma Aldrich Co Llc USE OF PROGRAMMABLE DNA BINDING PROTEINS FOR IMPROVING TARGETED RE-MODIFICATION
US11882815B2 (en) 2016-06-15 2024-01-30 University Of Massachusetts Recombinant adeno-associated viruses for delivering gene editing molecules to embryonic cells
CN106119269B (en) * 2016-06-23 2019-12-06 百奥迈科生物技术有限公司 Method for preparing linear single-stranded DNA in escherichia coli
EA201990213A1 (en) 2016-07-05 2019-11-29 COMPOSITIONS AND METHODS INCLUDING IMPROVEMENT OF CRISPR GUIDE RNA USING THE H1 PROMOTION
US11566263B2 (en) 2016-08-02 2023-01-31 Editas Medicine, Inc. Compositions and methods for treating CEP290 associated disease
WO2018027078A1 (en) 2016-08-03 2018-02-08 President And Fellows Of Harard College Adenosine nucleobase editors and uses thereof
JP7201153B2 (en) 2016-08-09 2023-01-10 プレジデント アンド フェローズ オブ ハーバード カレッジ Programmable CAS9-recombinase fusion protein and uses thereof
EP3497221A4 (en) * 2016-08-10 2020-02-05 Duke University COMPOSITIONS, SYSTEMS AND METHODS FOR PROGRAMMING THE IMMUNCELL FUNCTION BY TARGETED GENERAL REGULATION
CN109996880A (en) * 2016-08-18 2019-07-09 加利福尼亚大学董事会 CRISPR-CAS genome project based on modularization AAV delivery system
KR102145092B1 (en) * 2016-08-19 2020-08-14 주식회사 툴젠 Engineered Neovascularization-controling system
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
US10457940B2 (en) 2016-09-22 2019-10-29 University Of Massachusetts AAV treatment of Huntington's disease
CN107880132B (en) * 2016-09-30 2022-06-17 北京大学 A kind of fusion protein and the method for using the same for homologous recombination
US11730823B2 (en) 2016-10-03 2023-08-22 President And Fellows Of Harvard College Delivery of therapeutic RNAs via ARRDC1-mediated microvesicles
US11578340B2 (en) 2016-10-13 2023-02-14 University Of Massachusetts AAV capsid designs
EP3526320A1 (en) 2016-10-14 2019-08-21 President and Fellows of Harvard College Aav delivery of nucleobase editors
CN106318947A (en) * 2016-10-17 2017-01-11 北京大北农科技集团股份有限公司 Genome editing system and application thereof
FR3058160A1 (en) * 2016-10-28 2018-05-04 Universite Pierre Et Marie Curie - Paris 6 (Upmc) METHOD FOR DIFFERENTIATING PLURIPOTENT STEM CELLS IN CARDIOMYOCYTES
WO2018081978A1 (en) * 2016-11-03 2018-05-11 深圳华大基因研究院 Method and system for improving gene editing efficiency
AU2017364106A1 (en) * 2016-11-28 2019-06-20 The Board Of Regents Of The University Of Texas System Prevention of muscular dystrophy by CRISPR/Cpfl-mediated gene editing
WO2018102665A1 (en) 2016-12-01 2018-06-07 Sangamo Therapeutics, Inc. Tau modulators and methods and compositions for delivery thereof
WO2018110471A1 (en) 2016-12-12 2018-06-21 アステラス製薬株式会社 Transcription-regulating fusion polypeptide
US12286727B2 (en) 2016-12-19 2025-04-29 Editas Medicine, Inc. Assessing nuclease cleavage
WO2018119359A1 (en) 2016-12-23 2018-06-28 President And Fellows Of Harvard College Editing of ccr5 receptor gene to protect against hiv infection
JOP20190166A1 (en) * 2017-01-05 2019-07-02 Univ Texas Optimized strategy for exon skipping modifications using crispr/cas9 with triple guide sequences
US20220283144A1 (en) * 2017-01-06 2022-09-08 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods identifying and using stem cell differentiation markers
US12110545B2 (en) 2017-01-06 2024-10-08 Editas Medicine, Inc. Methods of assessing nuclease cleavage
KR20190104381A (en) 2017-01-06 2019-09-09 어비디티 바이오사이언시스 엘엘씨 Nucleic Acid-Polypeptide Compositions and Methods of Inducing Exon Skipping
TW201839136A (en) 2017-02-06 2018-11-01 瑞士商諾華公司 Composition and method for treating hemochromatosis
WO2018147343A1 (en) * 2017-02-07 2018-08-16 Edigene Corporation Method of treating diseases associated with elevated kras expression using crispr-gndm system
WO2018148511A1 (en) 2017-02-10 2018-08-16 Zymergen Inc. A modular universal plasmid design strategy for the assembly and editing of multiple dna constructs for multiple hosts
US20190380314A1 (en) * 2017-02-23 2019-12-19 President And Fellows Of Harvard College Methods of Genetic Modification of a Cell
WO2018160695A1 (en) * 2017-02-28 2018-09-07 Trustees Of Boston University Opto-genetic modulator
US10687520B2 (en) 2017-03-07 2020-06-23 The Board Of Regents Of The University Of Texas System Generation and correction of a humanized mouse model with a deletion of dystrophin exon 44
EP3592853A1 (en) 2017-03-09 2020-01-15 President and Fellows of Harvard College Suppression of pain by gene editing
KR20190123328A (en) 2017-03-09 2019-10-31 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 Cancer vaccine
JP2020510439A (en) 2017-03-10 2020-04-09 プレジデント アンド フェローズ オブ ハーバード カレッジ Base-editing factor from cytosine to guanine
US11674138B2 (en) 2017-03-13 2023-06-13 President And Fellows Of Harvard College Methods of modulating expression of target nucleic acid sequences in a cell
EP3596217A1 (en) 2017-03-14 2020-01-22 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
WO2018170464A1 (en) 2017-03-17 2018-09-20 The Johns Hopkins University Targeted epigenetic therapy against distal regulatory element of tgfb2 expression
KR102687373B1 (en) 2017-03-23 2024-07-23 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 Nucleobase editing agent comprising a nucleic acid programmable DNA binding protein
CN107012158B (en) * 2017-03-28 2020-09-11 东南大学 A kind of telomerase initiating gene expression method and its application
KR102758434B1 (en) * 2017-03-30 2025-01-21 고쿠리츠 다이가쿠 호진 교토 다이가쿠 Method for inducing exon skipping by genome editing
CN107058358B (en) * 2017-04-01 2020-06-09 中国科学院微生物研究所 Construction of a double-spacer sequence-recognized cleavage CRISPR-Cas9 vector and its application in Verrucobacterium
EP3385373A1 (en) 2017-04-05 2018-10-10 Centro de Neurociências e Biologia Celular Compositions for reprogramming cells into dendritic cells or antigen presenting cells, methods and uses thereof
CN110088272B (en) 2017-04-05 2023-08-04 阿斯加德治疗有限公司 Compositions for reprogramming cells to dendritic cells or antigen presenting cells, methods and uses thereof
SG11201909797QA (en) 2017-04-20 2019-11-28 Egenesis Inc Methods for generating genetically modified animals
EP3615672A1 (en) 2017-04-28 2020-03-04 Editas Medicine, Inc. Methods and systems for analyzing guide rna molecules
JP7327803B2 (en) 2017-05-09 2023-08-16 ユニバーシティ オブ マサチューセッツ Method of treating amyotrophic lateral sclerosis (ALS)
EP3622070A2 (en) 2017-05-10 2020-03-18 Editas Medicine, Inc. Crispr/rna-guided nuclease systems and methods
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
EP3635120A1 (en) * 2017-06-02 2020-04-15 Institut National de la Santé et de la Recherche Médicale (INSERM) Recombinant lentiviral vector for stem cell-based gene therapy of sickle cell disorder
EP3635104A1 (en) 2017-06-09 2020-04-15 Editas Medicine, Inc. Engineered cas9 nucleases
WO2018232323A1 (en) 2017-06-16 2018-12-20 Avery Therapeutics, Inc. Three dimensional tissue compositions and methods of use
US20200140896A1 (en) * 2017-06-30 2020-05-07 Novartis Ag Methods for the treatment of disease with gene editing systems
EP3652312A1 (en) 2017-07-14 2020-05-20 Editas Medicine, Inc. Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites
EP3655961A4 (en) * 2017-07-17 2021-09-01 Massachusetts Institute of Technology CELL ATLAS OF HEALTHY AND DISEASED BARRIER TISSUE
GB201711809D0 (en) 2017-07-21 2017-09-06 Governors Of The Univ Of Alberta Antisense oligonucleotide
EP3658573A1 (en) 2017-07-28 2020-06-03 President and Fellows of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (pace)
CN107488649A (en) * 2017-08-25 2017-12-19 南方医科大学 A kind of fusion protein of Cpf1 and p300 Core domains, corresponding DNA target are to activation system and application
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
US20200340058A1 (en) * 2017-09-14 2020-10-29 The Children's Medical Center Corporation Compositions and methods for enhancing cell transplantation efficacy
CN107513531B (en) * 2017-09-21 2020-02-21 无锡市妇幼保健院 gRNA target sequence for endogenously over-expressing lncRNA-XIST and application thereof
CA3075643A1 (en) 2017-09-22 2019-03-28 University Of Massachusetts Sod1 dual expression vectors and uses thereof
CN107722125B (en) * 2017-09-28 2021-05-07 中山大学 Artificial transcription activator dCas9-TV and coding gene and application thereof
US11572574B2 (en) 2017-09-28 2023-02-07 Toolgen Incorporated Artificial genome manipulation for gene expression regulation
EP3697906A1 (en) 2017-10-16 2020-08-26 The Broad Institute, Inc. Uses of adenosine base editors
WO2019089623A1 (en) * 2017-10-30 2019-05-09 Children's Hospital Medical Center Fusion proteins for use in improving gene correction via homologous recombination
CN117487776A (en) * 2017-11-01 2024-02-02 加利福尼亚大学董事会 CASZ compositions and methods of use
US20200354419A1 (en) * 2017-11-03 2020-11-12 Hunterian Medicine Llc Compositions and methods of use thereof for the treatment of duchenne muscular dystrophy
KR102132198B1 (en) * 2017-12-14 2020-07-09 단국대학교 산학협력단 CRISPR system specific for TERT promoter mutation and use thereof
US12406749B2 (en) 2017-12-15 2025-09-02 The Broad Institute, Inc. Systems and methods for predicting repair outcomes in genetic engineering
US12031130B2 (en) 2017-12-28 2024-07-09 Takeda Pharmaceutical Company Limited Composition for modifying target gene
PT3733641T (en) 2017-12-28 2024-05-07 Takeda Pharmaceuticals Co Cationic lipids
CN108559731A (en) * 2018-01-15 2018-09-21 南方医科大学 A kind of human embryonic stem cell line of tetracycline-regulated gene expression and its application
EP3749768A1 (en) 2018-02-05 2020-12-16 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US10767193B2 (en) * 2018-02-15 2020-09-08 Sigma-Aldrich Co. Llc Engineered CAS9 systems for eukaryotic genome modification
CN110229814B (en) * 2018-03-06 2025-11-14 中国科学院动物研究所 Improved guide RNA
MX2020009487A (en) 2018-03-14 2020-12-10 Editas Medicine Inc Systems and methods for the treatment of hemoglobinopathies.
BR112020021229A2 (en) 2018-04-19 2021-02-02 The Regents Of The University Of California compositions and methods for editing genes
CN112166194A (en) * 2018-04-23 2021-01-01 杜克大学 Downregulation of SNCA expression by targeted editing of DNA methylation
WO2019209777A1 (en) 2018-04-23 2019-10-31 The Curators Of The University Of Missouri Improved crispr therapy
WO2019210279A1 (en) * 2018-04-27 2019-10-31 The Regents Of The University Of California De novo formation of the biliary system by hepatocyte transdifferentiation
KR20250134703A (en) 2018-05-11 2025-09-11 빔 테라퓨틱스, 인크. Methods of substituting pathogenic amino acids using programmable base editor systems
GB2589246A (en) 2018-05-16 2021-05-26 Synthego Corp Methods and systems for guide RNA design and use
EP3797160A1 (en) 2018-05-23 2021-03-31 The Broad Institute Inc. Base editors and uses thereof
AU2019291918B2 (en) 2018-06-29 2025-06-12 Editas Medicine, Inc. Synthetic guide molecules, compositions and methods relating thereto
WO2020010249A1 (en) * 2018-07-06 2020-01-09 The Regents Of The University Of California Novel method to engineer translantable human tissues
CN109055375B (en) * 2018-07-26 2021-11-12 东南大学 Method for activating gene expression by CRISPR (clustered regularly interspaced short palindromic repeats) auxiliary trans-enhancer and application of method
CN110760511B (en) * 2018-07-27 2021-09-07 广东赤萌医疗科技有限公司 gRNA, expression vector and CRISPR-Cas9 system for treating duchenne muscular dystrophy
US11168141B2 (en) 2018-08-02 2021-11-09 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for treating dystrophinopathies
US12018087B2 (en) 2018-08-02 2024-06-25 Dyne Therapeutics, Inc. Muscle-targeting complexes comprising an anti-transferrin receptor antibody linked to an oligonucleotide and methods of delivering oligonucleotide to a subject
EP3830259A4 (en) 2018-08-02 2022-05-04 Dyne Therapeutics, Inc. MUSCLE TARGETING COMPLEXES AND THEIR USES FOR THE TREATMENT OF FACIOSCAPULOHUMERAL MUSCULAR DYSTROPHY
US20210308273A1 (en) 2018-08-02 2021-10-07 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for treating dystrophinopathies
GB201813011D0 (en) 2018-08-10 2018-09-26 Vib Vzw Means and methods for drought tolerance in crops
JP2021533773A (en) * 2018-08-15 2021-12-09 ザイマージェン インコーポレイテッド Application of CRISPRi in high-throughput metabolic operations
EP3836974A4 (en) * 2018-08-18 2022-06-15 President and Fellows of Harvard College IN SITU GENE EDITING
WO2020051562A2 (en) 2018-09-07 2020-03-12 Beam Therapeutics Inc. Compositions and methods for improving base editing
US20210395774A1 (en) * 2018-09-25 2021-12-23 Microbial Chemistry Research Foundation Novel virus vector and methods for producing and using same
JP7762563B2 (en) 2018-10-02 2025-10-30 サンガモ セラピューティクス, インコーポレイテッド Methods and compositions for modulation of tau protein
AU2019359276A1 (en) * 2018-10-09 2021-04-29 The University Of North Carolina At Chapel Hill Regulated gene editing system
US20210386827A1 (en) * 2018-10-15 2021-12-16 Avery Therapeutics, Inc. Cell-free compositions and methods for restoration or enhancement of tissue function
US12410428B2 (en) 2018-10-18 2025-09-09 University Of Utah Research Foundation RNA-guided transcriptional regulation and methods of using the same for the treatment of back pain
WO2020092453A1 (en) 2018-10-29 2020-05-07 The Broad Institute, Inc. Nucleobase editors comprising geocas9 and uses thereof
WO2020092725A1 (en) * 2018-11-01 2020-05-07 Montana State University Gene modulation with crispr system type i
EP3877748A4 (en) * 2018-11-06 2022-11-09 Cellino Biotech, Inc. SYSTEMS FOR CELL CONTROL
KR20210093954A (en) * 2018-11-16 2021-07-28 아스텔라스세이야쿠 가부시키가이샤 A method for treating muscular dystrophy by targeting the eutrophin gene
WO2020154500A1 (en) 2019-01-23 2020-07-30 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
WO2020159880A1 (en) * 2019-01-28 2020-08-06 The Administrators Of The Tulane Educational Fund Crispr-based methods and novel compositions for treating vascular disorders
WO2020168133A1 (en) 2019-02-13 2020-08-20 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
CN109929865B (en) * 2019-03-11 2022-03-08 东南大学 CRISPR (clustered regularly interspaced short palindromic repeats) assisted trans-enhancer activated gene expression method based on GAL4-UAS (anaerobic-anoxic-oxic system) system and application thereof
SG11202109882VA (en) 2019-03-19 2021-10-28 Broad Inst Inc Methods and compositions for editing nucleotide sequences
WO2020209800A2 (en) * 2019-04-11 2020-10-15 Agency For Science, Technology And Research A method of altering a differentiation status of a cell
US20220177879A1 (en) * 2019-04-12 2022-06-09 Duke University Crispr/cas-based base editing composition for restoring dystrophin function
WO2020210214A1 (en) * 2019-04-12 2020-10-15 The Regents Of The University Of California Compositions and methods for modifying dystrophin genes
JP2022529424A (en) * 2019-04-14 2022-06-22 デューク ユニバーシティ CRISPR / Cas-based genome editing composition for repairing dystrophin function
TWI887234B (en) * 2019-04-14 2025-06-21 美國公爵大學 Aav vector-mediated deletion of large mutational hotspot for treatment of duchenne muscular dystrophy
EP3956349A1 (en) 2019-04-17 2022-02-23 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
CN114144231B (en) * 2019-05-15 2024-05-24 得克萨斯系统大学评议会 CRISPR method for treating cancer
EP3973532A4 (en) * 2019-05-23 2022-08-31 American Molecular Laboratories, Inc. Methods for detecting a level of h. pylori in a fecal sample
CN112266418A (en) * 2019-07-08 2021-01-26 中国科学院微生物研究所 Improved genome editing system and application thereof
JP7708737B2 (en) 2019-07-18 2025-07-15 ユニバーシティー オブ ロチェスター Cell-type selective immune protection of cells
EP4028516A1 (en) * 2019-09-13 2022-07-20 The Regents of The University of Colorado, A Body Corporate Methods and compositions for cell and tissue rejuvenation
JP2022548911A (en) * 2019-09-23 2022-11-22 ビゲネロン ゲゼルシャフト ミット ベシュレンクテル ハフツング Method for Transcriptional Activation of Homologous Gene of Target Gene and In Vitro Diagnostic Method
US12435330B2 (en) 2019-10-10 2025-10-07 The Broad Institute, Inc. Methods and compositions for prime editing RNA
KR20220083700A (en) * 2019-10-18 2022-06-20 에피제네론, 인크. A method for detecting a target nucleic acid, a method for detecting a nucleic acid-binding molecule, and a method for evaluating a nucleic acid binding ability
CA3155381A1 (en) 2019-11-06 2021-05-14 Association Institut De Myologie Combined therapy for muscular diseases
US20230032846A1 (en) * 2019-12-03 2023-02-02 Duke University Systems and methods for lipid nanoparticle delivery of gene editing machinery
WO2021127057A1 (en) * 2019-12-16 2021-06-24 President And Fellows Of Harvard College Methods and compositions for correction of dmd mutations
EP4125349A4 (en) * 2020-04-27 2024-07-10 Duke University Gene editing of satellite cells in vivo using aav vectors encoding muscle-specific promoters
JP2023515710A (en) * 2020-04-27 2023-04-13 デューク ユニバーシティ A High-Throughput Screening Method to Find Optimal gRNA Pairs for CRISPR-Mediated Exon Deletion
KR20230019843A (en) 2020-05-08 2023-02-09 더 브로드 인스티튜트, 인코퍼레이티드 Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
US20230175015A1 (en) * 2020-05-12 2023-06-08 Myogene Bio Llc Immunosuppressive agents and viral delivery re-dosing methods for gene therapy
WO2022008557A2 (en) 2020-07-08 2022-01-13 UCB Biopharma SRL Modulation of cftr expression
WO2022020806A2 (en) * 2020-07-24 2022-01-27 The Trustees Of The University Of Pennsylvania Utrophin genome editing for treating duchenne muscular dystrophy (dmd)
CN115011598A (en) * 2020-09-02 2022-09-06 西湖大学 Duchenne muscular dystrophy-related exon splicing enhancers, sgRNAs, gene editing tools and their applications
AU2021345112A1 (en) 2020-09-15 2023-04-27 Research Institute At Nationwide Children's Hospital Aav-mediated homology-independent targeted integration gene editing for correction of diverse dmd mutations in patients with muscular dystrophy
KR20230090331A (en) * 2020-10-15 2023-06-21 노스이스턴 유니버시티 Engineered Cells for Increased Collagen Production
US20230392132A1 (en) * 2020-10-21 2023-12-07 Duke University Dual aav vector-mediated deletion of large mutational hotspot for treatment of duchenne muscular dystrophy
CN112662674B (en) * 2021-01-12 2023-04-11 广州瑞风生物科技有限公司 gRNA for targeted editing of VEGFA gene exon region and application thereof
CN114854791A (en) * 2021-02-04 2022-08-05 北京中因科技有限公司 Novel CRISPR-Cas9 system vector and application thereof
EP4288541A1 (en) 2021-02-05 2023-12-13 Christiana Care Gene Editing Institute, Inc. Methods of and compositions for reducing gene expression and/or activity
CN112779259B (en) * 2021-03-18 2023-05-26 新疆畜牧科学院生物技术研究所(新疆畜牧科学院中国-澳大利亚绵羊育种研究中心) sgRNA for precisely editing sheep OCT4 gene, primer for amplification and application
US11638761B2 (en) 2021-07-09 2023-05-02 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for treating Facioscapulohumeral muscular dystrophy
US11771776B2 (en) 2021-07-09 2023-10-03 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for treating dystrophinopathies
MX2024000489A (en) 2021-07-09 2024-04-09 Dyne Therapeutics Inc Muscle targeting complexes and formulations for treating dystrophinopathies.
US11969475B2 (en) 2021-07-09 2024-04-30 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for treating facioscapulohumeral muscular dystrophy
US20240254483A1 (en) 2021-07-30 2024-08-01 Tune Therapeutics, Inc. Compositions and methods for modulating expression of frataxin (fxn)
EP4377460A1 (en) 2021-07-30 2024-06-05 Tune Therapeutics, Inc. Compositions and methods for modulating expression of methyl-cpg binding protein 2 (mecp2)
CN113637658A (en) * 2021-08-19 2021-11-12 中国农业科学院棉花研究所 dCas 9-oToV-based gene transcription system and application thereof
WO2023039346A1 (en) * 2021-09-10 2023-03-16 The Regents Of The University Of California Temperature regulated crispr-cas systems and methods of use thereof
WO2023050158A1 (en) * 2021-09-29 2023-04-06 深圳先进技术研究院 Method for achieving multi-base editing
US20250134999A1 (en) 2022-01-14 2025-05-01 Tune Therapeutics, Inc. Compositions, systems, and methods for programming t cell phenotypes through targeted gene activation
WO2023137472A2 (en) 2022-01-14 2023-07-20 Tune Therapeutics, Inc. Compositions, systems, and methods for programming t cell phenotypes through targeted gene repression
EP4215614A1 (en) 2022-01-24 2023-07-26 Dynacure Combination therapy for dystrophin-related diseases
WO2023212594A2 (en) * 2022-04-26 2023-11-02 University Of Massachusetts SINGLE pegRNA-MEDIATED LARGE INSERTIONS
CN114941032B (en) * 2022-06-13 2025-05-06 大连医科大学 Application of RNF122 in the preparation of anti-tumor drugs
JP2025520677A (en) 2022-06-24 2025-07-03 ヨーロピアン モレキュラー バイオロジー ラボラトリー CRISPR-based modular tools for specific introduction of epigenetic modifications at target loci
WO2024015881A2 (en) 2022-07-12 2024-01-18 Tune Therapeutics, Inc. Compositions, systems, and methods for targeted transcriptional activation
EP4573200A2 (en) 2022-08-19 2025-06-25 Tune Therapeutics, Inc. Compositions, systems, and methods for regulation of hepatitis b virus through targeted gene repression
EP4590821A2 (en) 2022-09-19 2025-07-30 Tune Therapeutics, Inc. Compositions, systems, and methods for modulating t cell function
WO2024081937A2 (en) * 2022-10-13 2024-04-18 Duke University Cas12a fusion proteins and methods of using same
WO2024163683A2 (en) 2023-02-01 2024-08-08 Tune Therapeutics, Inc. Systems, compositions, and methods for modulating expression of methyl-cpg binding protein 2 (mecp2) and x-inactive specific transcript (xist)
WO2024163678A2 (en) 2023-02-01 2024-08-08 Tune Therapeutics, Inc. Fusion proteins and systems for targeted activation of frataxin (fxn) and related methods
WO2024168301A2 (en) * 2023-02-10 2024-08-15 Function Oncology, Inc. Personalized crispr profiling for cancer
WO2025029840A1 (en) 2023-07-31 2025-02-06 Tune Therapeutics, Inc. Compositions and methods for multiplexed activation and repression of t cell gene expression
WO2025029835A1 (en) 2023-07-31 2025-02-06 Tune Therapeutics, Inc. Compositions and methods for modulating il-2 gene expression
WO2025038494A1 (en) 2023-08-11 2025-02-20 Tune Therapeutics, Inc. Compositions, systems, and methods for lymphoid cell differentiation using targeted gene activation
WO2025059073A1 (en) 2023-09-11 2025-03-20 Tune Therapeutics, Inc. Epigenetic editing methods and systems for differentiating stem cells
CN118291415B (en) * 2024-03-14 2024-11-19 内蒙古大学 CRISPR (chemical reaction plasma enhanced surface plasmon resonance) Cr-P300M crotonylation acylation modification editing tool and application thereof

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140179006A1 (en) * 2012-12-12 2014-06-26 Massachusetts Institute Of Technology Crispr-cas component systems, methods and compositions for sequence manipulation

Family Cites Families (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9206016D0 (en) * 1992-03-19 1992-04-29 Sandoz Ltd Improvements in or relating to organic compounds
WO1993025673A1 (en) 1992-06-04 1993-12-23 The Regents Of The University Of California In vivo gene therapy with intron-free sequence of interest
US5593972A (en) 1993-01-26 1997-01-14 The Wistar Institute Genetic immunization
CA2153593C (en) 1993-01-26 2010-04-13 David B. Weiner Compositions and methods for delivery of genetic material
US5962428A (en) 1995-03-30 1999-10-05 Apollon, Inc. Compositions and methods for delivery of genetic material
AU2001253812A1 (en) 2000-04-28 2001-11-12 Genzyme Corporation In vivo loading of mhc
AU2003295366B2 (en) 2002-11-04 2011-11-24 Advisys, Inc. Synthetic muscle promoters with activities exceeding naturally occurring regulatory sequences in cardiac cells
EP1563069B1 (en) * 2002-11-22 2012-06-06 Institut Clayton De La Recherche Compositions and systems for the regulation of genes
WO2005014815A1 (en) 2003-08-08 2005-02-17 President And Fellows Of Harvard College siRNA BASED METHODS FOR TREATING ALZHEIMER’S DISEASE
EP2500430B1 (en) * 2004-06-28 2017-03-08 The University Of Western Australia Antisense oligonucleotides for inducing exon skipping and methods of use thereof
JP2009542228A (en) 2006-07-05 2009-12-03 ザ スクリプス リサーチ インスティテュート Chimeric zinc finger recombinase optimized for catalysis by directed evolution
EP2203173B1 (en) * 2007-10-26 2015-12-23 Academisch Ziekenhuis Leiden Means and methods for counteracting muscle disorders
CN103725717A (en) 2008-10-17 2014-04-16 焦耳无限科技公司 Method of producing Microbiological ethyl alcohol
EP2206723A1 (en) 2009-01-12 2010-07-14 Bonas, Ulla Modular DNA-binding domains
WO2011036640A2 (en) 2009-09-24 2011-03-31 Cellectis Meganuclease reagents of uses thereof for treating genetic diseases caused by frame shift/non sense mutations
UA109418C2 (en) * 2009-10-22 2015-08-25 Zinc Finger Protein Designed for Plant Genes Involved in Fatty Acid Biosynthesis
EP2533629B1 (en) 2010-02-11 2018-11-28 Recombinetics, Inc. Methods and materials for producing transgenic artiodactyls
EP2569424A1 (en) * 2010-05-12 2013-03-20 Cellectis Meganuclease variants cleaving a dna target sequence from the dystrophin gene and uses thereof
EP2571512B1 (en) * 2010-05-17 2017-08-23 Sangamo BioSciences, Inc. Novel dna-binding proteins and uses thereof
IT1400425B1 (en) 2010-06-08 2013-05-31 Amsterdam Molecular Therapeutics Bv MODIFIED SNRNAS FOR USE IN THERAPY.
CN102643852B (en) * 2011-02-28 2015-04-08 华东理工大学 Optical controllable gene expression system
US9540623B2 (en) 2011-07-08 2017-01-10 Cellectis Method for increasing the efficiency of double-strand-break induced mutagenesis
CN112251436A (en) * 2012-01-27 2021-01-22 比奥马林技术公司 RNA-regulated oligonucleotides with improved properties for the treatment of duchenne muscular dystrophy and becker muscular dystrophy
EP2834357B1 (en) 2012-04-04 2017-12-27 Life Technologies Corporation Tal-effector assembly platform, customized services, kits and assays
EP3597741A1 (en) 2012-04-27 2020-01-22 Duke University Genetic correction of mutated genes
US9738879B2 (en) 2012-04-27 2017-08-22 Duke University Genetic correction of mutated genes
PE20190844A1 (en) * 2012-05-25 2019-06-17 Emmanuelle Charpentier MODULATION OF TRANSCRIPTION WITH ADDRESSING RNA TO GENERIC DNA
US9890364B2 (en) 2012-05-29 2018-02-13 The General Hospital Corporation TAL-Tet1 fusion proteins and methods of use thereof
US8884771B2 (en) * 2012-08-01 2014-11-11 Microchip Technology Incorporated Smoke detection using change in permittivity of capacitor air dielectric
IN2015DN01480A (en) * 2012-08-29 2015-07-03 Sangamo Biosciences Inc
KR102596302B1 (en) * 2012-11-01 2023-11-01 팩터 바이오사이언스 인크. Methods and products for expressing proteins in cells
WO2014081855A1 (en) 2012-11-20 2014-05-30 Universite De Montreal Methods and compositions for muscular dystrophies
CA3034794A1 (en) * 2012-12-06 2014-06-12 Sigma-Aldrich Co. Llc Crispr-based genome modification and regulation
US8697359B1 (en) * 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
CN113563476A (en) 2013-03-15 2021-10-29 通用医疗公司 RNA-guided targeting of genetic and epigenetic regulatory proteins to specific genomic loci
EP3690958A1 (en) 2013-03-15 2020-08-05 Edward J. Britt Energy conversion device
JP2016521975A (en) * 2013-05-15 2016-07-28 サンガモ バイオサイエンシーズ, インコーポレイテッド Methods and compositions for the treatment of genetic conditions
AU2014274939B2 (en) * 2013-06-04 2020-03-19 President And Fellows Of Harvard College RNA-guideded transcriptional regulation
US9267135B2 (en) 2013-06-04 2016-02-23 President And Fellows Of Harvard College RNA-guided transcriptional regulation
KR20230136697A (en) * 2013-06-05 2023-09-26 듀크 유니버시티 Rna-guided gene editing and gene regulation
BR112015031611A2 (en) * 2013-06-17 2017-12-12 Massachusetts Inst Technology application, manipulation and optimization of systems, methods and compositions for targeting and modeling post-mitotic cell diseases and disorders
EP3635104A1 (en) * 2017-06-09 2020-04-15 Editas Medicine, Inc. Engineered cas9 nucleases

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140179006A1 (en) * 2012-12-12 2014-06-26 Massachusetts Institute Of Technology Crispr-cas component systems, methods and compositions for sequence manipulation

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
Arechavala-Gomeza et al., Comparative analysis of antisense oligonucleotide sequences for targeted skipping of exon 51 during dystrophin pre-mRNA splicing in human muscle, Human Gene Therapy, volume 18, pages 798-810. (Year: 2007) *
Dana Carroll, A CRISPR approach to gene targeting, Molecular Therapy, volume 20, pages 1658-1660. (Year: 2012) *

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20210040460A1 (en) 2012-04-27 2021-02-11 Duke University Genetic correction of mutated genes
US11976307B2 (en) 2012-04-27 2024-05-07 Duke University Genetic correction of mutated genes
US12215345B2 (en) 2013-03-19 2025-02-04 Duke University Compositions and methods for the induction and tuning of gene expression
US11155796B2 (en) 2015-02-09 2021-10-26 Duke University Compositions and methods for epigenome editing
US12215366B2 (en) 2015-02-09 2025-02-04 Duke University Compositions and methods for epigenome editing
US11427817B2 (en) 2015-08-25 2022-08-30 Duke University Compositions and methods of improving specificity in genomic engineering using RNA-guided endonucleases
US11421251B2 (en) 2015-10-13 2022-08-23 Duke University Genome engineering with type I CRISPR systems in eukaryotic cells
US12428631B2 (en) 2016-04-13 2025-09-30 Duke University CRISPR/Cas9-based repressors for silencing gene targets in vivo and methods of use
US20190134221A1 (en) * 2016-05-05 2019-05-09 Duke University Crispr/cas-related methods and compositions for treating duchenne muscular dystrophy
US12214056B2 (en) 2016-07-19 2025-02-04 Duke University Therapeutic applications of CPF1-based genome editing
US12098399B2 (en) 2022-06-24 2024-09-24 Tune Therapeutics, Inc. Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression
WO2024206714A1 (en) * 2023-03-31 2024-10-03 Mammoth Biosciences, Inc. Engineered effector proteins, compositions, systems and methods of use thereof

Also Published As

Publication number Publication date
EP3004370A2 (en) 2016-04-13
EP3417880A1 (en) 2018-12-26
CN114230675A (en) 2022-03-25
KR20230136697A (en) 2023-09-26
US20180320197A1 (en) 2018-11-08
JP2016521555A (en) 2016-07-25
AU2020203924A1 (en) 2020-07-02
AU2022250450B2 (en) 2025-05-22
EP4389903A3 (en) 2024-10-16
KR20160023765A (en) 2016-03-03
ES2987399T3 (en) 2024-11-14
CA2914519A1 (en) 2014-12-11
JP7085716B2 (en) 2022-06-17
KR102733409B1 (en) 2024-11-21
EP3004370A4 (en) 2017-01-11
AU2014274840A2 (en) 2016-01-21
AU2022250572A1 (en) 2023-01-05
US20210032654A1 (en) 2021-02-04
CN120005852A (en) 2025-05-16
AU2025213563A1 (en) 2025-08-28
AU2022250572B2 (en) 2025-05-15
JP2020058349A (en) 2020-04-16
AU2022250450A1 (en) 2023-01-05
JP2025062594A (en) 2025-04-14
CN105658805B (en) 2021-12-31
EP3417880B1 (en) 2025-02-19
EP4435110A2 (en) 2024-09-25
CN105658805A (en) 2016-06-08
JP7649046B2 (en) 2025-03-19
JP2022101562A (en) 2022-07-06
US10745714B2 (en) 2020-08-18
KR102551324B1 (en) 2023-07-05
ES2991293T3 (en) 2024-12-03
US20160201089A1 (en) 2016-07-14
JP2023164823A (en) 2023-11-14
EP3539573B1 (en) 2024-02-14
KR20210072831A (en) 2021-06-17
AU2014274840B2 (en) 2020-03-12
CN114230675B (en) 2025-02-18
KR20230107387A (en) 2023-07-14
WO2014197748A3 (en) 2015-02-19
EP4389903A2 (en) 2024-06-26
AU2014274840A1 (en) 2016-01-21
EP3539573A1 (en) 2019-09-18
WO2014197748A2 (en) 2014-12-11
JP7313055B2 (en) 2023-07-24
KR102307280B1 (en) 2021-10-01
US10704060B2 (en) 2020-07-07
EP4435110A3 (en) 2025-01-01
ES3029138T3 (en) 2025-06-23
EP3004370B1 (en) 2024-08-21

Similar Documents

Publication Publication Date Title
AU2022250572B2 (en) RNA-guided gene editing and gene regulation
US12214056B2 (en) Therapeutic applications of CPF1-based genome editing
US10711256B2 (en) Genetic correction of mutated genes
JP2022101562A5 (en)
US12214054B2 (en) Therapeutic targets for the correction of the human dystrophin gene by gene editing and methods of use
US20230257723A1 (en) Crispr/cas9 therapies for correcting duchenne muscular dystrophy by targeted genomic integration
HK40071050A (en) Rna-guided gene editing and gene regulation

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED

AS Assignment

Owner name: DUKE UNIVERSITY, NORTH CAROLINA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GERSBACH, CHARLES A.;HILTON, ISAAC B.;PEREZ-PINERA, PABLO;AND OTHERS;SIGNING DATES FROM 20151105 TO 20151203;REEL/FRAME:054869/0604

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER