US20190284280A1 - Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) - Google Patents
Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) Download PDFInfo
- Publication number
- US20190284280A1 US20190284280A1 US16/346,463 US201716346463A US2019284280A1 US 20190284280 A1 US20190284280 A1 US 20190284280A1 US 201716346463 A US201716346463 A US 201716346463A US 2019284280 A1 US2019284280 A1 US 2019284280A1
- Authority
- US
- United States
- Prior art keywords
- cancer
- agent
- residue
- tim
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- Cancer is a serious public health problem, with about 595,690 people in the United States of America expected to die of cancer in 2016 alone according to the American Cancer Society, Cancer Facts & Figures 2016 (http://www.cancer.org/acs/groups/content/@research/documents/document/acspc-047079.pdf).
- TIM-3 T Cell Immunoglobulin and Mucin Domain-3
- HAVCR2 Hepatitis A Virus Cellular Receptor 2
- TIM-3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.
- TIM-3 is highly expressed on the surface of multiple immune cell types, including, for example, Th1 IFN- ⁇ + cells, Th17 cells, natural killer (NK) cells, monocytes, and tumor-associated dendritic cells (DCs) (see, e.g., Clayton et al., J. Immunol., 192(2): 782-791 (2014); Jones et al., J. Exp.
- TIM-3 also is highly expressed on “exhausted” or impaired CD8+ T-cells in a variety of chronic viral infections (e.g., HIV, HCV, and HBV) and in certain cancers (see, e.g., McMahan et al., J. Clin. Invest., 120(12): 4546-4557 (2010); Jin et al., Proc Natl Acad Sci USA, 107(33): 14733-14738 (2010); Golden-Mason et al., J. Virol., 83(18): 9122-9130 (2009); Jones et al., supra; Fourcade et al., J. Exp.
- Putative ligands for TIM-3 include phosphatidylserine (Nakayama et al., Blood, 113: 3821-3830 (2009)), galectin-9 (Zhu et al., Nat. Immunol., 6: 1245-1252 (2005)), high-mobility group protein 1 (HMGB1) (Chiba et al., Nature Immunology, 13: 832-842 (2012)), and carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1) (Huang et al., Nature, 517(7534): 386-90 (2015)).
- HMGB1 high-mobility group protein 1
- CEACAM1 carcinoembryonic antigen cell adhesion molecule 1
- TIM-3 functions to regulate various aspects of the immune response.
- the interaction of TIM-3 and galectin-9 (Gal-9) induces cell death and in vivo blockade of this interaction exacerbates autoimmunity and abrogates tolerance in experimental models, strongly suggesting that TIM-3 is a negative regulatory molecule.
- the TIM-3-Gal-9 interaction exhibits antimicrobial effects by promoting macrophage clearance of intracellular pathogens (see, e.g., Sakuishi et al., Trends in Immunology, 32(8): 345-349 (2011)).
- TIM-3 In vivo, suppression of TIM-3 has been shown to enhance the pathological severity of experimental autoimmune encephalomyelitis (Monney et al., supra; and Anderson, A. C. and Anderson, D. E., Curr. Opin. Immunol., 18: 665-669 (2006)). Studies also suggest that dysregulation of the TIM-3-galectin-9 pathway could play a role in chronic autoimmune diseases, such as multiple sclerosis (Anderson and Anderson, supra). TIM-3 promotes clearance of apoptotic cells by binding phosphatidyl serine through its unique binding cleft (see, e.g., DeKruyff et al., J. Immunol., 184(4):1918-1930 (2010)).
- TIM-3 e.g., an antibody
- the present disclosure provides antibody agents and various compositions and methods relating thereto including, for example, polypeptides, nucleic acids, cells, and various methodologies, etc.
- the present invention provides novel antibodies that bind to TIM-3.
- antibodies of the present invention bind to TIM-3 with high affinity and effectively neutralize TIM-3 activity.
- antibody heavy chain polypeptide (SEQ ID NO:1) and light chain polypeptide (SEQ ID NO:2) sequences are explicitly provided.
- the present disclosure provides a polypeptide or an isolated immunoglobulin heavy chain polypeptide having an amino acid sequence as set forth in SEQ ID NO:1.
- the present disclosure further provides a polypeptide or an isolated immunoglobulin heavy chain polypeptide having an amino acid sequence that shares at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% overall identity with that set forth in SEQ ID NO:1.
- sequence differences relative to the sequence set forth in SEQ ID NO:1 are not within the CDRs.
- a polypeptide or an isolated immunoglobulin heavy chain polypeptide includes all three CDRs of SEQ ID NO:1.
- a polypeptide or an immunoglobulin heavy chain polypeptide includes a signal peptide. In some embodiments, a polypeptide or an immunoglobulin heavy chain polypeptide which includes a signal peptide has an amino acid sequence as set forth in SEQ ID NO:5.
- a provided polypeptide or immunoglobulin heavy chain polypeptide is or comprises an IgG4 polypeptide. In some embodiments, a provided polypeptide or immunoglobulin heavy chain polypeptide comprises a human IGHG4*01 polypeptide. In some embodiments, a provided polypeptide or immunoglobulin heavy chain polypeptide comprises one or more mutations within the IgG heavy chain region. In some embodiments, a provided polypeptide or immunoglobulin heavy chain polypeptide comprises an IgG4 heavy chain constant region having one or more mutations in the heavy chain constant region. In some embodiments, a provided polypeptide or immunoglobulin heavy chain polypeptide comprises an IgG4 heavy chain constant region having one or more mutations in hinge region.
- the present disclosure provides a polypeptide or an isolated immunoglobulin light chain polypeptide having an amino acid sequence as set forth in SEQ ID NO:2.
- the present disclosure further provides a polypeptide or an isolated immunoglobulin light chain polypeptide having an amino acid sequence that shares at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% overall identity with that set forth in SEQ ID NO:2.
- sequence differences relative to the sequence set forth in SEQ ID NO:2 are not within the CDRs.
- a polypeptide or an isolated immunoglobulin light chain polypeptide includes all three CDRs of SEQ ID NO:2.
- a provided polypeptide or immunoglobulin light chain polypeptide is a kappa light chain. In some embodiments, a provided polypeptide or immunoglobulin light chain polypeptide comprises a human IGKC*01 polypeptide. In some embodiments, a polypeptide or an immunoglobulin light chain polypeptide includes a signal peptide. In some embodiments, a polypeptide or an immunoglobulin light chain polypeptide includes a signal peptide has an amino acid sequence as set forth in SEQ ID NO:6.
- an anti-TIM-3 antibody agent comprising at least one immunoglobulin heavy chain having an amino acid sequence as set forth in SEQ ID NO:1 and at least one immunoglobulin light chain having an amino acid sequence as set forth in SEQ ID NO:2.
- an anti-TIM-3 antibody agent comprises two immunoglobulin heavy chains, each having an amino acid sequence as set forth in SEQ ID NO:l.
- an anti-TIM-3 antibody agent comprises two immunoglobulin light chains, each having an amino acid sequence as set forth in SEQ ID NO:2.
- an anti-TIM-3 antibody agent has a canonical antibody format.
- a provided heavy chain, light chain and/or antibody agent is glycosylated and one or more sites.
- a glycan is N-linked to an Fc region.
- an antibody agent is glycosylated at Asn297 (Kabat numbering).
- present disclosure provides a composition comprising one or more glycoforms of a heavy chain, light chain, and/or antibody agent as described herein.
- a provided composition comprises plurality of such glycoforms, present in specified absolute and/or relative amounts.
- the present disclosure provides compositions that may be substantially free of one or more particular glycoforms of a heavy chain, light chain, and/or antibody agent as described herein.
- a provided heavy chain, light chain and/or antibody agent has a structure that includes one or more disulfide bonds.
- the one or more disulfide bonds are or include a disulfide bond at the expected position for an IgG4 immunoglobulin.
- an anti-TIM-3 antibody agent is administered concurrently with another antibody agent, such as one specific for lymphocyte-activation gene 3 (LAG-3) or Programmed Death 1 (PD-1).
- LAG-3 lymphocyte-activation gene 3
- PD-1 Programmed Death 1
- an antibody agent binds to TIM-3 and another antigen, resulting in a “dual reactive” antibody agent (e.g., a bispecific antibody).
- a dual reactive antibody agent e.g., a bispecific antibody
- an antibody agent can bind to TIM-3 and to another negative regulator of the immune system such as, for example, programmed death 1 (PD-1) or Lymphocyte Activation Gene 3 protein (LAG-3).
- PD-1 programmed death 1
- LAG-3 Lymphocyte Activation Gene 3 protein
- the present disclosure provides isolated or purified nucleic acid sequences encoding the foregoing immunoglobulin polypeptides, vectors comprising such nucleic acid sequences, anti-TIM-3 antibody agents comprising the foregoing immunoglobulin polypeptides, nucleic acid sequences encoding such anti-TIM-3 antibody agents, vectors comprising such nucleic acid sequences, isolated cells comprising such vectors, compositions comprising such anti-TIM-3 antibody agents or such vectors with a pharmaceutically acceptable carrier, and methods of treating cancer, infectious diseases, or autoimmune diseases in mammals by administering effective amounts of such compositions to mammals.
- FIG. 1 depicts a schematic illustration, not to scale, of TIM-3 regulation of T cell activation.
- FIG. 2 depicts results from an exemplary in vitro T cell exhaustion model.
- A Target expression of PD-1 and TIM-3 in responsive (pre-stimulated) cells and exhausted (post-stimulated) cells.
- B Quantification of IFN- ⁇ production in exhausted (post-stimulated) cells treated with an anti-TIM-3 antibody agent (black bars) and isotype control (clear bars).
- the present disclosure provides antibody agents and various compositions and methods relating thereto including, for example, polypeptides, nucleic acids, cells, and various methodologies, etc.
- Antigen-binding proteins of the present invention bind to TIM-3 with high affinity and effectively neutralize TIM-3 activity.
- Immunoglobulin heavy chain polypeptide (SEQ ID NO:1 and 5) and immunoglobulin light chain polypeptide (SEQ ID NO:2 and 6) sequences are explicitly provided.
- an immunoglobulin heavy chain polypeptide and/or an immunoglobulin light chain polypeptide is isolated.
- immunoglobulin refers to a protein that is found in blood or other bodily fluids of vertebrates, which is used by the immune system to identify and neutralize foreign objects, such as bacteria and viruses.
- a whole immunoglobulin typically consists of four polypeptides: two identical copies of a heavy (H) chain polypeptide and two identical copies of a light (L) chain polypeptide.
- Each of the heavy chains contains one N-terminal variable (V H ) region and three C-terminal constant (C H 1, C H 2, and C H 3) regions, and each light chain contains one N-terminal variable (V L ) region and one C-terminal constant (C L ) region.
- Immunoglobulin light chains can be assigned to one of two distinct types, either kappa ( ⁇ ) or lambda ( ⁇ ), based upon the amino acid sequences of their constant domains.
- each light chain is linked to a heavy chain by disulphide bonds, and the two heavy chains are linked to each other by disulphide bonds.
- the light chain variable region is aligned with the variable region of the heavy chain, and the light chain constant region is aligned with the first constant region of the heavy chain.
- the remaining constant regions of the heavy chains are aligned with each other.
- variable regions of each pair of light and heavy chains form the antigen binding site of an antibody.
- V H and V L regions have the same general structure, with each region comprising four framework (FW or FR) regions, connected by three complementarity determining regions (CDRs).
- framework region refers to the relatively conserved amino acid sequences within the variable region which are located between the hypervariable or complementary determining regions (CDRs).
- CDRs hypervariable or complementary determining regions
- FR1, FR2, FR3, and FR4 there are four framework regions in each variable domain, which are designated FR1, FR2, FR3, and FR4.
- the framework regions form ⁇ sheets that provide the structural framework of a variable region (see, e.g., C. A. Janeway et al. (eds.), Immunobiology, 5 th Ed., Garland Publishing, New York, N.Y. (2001)).
- CDRs complementary determining regions
- the CDRs form the “hypervariable region” of an antibody, which is responsible for antigen binding.
- the CDRs form loops connecting, and in some cases comprising part of, the ⁇ -sheet structure formed by the framework regions. While the constant regions of the light and heavy chains are not directly involved in binding of the antibody to an antigen, the constant regions can influence the orientation of the variable regions.
- the constant regions also exhibit various effector functions, such as participation in antibody-dependent complement-mediated lysis or antibody-dependent cellular toxicity via interactions with effector molecules and cells.
- antibody agent refers to an agent that specifically binds to a particular antigen.
- the term encompasses any polypeptide or polypeptide complex that includes immunoglobulin structural elements sufficient to confer specific binding.
- Exemplary antibody agents include, but are not limited to monoclonal antibodies or polyclonal antibodies.
- an antibody agent may include one or more constant region sequences that are characteristic of mouse, rabbit, primate, or human antibodies.
- an antibody agent may include one or more sequence elements are humanized, primatized, chimeric, etc, as is known in the art.
- an antibody agent utilized in accordance with the present invention is in a format selected from, but not limited to, intact IgA, IgG, IgE or IgM antibodies; bi- or multi-specific antibodies (e.g., Zybodies®, etc); antibody fragments such as Fab fragments, Fab′ fragments, F(ab′) 2 fragments, Fd′ fragments, Fd fragments, and isolated CDRs or sets thereof; single chain Fvs; polypeptide-Fc fusions; single domain antibodies (e.g., shark single domain antibodies such as IgNAR or fragments thereof); cameloid antibodies; masked antibodies (e.g., Probodies®); Small Modular ImmunoPharmaceuticals (“SMIPsTM”); single chain or Tandem diabodies (TandAb®); VHHs; Anticalin
- an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally.
- an antibody may contain a covalent modification (e.g., attachment of a glycan, a payload [e.g., a detectable moiety, a therapeutic moiety, a catalytic moiety, etc], or other pendant group [e.g., poly-ethylene glycol, etc.]).
- an antibody agent is or comprises a polypeptide whose amino acid sequence includes one or more structural elements recognized by those skilled in the art as a complementarity determining region (CDR); in some embodiments, an antibody agent is or comprises a polypeptide whose amino acid sequence includes at least one CDR (e.g., at least one heavy chain CDR and/or at least one light chain CDR) that is substantially identical to one found in a reference antibody. In some embodiments, an included CDR is substantially identical to a reference CDR in that it is either identical in sequence or contains between 1-5 amino acid substitutions as compared with the reference CDR.
- CDR complementarity determining region
- an included CDR is substantially identical to a reference CDR in that it shows at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the reference CDR. In some embodiments, an included CDR is substantially identical to a reference CDR in that it shows at least 96%, 96%, 97%, 98%, 99%, or 100% sequence identity with the reference CDR.
- an included CDR is substantially identical to a reference CDR in that at least one amino acid within the included CDR is deleted, added, or substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical with that of the reference CDR. In some embodiments, an included CDR is substantially identical to a reference CDR in that 1-5 amino acids within the included CDR are deleted, added, or substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical to the reference CDR.
- an included CDR is substantially identical to a reference CDR in that at least one amino acid within the included CDR is substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical with that of the reference CDR.
- an included CDR is substantially identical to a reference CDR in that 1-5 amino acids within the included CDR are deleted, added, or substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical to the reference CDR.
- an antibody agent is or comprises a polypeptide whose amino acid sequence includes structural elements recognized by those skilled in the art as an immunoglobulin variable domain.
- an antibody agent is a polypeptide protein having a binding domain which is homologous or largely homologous to an immunoglobulin-binding domain.
- an anti-TIM-3 antibody agent comprises an immunoglobulin heavy chain polypeptide and/or immunoglobulin light chain polypeptide.
- TIM-3 is a 60 kDa type 1 transmembrane protein comprised of three domains: an N-terminal Ig variable (IgV)-like domain, a central Ser/Thr-rich mucin domain, and a transmembrane domain with a short intracellular tail (see, e.g., Kane, L. P., Journal of Immunology, 184(6): 2743-2749 (2010)).
- TIM-3 was initially identified on terminally differentiated Th1 cells, and negatively regulates the T-cell response by inducing T-cell apoptosis (see, e.g., Hastings et al., Eur. J Immunol., 39(9): 2492-2501 (2009)). TIM-3 also is expressed on activated Th17 and Tc1 cells, and dysregulation of Tim-3 expression on CD4+ T-cells and CD8+ T-cells is associated with several autoimmune diseases, viral infections, and cancer (see, e.g., Liberal et al., Hepatology, 56(2): 677-686 (2012); Wu et al., Eur. J. Immunol., 42(5): 1180-1191 (2012); Anderson, A. C., Curr. Opin. Immunol., 24(2): 213-216 (2012); and Han et al., Frontiers in Immunology, 4: 449 (2013)).
- Certain other antibodies which bind to TIM-3, and components thereof, are known in the art (see, e.g., U.S. Pat. Nos. 8,101,176; 8,552,156; and 8,841,418). Certain anti-TIM-3 antibodies also are commercially available from sources such as, for example, Abcam (Cambridge, Mass.), and R&D Systems, Inc. (Minneapolis, Minn.).
- a provided heavy chain, light chain and/or antibody agent is glycosylated and one or more sites.
- “glycan” is a sugar polymer (moiety) component of a glycoprotein.
- the term “glycan” encompasses free glycans, including glycans that have been cleaved or otherwise released from a glycoprotein.
- a glycan is N-linked to an Fc region.
- an antibody agent is glycosylated at Asn297 (Kabat numbering).
- present disclosure provides a composition comprising one or more glycoforms of a heavy chain, light chain, and/or antibody agent as described herein.
- glycoform is used herein to refer to a particular form of a glycoprotein. That is, when a glycoprotein includes a particular polypeptide that has the potential to be linked to different glycans or sets of glycans, then each different version of the glycoprotein (i.e., where the polypeptide is linked to a particular glycan or set of glycans) is referred to as a “glycoform.”
- a provided composition comprises a plurality of glycoforms of one or more of a heavy chain, light chain, and/or antibody agent as described herein.
- a provided composition comprises plurality of such glycoforms, present in specified absolute and/or relative amounts.
- the present disclosure provides compositions that may be substantially free of one or more particular glycoforms of a heavy chain, light chain, and/or antibody agent as described herein.
- an amount of a glycoform is expressed as a “percent.” For any given parameter, “percent” refers to the number of moles of a particular glycan (glycan X) relative to total moles of glycans of a preparation. In some embodiments, “percent” refers to the number of moles of PNGase F-released Fc glycan X relative to total moles of PNGase F-released Fc glycans detected.
- a provided heavy chain, light chain and/or antibody agent has a structure that includes one or more disulfide bonds.
- the one or more disulfide bonds are or include a disulfide bond at the expected position for an IgG4 immunglobulin.
- a disulfide bond is present at one or more residues corresponding to positions selected from residue 22, 96, 127, 140, 196, 219, 222, 254, 314, 360 and 418 of SEQ ID NO: 1.
- a disulfide bond is present at one or more residues corresponding to positions selected from residue 23, 88, 134, 194 and 214 of SEQ ID NO: 2.
- a provided TIM-3 antibody agent comprises one or more disulfide bonds, wherein the first cysteine is selected from residue 22, 96, 127, 140, 196, 219, 222, 254, 314, 360 and 418 of SEQ ID NO: 1, and the second cysteine is selected from residue 23, 88, 134, 194, and 214 of SEQ ID NO: 2.
- a provided TIM-3 antibody agent comprises one or more disulfide bonds, wherein the first cysteine is selected from residue 22, 96, 127, 140, 196, 219, 222, 254, 314, 360 and 418 of SEQ ID NO: 1, and the second cysteine is selected from 22, 96, 127, 140, 196, 219, 222, 254, 314, 360 and 418 of SEQ ID NO: 1.
- a provided TIM-3 antibody agent comprises one or more disulfide bonds, wherein the first cysteine is selected from residue 23, 88, 134, 194, and 214 of SEQ ID NO: 2, and the second cysteine is selected from residue 23, 88, 134, 194, and 214 of SEQ ID NO: 2.
- a provided TIM-3 antibody agent comprises one or more disulfide bonds formed by a first cysteine and a second cysteine, wherein the one or more disulfide bond is selected from: (a) the first residue is residue 23 of SEQ ID NO: 2, and the second residue is residue 88 of SEQ ID NO: 2; (b) the first residue is residue 134 of SEQ ID NO: 2, and the second residue is residue 194 of SEQ ID NO: 2; (c) the first residue is residue 214 of SEQ ID NO: 2, and the second residue is residue 127 of SEQ ID NO: 1; (d) the first residue is residue 22 of SEQ ID NO: 1, and the second residue is residue 97 of SEQ ID NO: 1; (e) the first residue is residue 140 of SEQ ID NO: 1, and the second residue is residue 196 of SEQ ID NO: 1; (f) the first residue is residue 219 of SEQ ID NO: 1, and the second residue is residue 222 of SEQ ID NO: 1; (g) the first residue is selected from: (
- a provided TIM-3 antibody agent comprises disulfide bonds formed by a first cysteine and a second cysteine, wherein the antibody agent includes disulfide bonds at each of: (a) the first residue is residue 23 of SEQ ID NO: 2, and the second residue is residue 88 of SEQ ID NO: 2; (b) the first residue is residue 134 of SEQ ID NO: 2, and the second residue is residue 194 of SEQ ID NO: 2; (c) the first residue is residue 214 of SEQ ID NO: 2, and the second residue is residue 127 of SEQ ID NO: 1; (d) the first residue is residue 22 of SEQ ID NO: 1, and the second residue is residue 97 of SEQ ID NO: 1; (e) the first residue is residue 140 of SEQ ID NO: 1, and the second residue is residue 196 of SEQ ID NO: 1; (f) the first residue is residue 219 of SEQ ID NO: 1, and the second residue is residue 222 of SEQ ID NO: 1; (g) the first residue is residue 254
- an isolated immunoglobulin heavy chain polypeptide which comprises an amino acid sequence that is at least 90% identical (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 1 or 5.
- an isolated immunoglobulin light chain polypeptide which comprises an amino acid sequence that is at least 90% identical (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 2 or 6.
- Nucleic acid or amino acid sequence “identity,” as described herein, can be determined by comparing a nucleic acid or amino acid sequence of interest to a reference nucleic acid or amino acid sequence. The percent identity is the number of nucleotides or amino acid residues that are the same (i.e., that are identical) as between the sequence of interest and the reference sequence divided by the length of the longest sequence (i.e., the length of either the sequence of interest or the reference sequence, whichever is longer). A number of mathematical algorithms for obtaining the optimal alignment and calculating identity between two or more sequences are known and incorporated into a number of available software programs.
- Such programs include CLUSTAL-W, T-Coffee, and ALIGN (for alignment of nucleic acid and amino acid sequences), BLAST programs (e.g., BLAST 2.1, BL2SEQ, and later versions thereof) and FASTA programs (e.g., FASTA3x, FASTM, and SSEARCH) (for sequence alignment and sequence similarity searches).
- BLAST programs e.g., BLAST 2.1, BL2SEQ, and later versions thereof
- FASTA programs e.g., FASTA3x, FASTM, and SSEARCH
- Sequence alignment algorithms also are disclosed in, for example, Altschul et al., J. Molecular Biol., 215(3): 403-410 (1990), Beigert et al., Proc. Natl. Acad. Sci.
- One or more amino acids of the aforementioned immunoglobulin heavy chain polypeptides and/or light chain polypeptides can be replaced or substituted with a different amino acid.
- An amino acid “replacement” or “substitution” refers to the replacement of one amino acid at a given position or residue by another amino acid at the same position or residue within a polypeptide sequence.
- Amino acids are broadly grouped as “aromatic” or “aliphatic.”
- An aromatic amino acid includes an aromatic ring.
- aromatic amino acids include histidine (H or His), phenylalanine (F or Phe), tyrosine (Y or Tyr), and tryptophan (W or Trp).
- Non-aromatic amino acids are broadly grouped as “aliphatic.”
- “aliphatic” amino acids include glycine (G or Gly), alanine (A or Ala), valine (V or Val), leucine (L or Leu), isoleucine (I or He), methionine (M or Met), serine (S or Ser), threonine (T or Thr), cysteine (C or Cys), proline (P or Pro), glutamic acid (E or Glu), aspartic acid (A or Asp), asparagine (N or Asn), glutamine (Q or Gin), lysine (K or Lys), and arginine (R or Arg).
- Aliphatic amino acids may be sub-divided into four sub-groups.
- the “large aliphatic non-polar sub-group” consists of valine, leucine, and isoleucine.
- the “aliphatic slightly-polar sub-group” consists of methionine, serine, threonine, and cysteine.
- the “aliphatic polar/charged sub-group” consists of glutamic acid, aspartic acid, asparagine, glutamine, lysine, and arginine.
- the “small-residue sub-group” consists of glycine and alanine.
- the group of charged/polar amino acids may be sub-divided into three sub-groups: the “positively-charged sub-group” consisting of lysine and arginine, the “negatively-charged sub-group” consisting of glutamic acid and aspartic acid, and the “polar sub-group” consisting of asparagine and glutamine.
- Aromatic amino acids may be sub-divided into two sub-groups: the “nitrogen ring sub-group” consisting of histidine and tryptophan and the “phenyl sub-group” consisting of phenylalanine and tyrosine.
- amino acid replacement or substitution can be conservative, semi-conservative, or non-conservative.
- conservative amino acid substitution or “conservative mutation” refers to the replacement of one amino acid by another amino acid with a common property.
- a functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz and Schirmer, Principles of Protein Structure, Springer-Verlag, New York (1979)). According to such analyses, groups of amino acids may be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz and Schirmer, supra).
- conservative amino acid substitutions include substitutions of amino acids within the sub-groups described above, for example, lysine for arginine and vice versa such that a positive charge may be maintained, glutamic acid for aspartic acid and vice versa such that a negative charge may be maintained, serine for threonine such that a free —OH can be maintained, and glutamine for asparagine such that a free —NH 2 can be maintained.
- “Semi-conservative mutations” include amino acid substitutions of amino acids within the same groups listed above, but not within the same sub-group. For example, the substitution of aspartic acid for asparagine, or asparagine for lysine, involves amino acids within the same group, but different sub-groups. “Non-conservative mutations” involve amino acid substitutions between different groups, for example, lysine for tryptophan, or phenylalanine for serine, etc.
- an isolated anti-TIM-3 antibody agent comprising, consisting essentially of, or consisting of an inventive isolated amino acid sequences described herein.
- isolated refers to a nucleic acid sequence (e.g., a polynucleotide) or an amino acid sequence (e.g., a polypeptide) that is removed or separated from other components present in its natural environment.
- an isolated polypeptide is one that is separated from other components of a cell in which it was produced (e.g., the endoplasmic reticulum or cytoplasmic proteins and RNA).
- An isolated polynucleotide is one that is separated from other nuclear components (e.g., histones) and/or from upstream or downstream nucleic acid sequences.
- An isolated nucleic acid sequence or amino acid sequence can be at least 60% free, or at least 75% free, or at least 90% free, or at least 95% free, or at least 98% free, or at least 99% free from other components present in natural environment of the indicated nucleic acid sequence or amino acid sequence.
- anti-TIM-3 antibody agent is meant a molecule, preferably a proteinaceous molecule, that binds specifically to a TIM-3 protein.
- a TIM-3 binding agent is an anti-TIM-3 antibody agent.
- an isolated anti-TIM-3 antibody agent comprises, consists essentially of, or consists of an immunoglobulin heavy chain polypeptide (e.g., SEQ ID NO:1) and/or an immunoglobulin light chain polypeptide (e.g., SEQ ID NO:2).
- an isolated anti-TIM-3 antibody agent comprises, consists essentially of, or consists of an immunoglobulin heavy chain polypeptide whose sequence comprises SEQ ID NO:1 and an immunoglobulin light chain polypeptide whose sequence comprises SEQ ID NO:2.
- a provided polypeptide or heavy chain polypeptide consists essentially of an amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 5, and may further comprise additional components that do not materially affect the polypeptide, e.g., by influencing affinity of an inventive heavy chain polypeptide to TIM-3.
- additional components include, for example, protein moieties such as biotin that facilitate purification or isolation, passenger mutations, sequences free of problematic sites including free cysteines, additional glycosylation sites, and high-likelihood deamidation or isomerization sites.
- a provided polypeptide or immunoglobulin heavy chain polypeptide consists of an amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 5 and does not comprise any additional components (i.e., components that are not endogenous to an inventive immunoglobulin heavy chain polypeptide).
- anti-TIM-3 antibody agents include variants where one or more amino acids in the immunoglobulin heavy chain polypeptide and/or the immunoglobulin light chain polypeptide replaced, in any combination, with a different amino acid residue, or can be deleted or inserted, so long as the biological activity of an anti-TIM-3 antibody agent is not materially diminished (e.g., enhanced or improved) as a result of the amino acid replacements, insertions, and/or deletions.
- the “biological activity” of an TIM-3-binding agent refers to, for example, binding affinity for a particular TIM-3 epitope, neutralization or inhibition of TIM-3 binding to its receptor(s), neutralization or inhibition of TIM-3 activity in vivo (e.g., IC 50 ), pharmacokinetics, and cross-reactivity (e.g., with non-human homologs or orthologs of the TIM-3 protein, or with other proteins or tissues).
- Other biological properties or characteristics of an antigen-binding agent recognized in the art include, for example, avidity, selectivity, solubility, folding, immunotoxicity, expression, and formulation.
- ELISA ELISA
- competitive ELISA surface plasmon resonance analysis
- KINEXATM Kinetic Exclusion Assay
- inhibitor or “neutralize,” as used herein with respect to the activity of an anti-TIM-3 antibody agent, refer to the ability to substantially antagonize, prohibit, prevent, restrain, slow, disrupt, alter, eliminate, stop, or reverse the progression or severity of, for example, the biological activity of TIM-3, or a disease or condition associated with TIM-3.
- an anti-TIM-3 antibody agent inhibits or neutralizes the activity of TIM-3 by at least about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 98%, about 99%, about 100%, or a range defined by any two of the foregoing values (e.g., 20% to 100%, 40% to 100% or 60% to 95%, etc.)
- an anti-TIM-3 antibody agent is a whole antibody or a fragment thereof (e.g., an antibody fragment).
- the antibody or antibody fragment comprises a heavy chain constant region that is based upon wild-type IgG1, IgG2, or IgG4 antibodies, or variants thereof. It will be appreciated that each antibody class, or isotype, engages a distinct set of effector mechanisms for disposing of or neutralizing antigen once recognized.
- an anti-TIM-3 antibody agent when an anti-TIM-3 antibody agent is an antibody, it can exhibit one or more effector functions, such as participation in antibody-dependent complement-mediated lysis or antibody-dependent cellular toxicity via interactions with effector molecules and cells (e.g., activation of the complement system).
- an anti-TIM-3 antibody agent comprises an IgG4 heavy chain constant region. In some embodiments, an anti-TIM-3 antibody agent comprises one or more mutations within the IgG heavy chain region. In some embodiments, an anti-TIM-3 antibody agent comprises an IgG4 heavy chain constant region having one or more mutations in the heavy chain constant region. In some embodiments, an anti-TIM-3 antibody agent comprises an IgG4 heavy chain constant region having one or more mutations in hinge region. It is envisioned that in some embodiments, a mutation in the IgG4 hinge region may prevent half molecule exchange with other IgG4 molecules.
- the one or more mutations in hinge region of IgG4 may include an S228P mutation or a serine to proline stabilizing mutation that prevents half molecule exchange with other IgG4 molecules. See, e.g., J. Biol. Chem. 2015; 290(9):5462-5469.
- an anti-TIM-3 antibody agent also can be an antibody conjugate.
- an anti-TIM-3 antibody agent can be a conjugate of (1) an anti-TIM-3 antibody and (2) a protein or non-protein moiety.
- an anti-TIM-3 antibody agent can be an antibody conjugated to a peptide, a fluorescent molecule, or a chemotherapeutic agent.
- An anti-TIM-3 antibody agent can be, or can be obtained from, a human antibody, a non-human antibody, or a chimeric antibody.
- chimeric is meant an antibody or fragment thereof comprising both human and non-human regions.
- an anti-TIM-3 antibody agent is a humanized antibody.
- a “humanized” antibody is a monoclonal antibody comprising a human antibody scaffold and at least one CDR obtained or derived from a non-human antibody.
- Non-human antibodies include antibodies isolated from any non-human animal, such as, for example, a rodent (e.g., a mouse or rat).
- a humanized antibody can comprise, one, two, or three CDRs obtained or derived from a non-human antibody.
- CDRH3 of an inventive TIM-3-binding agent is obtained or derived from a mouse monoclonal antibody, while the remaining variable regions and constant region of an anti-TIM-3 antibody agent are obtained or derived from a human monoclonal antibody.
- a human antibody, a non-human antibody, a chimeric antibody, or a humanized antibody can be obtained by any means, including via in vitro sources (e.g., a hybridoma or a cell line producing an antibody recombinantly) and in vivo sources (e.g., rodents).
- in vitro sources e.g., a hybridoma or a cell line producing an antibody recombinantly
- in vivo sources e.g., rodents.
- a human antibody or a chimeric antibody can be generated using a transgenic animal (e.g., a mouse) wherein one or more endogenous immunoglobulin genes are replaced with one or more human immunoglobulin genes.
- transgenic mice wherein endogenous antibody genes are effectively replaced with human antibody genes include, but are not limited to, the Medarex HUMAB-MOUSETM, the Kirin TC MOUSETM, and the Kyowa Kirin KM-MOUSETM (see, e.g., Lonberg, Nat. Biotechnol., 23(9): 1117-25 (2005), and Lonberg, Handb. Exp. Pharmacol., 181: 69-97 (2008)).
- a humanized antibody can be generated using any suitable method known in the art (see, e.g., An, Z. (ed.), Therapeutic Monoclonal Antibodies: From Bench to Clinic, John Wiley & Sons, Inc., Hoboken, N.J. (2009)), including, e.g., grafting of non-human CDRs onto a human antibody scaffold (see, e.g., Kashmiri et al., Methods, 36(1): 25-34 (2005); and Hou et al., J. Biochem., 144(1): 115-120 (2008)).
- a humanized antibody can be produced using the methods described in, e.g., U.S. Patent Application Publication 2011/0287485 A1.
- an anti-TIM-3 antibody agent binds an epitope of TIM-3 which blocks the binding of TIM-3 to any of its putative ligands (e.g., phosphatidylserine, galectin-9, high-mobility group protein 1 (HMGB1), and carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1)) and inhibits TIM-3-mediated signaling.
- putative ligands e.g., phosphatidylserine, galectin-9, high-mobility group protein 1 (HMGB1), and carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1)
- the disclosure also provides an isolated or purified epitope of TIM-3 which blocks the binding of TIM-3 to any of its putative ligands in an indirect or allosteric manner.
- an anti-TIM-3 antibody agent binds an epitope of TIM-3 which blocks the binding of TIM-3 to one, two or more of its putative ligands.
- the disclosure also provides one or more isolated or purified nucleic acid sequences that encode an inventive immunoglobulin heavy chain polypeptide, an inventive immunoglobulin light chain polypeptide, and/or an inventive anti-TIM-3 antibody agent.
- nucleic acid sequence is intended to encompass a polymer of DNA or RNA, i.e., a polynucleotide, which can be single-stranded or double-stranded and which can contain non-natural or altered nucleotides.
- nucleic acid and polynucleotide refer to a polymeric form of nucleotides of any length, either ribonucleotides (RNA) or deoxyribonucleotides (DNA). These terms refer to the primary structure of the molecule, and thus include double- and single-stranded DNA, and double- and single-stranded RNA.
- RNA or DNA made from nucleotide analogs and modified polynucleotides such as, though not limited to, methylated and/or capped polynucleotides.
- Nucleic acids are typically linked via phosphate bonds to form nucleic acid sequences or polynucleotides, though many other linkages are known in the art (e.g., phosphorothioates, boranophosphates, and the like).
- Nucleic acid sequences encoding an inventive immunoglobulin heavy chain polypeptides include, for example, SEQ ID NO: 3.
- Nucleic acid sequences encoding an inventive immunoglobulin light chain polypeptides include, for example, SEQ ID NO: 4.
- the disclosure further provides a vector comprising one or more nucleic acid sequences encoding an inventive immunoglobulin heavy chain polypeptide, an inventive immunoglobulin light chain polypeptide, and/or an inventive anti-TIM-3 antibody agent.
- the vector can be, for example, a plasmid, episome, cosmid, viral vector (e.g., retroviral or adenoviral), or phage.
- Suitable vectors and methods of vector preparation are well known in the art (see, e.g., Sambrook et al., Molecular Cloning, a Laboratory Manual, 3 rd edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (2001), and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New York, N.Y. (1994)).
- the vector can comprise expression control sequences, such as promoters, enhancers, polyadenylation signals, transcription terminators, signal peptides (e.g., the osteonectin signal peptide), internal ribosome entry sites (IRES), and the like, that provide for the expression of the coding sequence in a host cell.
- expression control sequences are known in the art and described in, for example, Goeddel, Gene Expression Technology: Methods in Enzymology, Vol. 185, Academic Press, San Diego, Calif. (1990).
- promoters including constitutive, inducible, and repressible promoters, from a variety of different sources are well known in the art.
- Representative sources of promoters include for example, virus, mammal, insect, plant, yeast, and bacteria, and suitable promoters from these sources are readily available, or can be made synthetically, based on sequences publicly available, for example, from depositories such as the ATCC as well as other commercial or individual sources.
- Promoters can be unidirectional (i.e., initiate transcription in one direction) or bi-directional (i.e., initiate transcription in either a 3′ or 5′ direction).
- Non-limiting examples of promoters include, for example, the T7 bacterial expression system, pBAD (araA) bacterial expression system, the cytomegalovirus (CMV) promoter, the SV40 promoter, the RSV promoter.
- Inducible promoters include, for example, the Tet system (U.S. Pat. Nos. 5,464,758 and 5,814,618), the Ecdysone inducible system (No et al., Proc. Natl. Acad.
- pellet refers to a DNA sequence that increases transcription of, for example, a nucleic acid sequence to which it is operably linked.
- Enhancers can be located many kilobases away from the coding region of the nucleic acid sequence and can mediate the binding of regulatory factors, patterns of DNA methylation, or changes in DNA structure.
- a large number of enhancers from a variety of different sources are well known in the art and are available as or within cloned polynucleotides (from, e.g., depositories such as the ATCC as well as other commercial or individual sources).
- a number of polynucleotides comprising promoters (such as the commonly-used CMV promoter) also comprise enhancer sequences. Enhancers can be located upstream, within, or downstream of coding sequences.
- the vector also can comprise a “selectable marker gene.”
- selectable marker gene refers to a nucleic acid sequence that allow cells expressing the nucleic acid sequence to be specifically selected for or against, in the presence of a corresponding selective agent. Suitable selectable marker genes are known in the art and described in, e.g., International Patent Application Publications WO 1992/008796 and WO 1994/028143; Wigler et al., Proc. Natl. Acad. Sci. USA, 77: 3567-3570 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA, 78: 1527-1531 (1981); Mulligan & Berg, Proc. Natl.
- the vector is an “episomal expression vector” or “episome,” which is able to replicate in a host cell, and persists as an extrachromosomal segment of DNA within the host cell in the presence of appropriate selective pressure (see, e.g., Conese et al., Gene Therapy, 11: 1735-1742 (2004)).
- Representative commercially available episomal expression vectors include, but are not limited to, episomal plasmids that utilize Epstein Barr Nuclear Antigen 1 (EBNA1) and the Epstein Barr Virus (EBV) origin of replication (oriP).
- the vectors pREP4, pCEP4, pREP7, and pcDNA3.1 from Invitrogen (Carlsbad, Calif.) and pBK-CMV from Stratagene (La Jolla, Calif.) represent non-limiting examples of an episomal vector that uses T-antigen and the SV40 origin of replication in lieu of EBNA1 and oriP.
- Suitable vectors include integrating expression vectors, which may randomly integrate into the host cell's DNA, or may include a recombination site to enable the specific recombination between the expression vector and the host cell's chromosome. Such integrating expression vectors may utilize the endogenous expression control sequences of the host cell's chromosomes to effect expression of the desired protein.
- integrating expression vectors may utilize the endogenous expression control sequences of the host cell's chromosomes to effect expression of the desired protein.
- Examples of vectors that integrate in a site specific manner include, for example, components of the flp-in system from Invitrogen (Carlsbad, Calif.) (e.g., pcDNATM 5/FRT), or the cre-lox system, such as can be found in the pExchange-6 Core Vectors from Stratagene (La Jolla, Calif.).
- vectors that randomly integrate into host cell chromosomes include, for example, pcDNA3.1 (when introduced in the absence of T-antigen) from Life Technologies (Carlsbad, Calif.), UCOE from Millipore (Billerica, Mass.), and pCI or pFN10A (ACT) FLEXITM from Promega (Madison, Wis.).
- Viral vectors also can be used.
- Representative commercially available viral expression vectors include, but are not limited to, the adenovirus-based Per.C6 system available from Crucell, Inc. (Leiden, The Netherlands), the lentiviral-based pLP1 from Invitrogen (Carlsbad, Calif.), and the retroviral vectors pFB-ERV plus pCFB-EGSH from Stratagene (La Jolla, Calif.).
- Nucleic acid sequences encoding inventive amino acid sequences can be provided to a cell on the same vector (i.e., in cis).
- a unidirectional promoter can be used to control expression of each nucleic acid sequence.
- a combination of bidirectional and unidirectional promoters can be used to control expression of multiple nucleic acid sequences.
- Nucleic acid sequences encoding inventive amino acid sequences alternatively can be provided to the population of cells on separate vectors (i.e., in trans). Each of the nucleic acid sequences in each of the separate vectors can comprise the same or different expression control sequences. The separate vectors can be provided to cells simultaneously or sequentially.
- the vector(s) comprising the nucleic acid(s) encoding inventive amino acid sequences can be introduced into a host cell that is capable of expressing the polypeptides encoded thereby, including any suitable prokaryotic or eukaryotic cell.
- a host cell that is capable of expressing the polypeptides encoded thereby, including any suitable prokaryotic or eukaryotic cell.
- the present disclosure provides an isolated cell comprising an inventive vector.
- Host cells include cells that can be easily and reliably grown, have reasonably fast growth rates, have well-characterized expression systems, and can be transformed or transfected easily and efficiently.
- prokaryotic cells examples include, but are not limited to, cells from the genera Bacillus (such as Bacillus subtilis and Bacillus brevis ), Escherichia (such as E. coli ), Pseudomonas, Streptomyces, Salmonella, and Erwinia.
- Useful prokaryotic cells include, for example, the various strains of Escherichia coli (e.g., K12, HB101 (ATCC No. 33694), DH5 ⁇ , DH10, MC1061 (ATCC No. 53338), and CC102).
- an inventive vector is introduced into a eukaryotic cell.
- Suitable eukaryotic cells include, for example, yeast cells, insect cells, and mammalian cells.
- suitable yeast cells include those from the genera Kluyveromyces, Pichia, Rhino - sporidium, Saccharomyces, and Schizosaccharomyces .
- Yeast cells include, for example, Saccharomyces cerivisae and Pichia pastoris.
- Suitable insect cells are described in, for example, Kitts et al., Biotechniques, 14: 810-817 (1993); Lucklow, Curr. Opin. Biotechnol., 4: 564-572 (1993); and Lucklow et al., J. Virol., 67: 4566-4579 (1993).
- Insect cells include, for example, Sf-9 and HIS (Invitrogen, Carlsbad, Calif.).
- mammalian cells are utilized.
- suitable mammalian host cells are known in the art, and many are available from the American Type Culture Collection (ATCC, Manassas, Va.).
- suitable mammalian cells include, but are not limited to, Chinese hamster ovary cells (CHO) (ATCC No. CCL61), CHO DHFR-cells (Urlaub et al., Proc. Natl. Acad. Sci. USA, 97: 4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), and 3T3 cells (ATCC No. CCL92).
- CHO Chinese hamster ovary cells
- CHO DHFR-cells Urlaub et al., Proc. Natl. Acad. Sci. USA, 97: 4216-4220 (1980)
- human embryonic kidney (HEK) 293 or 293T cells ATCC No. CRL1573)
- 3T3 cells AT
- mammalian host cells include primate cell lines and rodent cell lines, including transformed cell lines. Normal diploid cells, cell strains derived from in vitro culture of primary tissue, as well as primary explants, are also suitable.
- Other suitable mammalian cell lines include, but are not limited to, mouse neuroblastoma N2A cells, HeLa, mouse L-929 cells, and BHK or HaK hamster cell lines, all of which are available from the ATCC. Methods for selecting suitable mammalian host cells and methods for transformation, culture, amplification, screening, and purification of cells are known in the art.
- the mammalian cell is a human cell.
- the mammalian cell can be a human lymphoid or lymphoid derived cell line, such as a cell line of pre-B lymphocyte origin.
- human lymphoid cells lines include, without limitation, RAMOS (CRL-1596), Daudi (CCL-213), EB-3 (CCL-85), DT40 (CRL-2111), 18-81 (Jack et al., Proc. Natl. Acad. Sci. USA, 85: 1581-1585 (1988)), Raji cells (CCL-86), PER.C6 cells (Crucell Holland B.V., Leiden, The Netherlands), and derivatives thereof.
- a nucleic acid sequence encoding an inventive amino acid sequence may be introduced into a cell by “transfection,” “transformation,” or “transduction.”
- “Transfection,” “transformation,” or “transduction,” as used herein, refer to the introduction of one or more exogenous polynucleotides into a host cell by using physical or chemical methods.
- Many transfection techniques are known in the art and include, for example, calcium phosphate DNA co-precipitation (see, e.g., Murray E. J. (ed.), Methods in Molecular Biology, Vol.
- Phage or viral vectors can be introduced into host cells, after growth of infectious particles in suitable packaging cells, many of which are commercially available.
- compositions comprising an effective amount of an inventive immunoglobulin heavy chain polypeptide, an inventive immunoglobulin light chain polypeptide, an inventive TIM-3-binding agent, an inventive nucleic acid sequence encoding any of the foregoing, or an inventive vector comprising an inventive nucleic acid sequence.
- the composition is a pharmaceutically acceptable (e.g., physiologically acceptable) composition, which comprises a carrier, preferably a pharmaceutically acceptable (e.g., physiologically acceptable) carrier, and inventive amino acid sequences, antigen-binding agent, or vector.
- a pharmaceutically acceptable e.g., physiologically acceptable
- a carrier preferably a pharmaceutically acceptable (e.g., physiologically acceptable) carrier, and inventive amino acid sequences, antigen-binding agent, or vector.
- Any suitable carrier can be used within the context of the invention, and such carriers are well known in the art.
- the choice of carrier will be determined, in part, by the particular site to which the composition may be administered and the particular method used to administer the composition.
- the composition optionally can be sterile.
- the composition can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use.
- the compositions can be generated in accordance with conventional techniques described in, e.g., Remington: The Science and Practice of Pharmacy, 21 st Edition, Lippincott Williams & Wilkins, Philadelphia, Pa. (2001).
- the disclosure further provides methods of treating any disease or disorder in which expression, improper expression (e.g., overexpression) or increased activity of a TIM-3 protein causes or contributes to the pathological effects of the disease, or a decrease in TIM-3 protein levels or activity has a therapeutic benefit in mammals, such as humans.
- Mammals include, e.g., mice, rats, rabbits, dogs, cats, cows, horses, non-human primates, and humans.
- TIM-3 is a negative regulator of the immune response and is therefore a target for therapy ( FIG. 1 ). Accordingly, the disclosure further provides methods of treating a disorder in a mammal that is responsive to TIM-3 inhibition or neutralization.
- the method comprises administering the aforementioned composition to a mammal having a disorder that is responsive to TIM-3 inhibition or neutralization, whereupon the disorder is treated in the mammal.
- a disorder that is “responsive to TIM-3 inhibition” or “responsive to TIM-3 neutralization” refers to any disease or disorder in which a decrease in TIM-3 levels or activity has a therapeutic benefit in mammals, for example humans, or the improper expression (e.g., overexpression) or increased activity of TIM-3 causes or contributes to the pathological effects of the disease or disorder.
- Disorders that are responsive to TIM-3 inhibition include, for example, cancer, infectious diseases, and autoimmune diseases.
- the disclosure further provides methods of enhancing an immune response or increasing the activity of an immune cell in a mammal having a disorder that is responsive to TIM-3 inhibition.
- such methods include administering an effective amount of any TIM-3 binding agent or antibody agent described herein.
- administration of a TIM-3 binding agent enhances or increases an immune response or immune cell activity in a mammal or tissue thereof.
- an immune response is a humoral or cell mediated immune response.
- an immune response is a CD4 or CD8 T cell response.
- an immune response is a B cell response.
- inventive methods can be used to treat any type of cancer known in the art, such as, for example, melanoma, renal cell carcinoma, lung cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, gall bladder cancer, laryngeal cancer, liver cancer, thyroid cancer, stomach cancer, salivary gland cancer, prostate cancer, pancreatic cancer, adenocarcinoma (e.g., adenocarcinoma of the lung), or Merkel cell carcinoma (see, e.g., Bhatia et al., Curr. Oncol. Rep., 13(6): 488-497 (2011)).
- adenocarcinoma e.g., adenocarcinoma of the lung
- Merkel cell carcinoma see, e.g., Bhatia et al., Curr. Oncol. Rep., 13(6): 488-497 (2011).
- a cancer is endometrial cancer, breast cancer, ovarian cancer, cervical cancer, fallopian tube cancer, testicular cancer, primary peritoneal cancer, colon cancer, colorectal cancer, stomach cancer, small intestine cancer, squamous cell carcinoma of the anogenital region, melanoma, renal cell carcinoma, lung cancer, non-small cell lung cancer, squamous cell carcinoma of the lung, stomach cancer, bladder cancer, gall bladder cancer, liver cancer, thyroid cancer, laryngeal cancer, salivary gland cancer, esophageal cancer, head and neck cancer, squamous cell carcinoma of the head and neck, adenocarcinoma, adenocarcinoma of the lung, prostate cancer, pancreatic cancer, mesothelioma, Merkel cell carcinoma, sarcoma, glioblastoma, or hematological cancer (e.g., multiple myeloma, B-cell lymphoma, T-cell lymphoma, Hod
- a cancer to be treated with the inventive methods and/or compositions described herein is characterized by microsatellite instability or lack thereof.
- Microsatellite instability (“MSI”) is or comprises a change that in the DNA of certain cells (such as tumor cells) in which the number of repeats of microsatellites (short, repeated sequences of DNA) is different than the number of repeats that was contained in the DNA from which it was inherited.
- Microsatellite instability arises from a failure to repair replication-associated errors due to a defective DNA mismatch repair (MMR) system. This failure allows persistence of mismatch mutations all over the genome, but especially in regions of repetitive DNA known as microsatellites, leading to increased mutational load.
- MMR DNA mismatch repair
- a cancer has a microsatellite instability status of high microsatellite instability (e.g., MSI-H status). In some embodiments, a cancer has a microsatellite instability status of low microsatellite instability (e.g., MSI-L status). In some embodiments, a cancer has a microsatellite instability status of microsatellite stable (e.g., MSS status). In some embodiments microsatellite instability status is assessed by a next generation sequencing (NGS)-based assay, an immunohistochemistry (IHC)-based assay, and/or a PCR-based assay. In some embodiments, microsatellite instability is detected by NGS. In some embodiments, microsatellite instability is detected by IHC. In some embodiments, microsatellite instability is detected by PCR.
- NGS next generation sequencing
- IHC immunohistochemistry
- the cancer is associated with a high tumor mutation burden (TMB). In some embodiments, the cancer is associated with high TMB and MSI-H. In some embodiments, the cancer is associated with high TMB and MSI-L or MSS. In some embodiments, the cancer is endometrial cancer associated with high TMB. In some related embodiments, the endometrial cancer is associated with high TMB and MSI-H. In some related embodiments, the endometrial cancer is associated with high TMB and MSI-L or MSS.
- TMB tumor mutation burden
- MSI-H high TMB and MSI-L or MSS.
- a cancer is a mismatch repair deficient cancer.
- Microsatellite instability may arise from a failure to repair replication-associated errors due to a defective DNA mismatch repair (MMR) system. This failure allows persistence of mismatch mutations all over the genome, but especially in regions of repetitive DNA known as microsatellites, leading to increased mutational load that may improve responses to certain anti-PD-1 agents.
- MMR DNA mismatch repair
- a cancer is a hypermutated cancer.
- a cancer harbors a mutation in polymerase epsilon (POLE).
- the inventive methods can be used to treat any type of infectious disease (i.e., a disease or disorder caused by a bacterium, a virus, a fungus, or a parasite).
- infectious diseases i.e., a disease or disorder caused by a bacterium, a virus, a fungus, or a parasite.
- infectious diseases include, but are not limited to, diseases caused by a human immunodeficiency virus (HIV), a respiratory syncytial virus (RSV), an influenza virus, a dengue virus, a hepatitis B virus (HBV, or a hepatitis C virus (HCV)).
- HCV human immunodeficiency virus
- RSV respiratory syncytial virus
- HBV hepatitis B virus
- HCV hepatitis C virus
- the inventive methods can be used to treat any type of autoimmune disease (i.e., as disease or disorder caused by immune system over-activity in which the body attacks and damages its own tissues), such as those described in, for example, MacKay I. R. and Rose N. R., eds., The Autoimmune Diseases, Fifth Edition, Academic Press, Waltham, Mass. (2014).
- autoimmune diseases that can be treated by the inventive method include, but are not limited to, multiple sclerosis, type 1 diabetes mellitus, rheumatoid arthritis, scleroderma, Crohn's disease, psoriasis, systemic lupus erythematosus (SLE), and ulcerative colitis.
- compositions comprising an inventive immunoglobulin heavy chain polypeptide, an inventive immunoglobulin light chain polypeptide, an inventive TIM-3-binding agent, an inventive nucleic acid sequence encoding any of the foregoing, or an inventive vector comprising an inventive nucleic acid sequence induces an immune response against a cancer or infectious disease in a mammal.
- Mammals include, e.g., mice, rats, rabbits, dogs, cats, cows, horses, non-human primates, and humans.
- An “immune response” can entail, for example, antibody production and/or the activation of immune effector cells (e.g., T-cells).
- the terms “treatment,” “treating,” and the like refer to obtaining a desired pharmacologic and/or physiologic effect.
- the effect is therapeutic, i.e., the effect partially or completely cures a disease and/or adverse symptom attributable to the disease.
- the inventive method comprises administering a “therapeutically effective amount” of an anti-TIM-3 antibody agent.
- a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result.
- the therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of an anti-TIM-3 antibody agent to elicit a desired response in the individual.
- a therapeutically effective amount of an anti-TIM-3 antibody agent is an amount which decreases TIM-3 bioactivity in a human.
- the pharmacologic and/or physiologic effect may be prophylactic, i.e., the effect completely or partially prevents a disease or symptom thereof.
- the inventive method comprises administering a “prophylactically effective amount” of an anti-TIM-3 antibody agent.
- a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired prophylactic result (e.g., prevention of disease onset).
- a typical dose can be, for example, in the range of 1 pg/kg to 20 mg/kg of animal or human body weight; however, doses below or above this exemplary range are within the scope of the invention.
- the daily parenteral dose can be about 0.00001 ⁇ g/kg to about 20 mg/kg of total body weight (e.g., about 0.001 ⁇ g/kg, about 0.1 ⁇ g/kg, about 1 ⁇ g/kg, about 5 ⁇ g/kg, about 10 ⁇ g/kg, about 100 ⁇ g/kg, about 500 ⁇ g/kg, about 1 mg/kg, about 5 mg/kg, about 10 mg/kg, or a range defined by any two of the foregoing values).
- from about 0.1 ⁇ g/kg to about 10 mg/kg of total body weight e.g., about 0.5 ⁇ g/kg, about 1 ⁇ g/kg, about 50 ⁇ g/kg, about 150 ⁇ g/kg, about 300 ⁇ g/kg, about 750 ⁇ g/kg, about 1.5 mg/kg, about 5 mg/kg, or a range defined by any two of the foregoing values.
- from about 1 ⁇ g/kg to 5 mg/kg of total body weight e.g., about 3 ⁇ g/kg, about 15 ⁇ g/kg, about 75 ⁇ g/kg, about 300 ⁇ g/kg, about 900 ⁇ g/kg, about 2 mg/kg, about 4 mg/kg, or a range defined by any two of the foregoing values.
- from about 0.5 to 15 mg/kg body weight per day e.g., about 1 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 6 mg/kg, about 9 mg/kg, about 11 mg/kg, about 13 mg/kg, or a range defined by any two of the foregoing values).
- Therapeutic or prophylactic efficacy can be monitored by periodic assessment of treated patients. For repeated administrations over several days or longer, depending on the condition, the treatment can be repeated until a desired suppression of disease symptoms occurs, or alternatively, the treatment can be continued for the lifetime of the patient.
- other dosage regimens may be useful and are within the scope of the invention.
- the desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
- Composition(s) comprising an effective amount of an inventive immunoglobulin heavy chain polypeptide, an inventive immunoglobulin light chain polypeptide, an inventive TIM-3-binding agent, an inventive nucleic acid sequence encoding any of the foregoing, or an inventive vector comprising an inventive nucleic acid sequence can be administered to a mammal using standard administration techniques, including oral, ocular, parenteral, intravenous, intraperitoneal, subcutaneous, pulmonary, bronchial, buccal, intradermal, interdermal, transdermal, topical, intramuscular, intranasal, buccal, sublingual, enteral, intra-arterial, intragastric, within a specific organ (e.g., intrahepatic), rectally, subcutaneously, sublingual, tracheal, vaginal, vitreal, intramedullar, intrathecal, intraventricular, mucosal or suppository administration.
- standard administration techniques including oral, ocular, parenteral, intravenous, intraperitone
- the composition is suitable for parenteral administration.
- parenteral includes intravenous, intramuscular, subcutaneous, rectal, vaginal, and intraperitoneal administration.
- the composition is administered to a mammal using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection. Mammals include, e.g., mice, rats, rabbits, dogs, cats, cows, horses, non-human primates, and humans.
- an anti-TIM-3 antibody agent e.g., an antibody
- an anti-TIM-3 antibody agent has an in vivo half-life between about 30 minutes and 45 days (e.g., about 30 minutes, about 45 minutes, about 1 hour, about 2 hours, about 4 hours, about 6 hours, about 10 hours, about 12 hours, about 1 day, about 5 days, about 10 days, about 15 days, about 25 days, about 35 days, about 40 days, about 45 days, or a range defined by any two of the foregoing values).
- an anti-TIM-3 antibody agent has an in vivo half life between about 2 hours and 20 days (e.g., about 5 hours, about 10 hours, about 15 hours, about 20 hours, about 2 days, about 3 days, about 7 days, about 12 days, about 14 days, about 17 days, about 19 days, or a range defined by any two of the foregoing values).
- an anti-TIM-3 antibody agent has an in vivo half-life between about 10 days and about 40 days (e.g., about 10 days, about 13 days, about 16 days, about 18 days, about 20 days, about 23 days, about 26 days, about 29 days, about 30 days, about 33 days, about 37 days, about 38 days, about 39 days, about 40 days, or a range defined by any two of the foregoing values).
- the stability of an anti-TIM-3 antibody agent can be measured using any other suitable assay known in the art, such as, for example, measuring serum half-life, differential scanning calorimetry (DSC), thermal shift assays, and pulse-chase assays.
- DSC differential scanning calorimetry
- Other methods of measuring protein stability in vivo and in vitro that can be used in the context of the invention are described in, for example, Protein Stability and Folding, B. A. Shirley (ed.), Human Press, Totowa, N.J. (1995); Protein Structure, Stability, and Interactions ( Methods in Molecular Biology ), Shiver J. W. (ed.), Humana Press, New York, N.Y. (2010); and Ignatova, Microb. Cell Fact., 4: 23 (2005).
- an anti-TIM-3 antibody agent can be measured in terms of the transition mid-point value (T m ), which is the temperature where 50% of the amino acid sequence is in its native confirmation, and the other 50% is denatured. In general, the higher the T m , the more stable the protein.
- an inventive TIM-3 binding agent comprises a transition mid-point value (T m ) in vitro of about 60-100° C.
- an anti-TIM-3 antibody agent can comprise a T m in vitro of about 65-80° C. (e.g., 66° C., 68° C., 70° C., 71° C., 75° C., or 79° C.), about 80-90° C. (e.g., about 81° C., 85° C., or 89° C.), or about 90-100° C. (e.g., about 91° C., about 95° C., or about 99° C.).
- the biological activity of a particular TIM-3-binding antibody agent also can be assessed by determining its binding affinity to TIM-3 or an epitope thereof.
- affinity refers to the equilibrium constant for the reversible binding of two agents and is expressed as the dissociation constant (K D ).
- Affinity of a binding agent to a ligand, such as affinity of an antibody for an epitope can be, for example, from about 1 picomolar (pM) to about 100 micromolar ( ⁇ M) (e.g., from about 1 picomolar (pM) to about 1 nanomolar (nM), from about 1 nM to about 1 micromolar ( ⁇ M), or from about 1 ⁇ M to about 100 ⁇ M).
- an anti-TIM-3 antibody agent can bind to an TIM-3 protein with a K D less than or equal to 1 nanomolar (e.g., 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 0.05 nM, 0.025 nM, 0.01 nM, 0.001 nM, or a range defined by any two of the foregoing values).
- 1 nanomolar e.g., 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 0.05 nM, 0.025 nM, 0.01 nM, 0.001 nM, or a range defined by any two of the foregoing values).
- an anti-TIM-3 antibody agent can bind to TIM-3 with a K D less than or equal to 200 pM (e.g., 190 pM, 175 pM, 150 pM, 125 pM, 110 pM, 100 pM, 90 pM, 80 pM, 75 pM, 60 pM, 50 pM, 40 pM, 30 pM, 25 pM, 20 pM, 15 pM, 10 pM, 5 pM, 1 pM, or a range defined by any two of the foregoing values).
- Immunoglobulin affinity for an antigen or epitope of interest can be measured using any art-recognized assay.
- Such methods include, for example, fluorescence activated cell sorting (FACS), separable beads (e.g., magnetic beads), surface plasmon resonance (SPR), solution phase competition (KINEXATM), antigen panning, competitive binding assays, and/or ELISA (see, e.g., Janeway et al. (eds.), Immunobiology, 5th ed., Garland Publishing, New York, N.Y., 2001).
- FACS fluorescence activated cell sorting
- separable beads e.g., magnetic beads
- SPR surface plasmon resonance
- KINEXATM solution phase competition
- antigen panning e.g., antigen panning
- competitive binding assays e.g., Janeway et al. (eds.), Immunobiology, 5th ed., Garland Publishing, New York, N.Y., 2001).
- an anti-TIM-3 antibody agent may be administered alone or in combination with other drugs.
- an anti-TIM-3 antibody agent can be administered in combination with other agents for the treatment or prevention of the diseases disclosed herein, such as agents that are cytotoxic to cancer cells, modulate the immunogenicity of cancer cells, or promote immune responses to cancer cells.
- an anti-TIM-3 antibody agent can be used in combination with at least one other anticancer agent including, for example, any chemotherapeutic agent known in the art, ionization radiation, small molecule anticancer agents, cancer vaccines, biological therapies (e.g., other monoclonal antibodies, cancer-killing viruses, gene therapy, and adoptive T-cell transfer), and/or surgery.
- a subject for treatment with an anti-TIM-3 antibody agent has been treated or will be treated with chemotherapy (e.g., platinum-based chemotherapy).
- a chemotherapeutic agent is actinomycin, all-trans retinoic acid, azacitidine, azathioprine, bleomycin, bortezomib, carboplatin, capecitabine, cisplatin, chlorambucil, cyclophosphamide, cytarabine, daunorubicin, docetaxel, doxifluridine, doxorubicin, epirubicin, epothilone, etoposide, fluorouracil, gemcitabine, hydroxyurea, idarubicin, imatinib, irinotecan, mechlorethamine, mercaptopurine, methotrexate, mitox
- a chemotherapeutic agent is a platinum-based chemotherapeutic agent, such as cisplatin, carboplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin, or satraplatin.
- a chemotherapeutic agent is a folate antimetabolite such as pemetrexed.
- a subject e.g., a mammal, e.g.
- an anti-angiogenic agent for example, bevacizumab, itraconazole, carboxyamidotriazole, TNP-470, fumagillin, CM101, IL-12, platelet factor-4, suramin, SU5416, thrombospondin, angiostatic steroids, heparin, cartilage-derived angiogenesis inhibitory factor (e.g.
- peptide troponin I and chondromodulin I matrix metalloproteinase inhibitor
- angiostatin endostatin
- 2-methoxyestradiol tecogalan
- tetrathiomolybdate thrombospondin
- thalidomide prolactin
- ⁇ V ⁇ 3 inhibitor lenalidomide, linomide, ramucirumab, tasquinimod, ranibizumab, sorafenib, sunitinib, pazopanib, everolimus
- tissue inhibitors of metalloproteases TIMP2
- bFGF soluble receptor transforming growth factor beta, interferon alpha, interferon beta, soluble KDR and FLT-1 receptors, placental proliferin-related protein, pazopanib, sunitinib, sorafenib, axitinib, ponatinib, cabozantinib, regor
- an anti-TIM-3 antibody agent can be used in combination with an anti-inflammatory agent including, for example, corticosteroids (e.g., prednisone and fluticasone) and non-steroidal anti-inflammatory drugs (NSAIDs) (e.g., aspirin, ibuprofen, and naproxen).
- corticosteroids e.g., prednisone and fluticasone
- NSAIDs non-steroidal anti-inflammatory drugs
- an anti-TIM-3 antibody agent is used to treat an infectious disease.
- an anti-TIM-3 antibody agent can be administered in combination with at least one anti-bacterial agent or at least one anti-viral agent.
- the anti-bacterial agent can be any suitable antibiotic known in the art.
- the anti-viral agent can be any vaccine of any suitable type that specifically targets a particular virus (e.g., live-attenuated vaccines, subunit vaccines, recombinant vector vaccines, and small molecule anti-viral therapies (e.g., viral replication inhibitors and nucleoside analogs).
- an anti-TIM-3 antibody agent is used to treat an autoimmune disease.
- an anti-TIM-3 antibody agent can be used in combination with an anti-inflammatory agent including, for example, corticosteroids (e.g., prednisone and fluticasone) and non-steroidal anti-inflammatory drugs (NSAIDs) (e.g., aspirin, ibuprofen, and naproxen).
- corticosteroids e.g., prednisone and fluticasone
- NSAIDs non-steroidal anti-inflammatory drugs
- the TIM-3 binding agent when used to treat cancer or an infectious disease, can be administered in combination with other agents that inhibit immune checkpoint pathways.
- an anti-TIM-3 antibody agent can be administered in combination with agents that inhibit or antagonize the programmed death 1 protein (PD-1), lymphocyte activation gene-3 protein (LAG-3), and/or cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) pathways.
- PD-1 programmed death 1 protein
- LAG-3 lymphocyte activation gene-3 protein
- CTLA-4 cytotoxic T-lymphocyte-associated protein 4
- an inventive TIM-3 binding agent is administered in combination with an agent that inhibits LAG-3 signaling and/or an agent that inhibits PD-1 signaling.
- an inventive TIM-3 binding agent is administered to a subject that has been administered or will be administered an agent that inhibits LAG-3 signaling, such that the subject receives treatment with both.
- an inventive TIM-3 binding agent is administered to a subject that has been administered or will be administered an agent that inhibits PD-1 signaling, such that the subject receives treatment with both.
- a mammal that receives treatment an inventive TIM-3 agent has been or will receive treatment with an agent that inhibits PD-1 and an agent that inhibits LAG-3, such that the mammal receives all three.
- an inventive TIM-3 binding agent is administered in combination with an antibody that binds to LAG-3 and/or an antibody that binds to PD-1.
- anti-PD-1 antibody is an antibody selected from the group consisting of: BGB-A317, BI 754091, IBI308, INCSHR-1210, JNJ-63723283, JS-001, MEDI-0680, MGA-012, nivolumab, PDR001, pembrolizumab, PF-06801591, REGN-2810, TSR-042, and derivatives thereof.
- an agent that inhibits PD-1 is an anti-PD-L1/L2 agent.
- an anti-PD-L1/L2 agent is an anti-PD-L1 antibody.
- an anti-PD-L1 antibody agent is atezolizumab, avelumab, CX-072, durvalumab, FAZ053, LY3300054, PD-L1 millamolecule, or derivatives thereof.
- a subject is receiving or will receive one or more additional therapies in combination with a TIM-3-binding agent.
- an additional therapy is a PARP inhibitor.
- a PARP inhibitor is ABT-767, AZD 2461, BGB-290, BGP 15, CEP 8983, CEP 9722, DR 2313, E7016, E7449, fluzoparib (SHR 3162), IMP 4297, INO1001, JPI 289, JPI 547, monoclonal antibody B3-LysPE40 conjugate, MP 124, niraparib (ZEJULA) (MK-4827), NU 1025, NU 1064, NU 1076, NU1085, olaparib (AZD2281), ONO2231, PD 128763, R 503, R554, rucaparib (RUBRACA) (AG-014699, PF-01367338), SBP 101, SC 101914, Simmiparib, talazo
- a PARP inhibitor is niraparib, olaparib, rucaparib, talazoparib, and veliparib.
- additional therapies include treatment with a composition that delivers an agent that inhibits PD-1 and treatment with a PARP inhibitor such that the subject receives treatment with all three.
- additional therapies include treatment with a composition that delivers an agent that inhibits PD-1, treatment with a composition that delivers an agent that inhibits LAG-3, and treatment with a PARP inhibitor such that the subject receives treatment with all four.
- a method of treating a disorder that is responsive to TIM-3 inhibition (e.g., cancer or an infectious disease) in a mammal can further comprise administering to the mammal a composition comprising (i) an antibody that binds to a TIM-3 protein and (ii) a pharmaceutically acceptable carrier or a composition comprising (i) an antibody that binds to a PD-1 protein and (ii) a pharmaceutically acceptable carrier.
- a composition comprising (i) an antibody that binds to a TIM-3 protein and (ii) a pharmaceutically acceptable carrier or a composition comprising (i) an antibody that binds to a PD-1 protein and (ii) a pharmaceutically acceptable carrier.
- Mammals include, e.g., mice, rats, rabbits, dogs, cats, cows, horses, non-human primates, and humans.
- an anti-TIM-3 antibody agent described herein can be used in diagnostic or research applications.
- an anti-TIM-3 antibody agent can be used in a method to diagnose a disorder or disease in which the improper expression (e.g., overexpression) or increased activity of TIM-3 causes or contributes to the pathological effects of the disease or disorder.
- an anti-TIM-3 antibody agent can be used in an assay to monitor TIM-3 protein levels in a subject being tested for a disease or disorder that is responsive to TIM-3 inhibition.
- Research applications include, for example, methods that utilize an anti-TIM-3 antibody agent and a label to detect a TIM-3 protein in a sample, e.g., in a human body fluid or in a cell or tissue extract.
- an anti-TIM-3 antibody agent t can be used with or without modification, such as covalent or non-covalent labeling with a detectable moiety.
- the detectable moiety can be a radioisotope (e.g., 3 H, 14 C, 32 P, 35 S, or 125 I), a fluorescent or chemiluminescent compound (e.g., fluorescein isothiocyanate, rhodamine, or luciferin), an enzyme (e.g., alkaline phosphatase, beta-galactosidase, or horseradish peroxidase), or prosthetic groups.
- a radioisotope e.g., 3 H, 14 C, 32 P, 35 S, or 125 I
- a fluorescent or chemiluminescent compound e.g., fluorescein isothiocyanate, rhodamine, or luciferin
- an enzyme e.g., alkaline phosphatase, beta-galact
- any method known in the art for separately conjugating an antigen-binding agent (e.g., an antibody) to a detectable moiety may be employed in the context of the invention (see, e.g., Hunter et al., Nature, 194: 495-496 (1962); David et al., Biochemistry, 13: 1014-1021 (1974); Pain et al., J. Immunol. Meth., 40: 219-230 (1981); and Nygren, J. Histochem. and Cytochem., 30: 407-412 (1982)).
- TIM-3 protein levels can be measured using an inventive TIM-3-binding agent by any suitable method known in the art. Such methods include, for example, radioimmunoassay (RIA), and FACS.
- RIA radioimmunoassay
- Normal or standard expression values of TIM-3 can be established using any suitable technique, e.g., by combining a sample comprising, or suspected of comprising, TIM-3 with a TIM-3-specific antibody under conditions suitable to form an antigen-antibody complex.
- the antibody is directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound antibody.
- Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, and radioactive materials (see, e.g., Zola, Monoclonal Antibodies: A Manual of Techniques, CRC Press, Inc. (1987)).
- the amount of TIM-3 polypeptide expressed in a sample is then compared with a standard value.
- An anti-TIM-3 antibody agent can be provided in a kit, e.g., a packaged combination of reagents in predetermined amounts with instructions for performing a diagnostic assay.
- the kit desirably includes substrates and cofactors required by the enzyme (e.g., a substrate precursor which provides a detectable chromophore or fluorophore).
- substrates and cofactors required by the enzyme e.g., a substrate precursor which provides a detectable chromophore or fluorophore.
- other additives may be included in the kit, such as stabilizers, buffers (e.g., a blocking buffer or lysis buffer), and the like.
- the relative amounts of the various reagents can be varied to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay.
- the reagents may be provided as dry powders (typically lyophilized), including excipients which on dissolution will provide a reagent solution having the appropriate concentration
- This example describes particular anti-TIM-3 antibody heavy chain polypeptide and light chain polypeptide sequences and nucleic acids encoding the same.
- An anti-TIM-3 antibody heavy chain polypeptide (SEQ ID NO: 1) EVQLLESGGGLVQPGGSLRLSCAAASGFTFSSYDMSWVRQAPGKGLDW VSTISGGGTYTYYQDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC ASMDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN VDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPP SQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
- sequences above describe an exemplary humanized monoclonal anti-TIM-3 antibody utilizing a human IGHG4*01 heavy chain gene, and a human IGKC*01 kappa light chain gene, as scaffolds.
- the example further describes biophysical and biochemical characterization of this exemplary humanized monoclonal anti-TIM-3 antibody.
- Lys-C and trypsin digested peptides were well separated and detected by on-line LC-MS analysis.
- the disulfide bond linkages were confirmed by comparison of total ion chromatograms in the non-reduced (NR) condition with the reduced condition.
- Disulfide linkages are consistent with the expected disulfide linkage pattern for an IgG4 molecule.
- the residues involved in the expected inter- and intrachain disulfide linkages are tabulated below (Tables 1, 2 and 3).
- anti-TIM-3 mAb HC Cysteine residue Residue (position in ID SEQ ID NO: 1) I 22 II 96 III 127 IV 140 V 196 VI 219 VII 222 VIII 254 IX 314 X 360 XI 418
- anti-TIM-3 mAb LC Cysteine residue Residue (position in ID SEQ ID NO: 2) I 23 II 88 III 134 IV 194 V 214
- This exemplary anti-TIM-3 antibody exhibits an occupied N-glycosylation site at asparagine residue 290 in the CH2 domain of each heavy chain in the mature protein sequence (SEQ ID NO:1).
- the expressed N-glycosylation at this site is a mixture of oligosaccharide species typically observed on IgGs expressed in mammalian cell culture, for example, shown below is the relative abundance of glycan species from a preparation of this exemplary anti-TIM-3 antibody cultured in Chinese Hamster Ovary (CHO) cells (Table 4).
- Glycan Analysis of an anti-TIM-3 antibody binding agent Abundance (% of total Species oligosaccharide) Description of Glycan G0F 20.1% Core fucosylated agalactobiantennary complex-type oligosaccharide G1F 41.9% Core fucosylated monogalactosylated biantennary complex type oligosaccharide G2F 29.0% Core-fucosylated galactosylated biantennary complex type oligosaccharide G2FS1 3.2% Monosialylated core fucosylated galactosylated biantennary complex type oligosaccharide G2FS2 1.2% Disialylated core fucosylated galactosylated biantennary complex type oligosaccharide M5 0.4% Oligomannosidic N-linked oligosaccharide, Man 5 GlcNAc 2
- This example describes binding of an exemplary anti-TIM-3 antibody (having heavy and light chains as set forth in SEQ ID NOs: 1 & 2, respectively) to recombinant TIM-3 polypeptides. Specifically, this example demonstrates high affinity binding of an exemplary antibody to soluble TIM-3 fusions and cell-expressed recombinant TIM-3 as determined using surface plasmon resonance (SPR) and flow cytometry, respectively.
- SPR surface plasmon resonance
- Capture and analyte binding were performed in HBS-EP+ buffer.
- the captured antigen and antibodies were removed between each cycle to ensure a fresh binding surface for each concentration of antigen.
- the resulting sensorgrams were fitted globally using a 1:1 binding model to calculate on- and off-rates (k assoc and k dissoc , respectively), and dissociation constants as a measure of overall affinity (K D ).
- SPR measurements demonstrated that an exemplary anti-TIM-3 antibody bound to both human and cynomolgus monkey TIM-3 with high affinity with K D estimates of 7 and 17 pM, respectively (Table 4). Further binding analyses determined that the exemplary anti-TIM-3 antibody did not substantially bind to human TIM-1 polypeptide or human PD-1 polypeptide (data not shown).
- Flow cytometry studies were performed with CHO-K1 cell line clones in which native human or cynomolgus monkey TIM-3 was stably transfected.
- An exemplary anti-TIM-3 antibody (having heavy and light chains as set forth in SEQ ID NOs: 1 & 2, respectively) was diluted in 3-fold dilutions. Dilutions of exemplary antibody were added to human or cynomolgus monkey TIM-3 expressing CHO-K1 cells (1E5 cells) and incubated on ice. Cells were washed twice and incubated on ice with PE-conjugated goat anti-human IgG4 to detect antibody binding.
- anti-TIM-3 antibodies within the scope of the present invention can specifically bind to TIM-3 polypeptides with high affinity.
- TIM-3 Blockade Enhances T Cell Activation in Exhausted Immune Cells
- This example describes characterization of an exemplary anti-TIM-3 antibody agent in an in vitro T-cell exhaustion model characterized by increased expression of PD-1 and TIM-3 ( FIG. 2A ).
- spleen was removed from MBP-Tracker mice and processed to generate single cell suspension of splenocytes. Cells were resuspended at 3 ⁇ 10 6 /mL and stimulated with WT-MBP or APL-MBP for 72 hours. Following stimulation, T cells were purified by ficoll density gradient and subsequently re-plated at 2 ⁇ 10 6 /mL in 20 U/mL IL-2 for four days.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Oncology (AREA)
- Virology (AREA)
- Communicable Diseases (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Transplantation (AREA)
- Dermatology (AREA)
- Rheumatology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- AIDS & HIV (AREA)
- Tropical Medicine & Parasitology (AREA)
- Pulmonology (AREA)
- Pain & Pain Management (AREA)
- Obesity (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Biotechnology (AREA)
- Orthopedic Medicine & Surgery (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/346,463 US20190284280A1 (en) | 2016-11-01 | 2017-11-01 | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662416131P | 2016-11-01 | 2016-11-01 | |
| US201662427775P | 2016-11-29 | 2016-11-29 | |
| US16/346,463 US20190284280A1 (en) | 2016-11-01 | 2017-11-01 | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| PCT/US2017/059619 WO2018085469A2 (en) | 2016-11-01 | 2017-11-01 | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/059619 A-371-Of-International WO2018085469A2 (en) | 2016-11-01 | 2017-11-01 | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/512,257 Continuation US11753472B2 (en) | 2016-11-01 | 2021-10-27 | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20190284280A1 true US20190284280A1 (en) | 2019-09-19 |
Family
ID=62075645
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/346,463 Abandoned US20190284280A1 (en) | 2016-11-01 | 2017-11-01 | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| US17/512,257 Active US11753472B2 (en) | 2016-11-01 | 2021-10-27 | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) |
| US18/354,395 Abandoned US20230416368A1 (en) | 2016-11-01 | 2023-07-18 | Antibodies Directed Against T Cell Immunoglobulin and Mucin Protein 3 (TIM-3) |
| US19/066,882 Pending US20250368739A1 (en) | 2016-11-01 | 2025-02-28 | Antibodies Directed Against T Cell Immunoglobulin and Mucin Protein 3 (TIM-3) |
Family Applications After (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/512,257 Active US11753472B2 (en) | 2016-11-01 | 2021-10-27 | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) |
| US18/354,395 Abandoned US20230416368A1 (en) | 2016-11-01 | 2023-07-18 | Antibodies Directed Against T Cell Immunoglobulin and Mucin Protein 3 (TIM-3) |
| US19/066,882 Pending US20250368739A1 (en) | 2016-11-01 | 2025-02-28 | Antibodies Directed Against T Cell Immunoglobulin and Mucin Protein 3 (TIM-3) |
Country Status (13)
| Country | Link |
|---|---|
| US (4) | US20190284280A1 (cg-RX-API-DMAC7.html) |
| EP (2) | EP3689419A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2019537438A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20190098741A (cg-RX-API-DMAC7.html) |
| CN (1) | CN110062885A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2017354071A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112019008861A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3041685A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL266230A (cg-RX-API-DMAC7.html) |
| MA (2) | MA50677A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2019005116A (cg-RX-API-DMAC7.html) |
| SG (2) | SG11201903867YA (cg-RX-API-DMAC7.html) |
| WO (1) | WO2018085469A2 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11352427B2 (en) | 2015-04-01 | 2022-06-07 | Anaptysbio, Inc. | Antibodies directed against T Cell immunoglobulin and mucin protein 3 (TIM-3) |
| US11753472B2 (en) | 2016-11-01 | 2023-09-12 | Tesaro, Inc. | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) |
| US11926665B2 (en) | 2017-01-09 | 2024-03-12 | Tesaro, Inc. | Methods of treating cancer with anti-TIM-3 antibodies |
Families Citing this family (52)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9708412B2 (en) | 2015-05-21 | 2017-07-18 | Harpoon Therapeutics, Inc. | Trispecific binding proteins and methods of use |
| US11623958B2 (en) | 2016-05-20 | 2023-04-11 | Harpoon Therapeutics, Inc. | Single chain variable fragment CD3 binding proteins |
| CN109757103B (zh) | 2016-07-14 | 2024-01-02 | 百时美施贵宝公司 | 针对tim3的抗体及其用途 |
| JP2019533458A (ja) * | 2016-11-01 | 2019-11-21 | アナプティスバイオ インコーポレイティッド | プログラム死1(pd−1)に対する抗体 |
| AU2018206481B2 (en) | 2017-01-09 | 2025-02-27 | Tesaro, Inc. | Methods of treating cancer with anti-PD-1 antibodies |
| TW202444417A (zh) | 2017-05-09 | 2024-11-16 | 美商提薩羅有限公司 | 治療癌症的組合療法 |
| EP3621994A4 (en) | 2017-05-12 | 2020-12-30 | Harpoon Therapeutics, Inc. | MESOTHELIN BINDING PROTEINS |
| KR20200005662A (ko) | 2017-05-18 | 2020-01-15 | 테사로, 인코포레이티드 | 암을 치료하기 위한 조합 요법 |
| TWI843707B (zh) | 2017-09-26 | 2024-06-01 | 美商提薩羅有限公司 | 尼拉帕尼(niraparib)調配物 |
| MX2020003770A (es) | 2017-09-30 | 2020-07-29 | Tesaro Inc | Terapias de combinacion para tratar cancer. |
| EA202090655A1 (ru) | 2017-10-06 | 2020-12-07 | Тесаро, Инк. | Комбинированные терапевтические средства и их применение |
| MX2020003915A (es) | 2017-10-13 | 2020-10-08 | Harpoon Therapeutics Inc | Proteinas trispecificas y metodos de uso. |
| IL315737A (en) | 2017-10-13 | 2024-11-01 | Harpoon Therapeutics Inc | B-cell maturation antigen-binding proteins |
| CN112566936B (zh) | 2018-08-21 | 2024-07-12 | 阿尔伯特爱因斯坦医学院 | 针对人tim-3的单克隆抗体 |
| TWI852940B (zh) | 2018-09-04 | 2024-08-21 | 美商泰沙羅公司 | 治療癌症之方法 |
| US12195544B2 (en) | 2018-09-21 | 2025-01-14 | Harpoon Therapeutics, Inc. | EGFR binding proteins and methods of use |
| US10815311B2 (en) | 2018-09-25 | 2020-10-27 | Harpoon Therapeutics, Inc. | DLL3 binding proteins and methods of use |
| JP2022504228A (ja) | 2018-10-03 | 2022-01-13 | テサロ, インコーポレイテッド | ニラパリブ遊離塩基の結晶形態 |
| CN113166071B (zh) | 2018-10-03 | 2025-03-21 | 特沙诺有限公司 | 尼拉帕利盐 |
| AU2019372436A1 (en) * | 2018-11-01 | 2021-05-20 | Merck Patent Gmbh | Methods of administering anti-TIM-3 antibodies |
| WO2020093023A1 (en) * | 2018-11-01 | 2020-05-07 | Merck Patent Gmbh | Anti-tim-3 antibodies |
| KR20210108978A (ko) | 2018-12-21 | 2021-09-03 | 오제 이뮈노테라프틱스 | 이작용성 항-pd-1/il-7 분자 |
| WO2020165374A1 (en) | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
| WO2020239558A1 (en) | 2019-05-24 | 2020-12-03 | Pfizer Inc. | Combination therapies using cdk inhibitors |
| WO2021024020A1 (en) | 2019-08-06 | 2021-02-11 | Astellas Pharma Inc. | Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer |
| WO2021051352A1 (zh) * | 2019-09-19 | 2021-03-25 | 上药生物治疗(香港)有限公司 | 一种分离的抗原结合蛋白及其用途 |
| WO2021122866A1 (en) | 2019-12-17 | 2021-06-24 | Ose Immunotherapeutics | Bifunctional molecules comprising an il-7 variant |
| IL294557A (en) | 2020-01-07 | 2022-09-01 | Univ Texas | Improved human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy |
| CA3169303A1 (en) * | 2020-02-24 | 2021-09-02 | Xiaokun SHEN | Application of poly adp-ribose polymerase inhibitors in corona virus resistance |
| KR20230035576A (ko) | 2020-07-07 | 2023-03-14 | 비온테크 에스이 | Hpv 양성 암 치료용 rna |
| WO2022135667A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Therapeutic rna for treating cancer |
| WO2022135666A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Treatment schedule for cytokine proteins |
| TW202245808A (zh) | 2020-12-21 | 2022-12-01 | 德商拜恩迪克公司 | 用於治療癌症之治療性rna |
| WO2022148781A1 (en) | 2021-01-05 | 2022-07-14 | Institut Curie | Combination of mcoln activators and immune checkpoint inhibitors |
| MX2023011964A (es) | 2021-04-09 | 2024-01-08 | Ose Immunotherapeutics | Nuevo andamio para moléculas bifuncionales con propiedades mejoradas. |
| EP4320156A1 (en) | 2021-04-09 | 2024-02-14 | Ose Immunotherapeutics | Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains |
| CA3225254A1 (en) | 2021-07-13 | 2023-01-19 | BioNTech SE | Multispecific binding agents against cd40 and cd137 in combination therapy for cancer |
| TW202327595A (zh) | 2021-10-05 | 2023-07-16 | 美商輝瑞大藥廠 | 用於治療癌症之氮雜內醯胺化合物的組合 |
| TW202333802A (zh) | 2021-10-11 | 2023-09-01 | 德商拜恩迪克公司 | 用於肺癌之治療性rna(二) |
| WO2023079428A1 (en) | 2021-11-03 | 2023-05-11 | Pfizer Inc. | Combination therapies using tlr7/8 agonist |
| WO2024003360A1 (en) | 2022-07-01 | 2024-01-04 | Institut Curie | Biomarkers and uses thereof for the treatment of neuroblastoma |
| JP2025525886A (ja) | 2022-08-02 | 2025-08-07 | オーエスイー・イミュノセラピューティクス | Cd28に対する多機能性分子 |
| JP2026501506A (ja) | 2022-12-14 | 2026-01-16 | アステラス・ファーマ・ヨーロッパ・ベスローデン・フェンノートシャップ | Cldn18.2及びcd3に結合する二重特異性結合剤並びに免疫チェックポイント阻害剤を含む併用療法 |
| WO2024200820A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Method of synthesis of targeted lipid nanoparticle and uses thereof |
| EP4687991A1 (en) | 2023-03-30 | 2026-02-11 | Ose Immunotherapeutics | Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell enhancing molecule and use thereof |
| TW202541837A (zh) | 2023-12-08 | 2025-11-01 | 日商安斯泰來製藥公司 | 含有結合至cldn18.2和cd3之雙特異性結合劑和穩定或增加cldn18.2表現之藥劑之組合療法 |
| WO2026033885A1 (en) | 2024-08-08 | 2026-02-12 | Astellas Pharma Inc. | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2 |
| WO2025120867A1 (en) | 2023-12-08 | 2025-06-12 | Astellas Pharma Inc. | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies |
| WO2025120866A1 (en) | 2023-12-08 | 2025-06-12 | Astellas Pharma Inc. | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2 |
| WO2025242836A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of auto-immune or inflammatory diseases and disorders |
| WO2025242835A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of cancer |
| WO2026068705A1 (en) | 2024-09-26 | 2026-04-02 | Ose Immunotherapeutics | Lipid-based nanoparticles comprising non-glycosylated fc domains and uses thereof |
Family Cites Families (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4828981A (en) | 1983-08-24 | 1989-05-09 | Synbiotics Corporation | Immunoassays for determining Dirofilaria immitis infection using antiidiotype monoclonal antibody reagents |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| IE913929A1 (en) | 1990-11-13 | 1992-05-20 | Immunex Corp | Bifunctional selectable fusion genes |
| AU6953394A (en) | 1993-05-21 | 1994-12-20 | Targeted Genetics Corporation | Bifunctional selectable fusion genes based on the cytosine deaminase (cd) gene |
| US5464758A (en) | 1993-06-14 | 1995-11-07 | Gossen; Manfred | Tight control of gene expression in eucaryotic cells by tetracycline-responsive promoters |
| US5814618A (en) | 1993-06-14 | 1998-09-29 | Basf Aktiengesellschaft | Methods for regulating gene expression |
| US6843987B2 (en) | 2000-02-02 | 2005-01-18 | Schering Corporation | Mammalian cytokines; receptors; related reagents and methods |
| FR2814642B1 (fr) | 2000-10-03 | 2005-07-01 | Ass Pour Le Dev De La Rech En | Souris transgenique pour la recombinaison ciblee mediee par la cre-er modifiee |
| US20030103985A1 (en) | 2001-05-18 | 2003-06-05 | Boehringer Ingelheim International Gmbh | Cytotoxic CD44 antibody immunoconjugates |
| US7771951B2 (en) | 2001-12-03 | 2010-08-10 | Amgen Fremont Inc. | Antibody categorization based on binding characteristics |
| US7470428B2 (en) | 2002-01-30 | 2008-12-30 | The Brigham And Women's Hospital, Inc. | Compositions and methods related to TIM-3, a Th1-specific cell surface molecule |
| US20030229910A1 (en) | 2002-04-17 | 2003-12-11 | Richard Metz | Short fragment homologous replacement to provide BSE resistant cattle |
| GB0317466D0 (en) * | 2003-07-25 | 2003-08-27 | Univ Sheffield | Use |
| US20060134105A1 (en) | 2004-10-21 | 2006-06-22 | Xencor, Inc. | IgG immunoglobulin variants with optimized effector function |
| DK2439273T3 (da) | 2005-05-09 | 2019-06-03 | Ono Pharmaceutical Co | Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika |
| US7824681B2 (en) * | 2005-08-16 | 2010-11-02 | The United States Of America As Represented By The Department Of Health And Human Services | Human monoclonal antibodies that specifically bind IGF-II |
| EP2046833B9 (en) * | 2006-07-14 | 2014-02-19 | AC Immune S.A. | Humanized antibody against amyloid beta |
| MY153248A (en) * | 2006-07-14 | 2015-01-29 | Ac Immune Sa | Humanized antibody against amyloid beta |
| WO2008033333A2 (en) | 2006-09-08 | 2008-03-20 | Amgen Inc. | Il-1 family variants |
| JP4611444B2 (ja) | 2007-01-10 | 2011-01-12 | イステイチユート・デイ・リチエルケ・デイ・ビオロジア・モレコラーレ・ピ・アンジエレツテイ・エツセ・ピー・アー | ポリ(adp−リボース)ポリメラーゼ(parp)阻害剤としてのアミド置換インダゾール |
| US20090075378A1 (en) | 2007-02-20 | 2009-03-19 | Anaptysbio, Inc. | Somatic hypermutation systems |
| BR122017025062B8 (pt) | 2007-06-18 | 2021-07-27 | Merck Sharp & Dohme | anticorpo monoclonal ou fragmento de anticorpo para o receptor de morte programada humano pd-1, polinucleotídeo e composição compreendendo o referido anticorpo ou fragmento |
| KR101653548B1 (ko) | 2008-01-08 | 2016-09-02 | 머크 샤프 앤드 돔 리미티드 | 2-{4-[(3s)-피페리딘-3-일]페닐}-2h-인다졸-7-카복스아미드의 약제학적으로 허용되는 염 |
| EP2262837A4 (en) | 2008-03-12 | 2011-04-06 | Merck Sharp & Dohme | PD-1 BINDING PROTEINS |
| US8012714B2 (en) * | 2008-04-14 | 2011-09-06 | Innovative Targeting Solutions, Inc. | Sequence diversity generation in immunoglobulins |
| KR20110048536A (ko) | 2008-08-28 | 2011-05-11 | 와이어쓰 엘엘씨 | 자가면역 질병에서 il-22, il-17 및 il-1 패밀리 시토킨의 용도 |
| AU2011262758B8 (en) | 2010-06-11 | 2014-09-04 | Kyowa Kirin Co., Ltd. | Anti-tim-3 antibody |
| WO2011159877A2 (en) | 2010-06-18 | 2011-12-22 | The Brigham And Women's Hospital, Inc. | Bi-specific antibodies against tim-3 and pd-1 for immunotherapy in chronic immune conditions |
| WO2013006490A2 (en) | 2011-07-01 | 2013-01-10 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
| WO2013016220A1 (en) | 2011-07-22 | 2013-01-31 | Amgen Inc. | Il-17 receptor a is required for il-17c biology |
| CA2843158A1 (en) | 2011-08-26 | 2013-03-07 | Merrimack Pharmaceuticals, Inc. | Tandem fc bispecific antibodies |
| SI3536710T1 (sl) | 2011-11-16 | 2026-04-30 | Boehringer Ingelheim International Gmbh | Protitelesa proti IL-36R |
| WO2013098420A1 (en) | 2011-12-28 | 2013-07-04 | Immunoqure Ag | Method of isolating human antibodies |
| KR101704893B1 (ko) | 2012-06-15 | 2017-02-08 | 화이자 인코포레이티드 | Gdf-8에 대한 개선된 길항물질 항체 및 그의 용도 |
| WO2014165115A1 (en) | 2013-03-12 | 2014-10-09 | Decimmune Therapeutics, Inc. | Humanized anti-n2 antibodies |
| US9896513B2 (en) * | 2013-03-15 | 2018-02-20 | Novo Nordisk A/S | Antibodies capable of specifically binding two epitopes on tissue factor pathway inhibitor |
| SMT202100065T1 (it) | 2013-05-02 | 2021-03-15 | Anaptysbio Inc | Anticorpi diretti contro la proteina della morte programmata (pd-1) |
| HUE045065T2 (hu) * | 2014-01-31 | 2019-12-30 | Novartis Ag | TIM-3 antitest molekulák és felhasználásaik |
| KR102442436B1 (ko) | 2014-03-14 | 2022-09-15 | 노파르티스 아게 | Lag-3에 대한 항체 분자 및 그의 용도 |
| GB201419094D0 (en) | 2014-10-27 | 2014-12-10 | Agency Science Tech & Res | Anti-TIM-3-antibodies |
| SI3215532T1 (sl) * | 2014-11-06 | 2020-02-28 | F. Hoffmann-La Roche Ag | Protitelesa proti TIM3 in postopki uporabe |
| GB201421430D0 (en) | 2014-12-02 | 2015-01-14 | Medimmune Llc | Antibodies to Adam17 and uses thereof |
| MA41463A (fr) | 2015-02-03 | 2017-12-12 | Anaptysbio Inc | Anticorps dirigés contre le gène d'activation 3 des lymphocytes (lag-3) |
| FI3277321T3 (fi) | 2015-04-01 | 2024-10-31 | Anaptysbio Inc | T-soluimmunoglobuliinia ja musiiniproteiini 3:a (tim-3) vastaan suunnattuja vasta-aineita |
| NZ775762A (en) | 2015-06-05 | 2025-02-28 | Genentech Inc | Anti-tau antibodies and methods of use |
| HRP20211058T8 (hr) | 2015-07-29 | 2021-11-26 | Novartis Ag | Kombinirane terapije koje sadrže molekule antitijela protiv lag-3 |
| PE20181326A1 (es) * | 2015-11-03 | 2018-08-20 | Janssen Biotech Inc | Anticuerpos que se unen especificamente a pd-1 y sus usos |
| AR108377A1 (es) * | 2016-05-06 | 2018-08-15 | Medimmune Llc | Proteínas de unión biespecíficas y sus usos |
| SG11201811564QA (en) | 2016-06-29 | 2019-01-30 | Tesaro Inc | Methods of treating ovarian cancer |
| US11203637B2 (en) | 2016-08-26 | 2021-12-21 | Beigene, Ltd. | Anti-Tim-3 antibodies and use thereof |
| MX2019005116A (es) | 2016-11-01 | 2019-11-12 | Anaptysbio Inc | Anticuerpos dirigidos contra la proteina de inmunoglobulina de linfocitos t y de mucina 3 (tim-3). |
| WO2018129553A1 (en) | 2017-01-09 | 2018-07-12 | Tesaro, Inc. | Methods of treating cancer with anti-tim-3 antibodies |
| AR111651A1 (es) | 2017-04-28 | 2019-08-07 | Novartis Ag | Conjugados de anticuerpos que comprenden agonistas del receptor de tipo toll y terapias de combinación |
-
2017
- 2017-11-01 MX MX2019005116A patent/MX2019005116A/es unknown
- 2017-11-01 BR BR112019008861-0A patent/BR112019008861A2/pt not_active IP Right Cessation
- 2017-11-01 EP EP20150611.0A patent/EP3689419A1/en not_active Withdrawn
- 2017-11-01 CN CN201780075954.0A patent/CN110062885A/zh active Pending
- 2017-11-01 SG SG11201903867YA patent/SG11201903867YA/en unknown
- 2017-11-01 SG SG10201913308PA patent/SG10201913308PA/en unknown
- 2017-11-01 AU AU2017354071A patent/AU2017354071A1/en not_active Abandoned
- 2017-11-01 EP EP17867255.6A patent/EP3535586A4/en not_active Withdrawn
- 2017-11-01 CA CA3041685A patent/CA3041685A1/en not_active Abandoned
- 2017-11-01 WO PCT/US2017/059619 patent/WO2018085469A2/en not_active Ceased
- 2017-11-01 US US16/346,463 patent/US20190284280A1/en not_active Abandoned
- 2017-11-01 MA MA050677A patent/MA50677A/fr unknown
- 2017-11-01 MA MA046113A patent/MA46113A/fr unknown
- 2017-11-01 JP JP2019522850A patent/JP2019537438A/ja not_active Withdrawn
- 2017-11-01 KR KR1020197015227A patent/KR20190098741A/ko not_active Ceased
-
2019
- 2019-04-24 IL IL266230A patent/IL266230A/en unknown
-
2021
- 2021-10-27 US US17/512,257 patent/US11753472B2/en active Active
-
2023
- 2023-07-18 US US18/354,395 patent/US20230416368A1/en not_active Abandoned
-
2025
- 2025-02-28 US US19/066,882 patent/US20250368739A1/en active Pending
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11352427B2 (en) | 2015-04-01 | 2022-06-07 | Anaptysbio, Inc. | Antibodies directed against T Cell immunoglobulin and mucin protein 3 (TIM-3) |
| US11753472B2 (en) | 2016-11-01 | 2023-09-12 | Tesaro, Inc. | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) |
| US11926665B2 (en) | 2017-01-09 | 2024-03-12 | Tesaro, Inc. | Methods of treating cancer with anti-TIM-3 antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| IL266230A (en) | 2019-06-30 |
| JP2019537438A (ja) | 2019-12-26 |
| AU2017354071A1 (en) | 2019-05-23 |
| MX2019005116A (es) | 2019-11-12 |
| SG10201913308PA (en) | 2020-02-27 |
| SG11201903867YA (en) | 2019-05-30 |
| US11753472B2 (en) | 2023-09-12 |
| WO2018085469A2 (en) | 2018-05-11 |
| US20220169734A1 (en) | 2022-06-02 |
| US20230416368A1 (en) | 2023-12-28 |
| WO2018085469A3 (en) | 2018-07-26 |
| EP3535586A2 (en) | 2019-09-11 |
| MA46113A (fr) | 2019-07-10 |
| EP3535586A4 (en) | 2020-08-05 |
| CN110062885A (zh) | 2019-07-26 |
| BR112019008861A2 (pt) | 2019-07-09 |
| MA50677A (fr) | 2021-07-14 |
| KR20190098741A (ko) | 2019-08-22 |
| EP3689419A1 (en) | 2020-08-05 |
| US20250368739A1 (en) | 2025-12-04 |
| CA3041685A1 (en) | 2018-05-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11753472B2 (en) | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) | |
| US20220089739A1 (en) | Antibodies Directed Against Programmed Death-1 (PD-1) | |
| US20230331843A1 (en) | Antibodies Directed Against Programmed Death-1(PD-1) | |
| EP3277321B1 (en) | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) | |
| CA3016894A1 (en) | Gitr antibodies, methods, and uses | |
| TW201825512A (zh) | 針對計劃性死亡-1(pd-1)之抗體 | |
| TW201825513A (zh) | 針對t細胞免疫球蛋白及黏蛋白3(tim-3)之抗體 | |
| HK40009966A (en) | Antibodies directed against programmed death- 1 (pd-1) | |
| HK40045115A (en) | Antibodies directed against programmed death-1 (pd-1) | |
| HK1219743B (en) | Antibodies directed against programmed death-1 (pd-1) | |
| HK1242616B (en) | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) | |
| BR112015026823B1 (pt) | Anticorpo da proteína de morte-1 programada (pd-1) isolada, composição compreendendo o mesmo e uso da composição | |
| HK1242616A1 (en) | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| AS | Assignment |
Owner name: TESARO, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GHOSH, SRIMOYEE;HUANG, BAOCHUAN;SIGNING DATES FROM 20200923 TO 20201116;REEL/FRAME:054388/0268 Owner name: ANAPTYSBIO, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KING, DAVID J.;KEHRY, MARILYN;SIGNING DATES FROM 20200920 TO 20200921;REEL/FRAME:054388/0318 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |