US20170318843A1 - Enzymes for malting - Google Patents

Enzymes for malting Download PDF

Info

Publication number
US20170318843A1
US20170318843A1 US15/524,603 US201515524603A US2017318843A1 US 20170318843 A1 US20170318843 A1 US 20170318843A1 US 201515524603 A US201515524603 A US 201515524603A US 2017318843 A1 US2017318843 A1 US 2017318843A1
Authority
US
United States
Prior art keywords
seq
cereal
xylanase
glucanase
activity
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/524,603
Other languages
English (en)
Inventor
Charlotte Horsmans Poulsen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
DuPont Nutrition Biosciences ApS
Original Assignee
DuPont Nutrition Biosciences ApS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by DuPont Nutrition Biosciences ApS filed Critical DuPont Nutrition Biosciences ApS
Assigned to DUPONT NUTRITION BIOSCIENCES APS reassignment DUPONT NUTRITION BIOSCIENCES APS ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: POULSEN, CHARLOTTE HORSMANS
Publication of US20170318843A1 publication Critical patent/US20170318843A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12C—BEER; PREPARATION OF BEER BY FERMENTATION; PREPARATION OF MALT FOR MAKING BEER; PREPARATION OF HOPS FOR MAKING BEER
    • C12C1/00—Preparation of malt
    • C12C1/02—Pretreatment of grains, e.g. washing, steeping
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L7/00—Cereal-derived products; Malt products; Preparation or treatment thereof
    • A23L7/20—Malt products
    • A23L7/25—Fermentation of cereal malt or of cereal by malting
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L7/00—Cereal-derived products; Malt products; Preparation or treatment thereof
    • A23L7/20—Malt products
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12C—BEER; PREPARATION OF BEER BY FERMENTATION; PREPARATION OF MALT FOR MAKING BEER; PREPARATION OF HOPS FOR MAKING BEER
    • C12C5/00—Other raw materials for the preparation of beer
    • C12C5/004—Enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405—Glucanases
    • C12N9/2434—Glucanases acting on beta-1,4-glucosidic bonds
    • C12N9/244—Endo-1,3(4)-beta-glucanase (3.2.1.6)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2477—Hemicellulases not provided in a preceding group
    • C12N9/248—Xylanases
    • C12N9/2482—Endo-1,4-beta-xylanase (3.2.1.8)
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs

Definitions

  • Malting is the process of converting barley and other cereals into malt, typically, for use in brewing, distilling, or in foods.
  • the malting process allows the grain to partially germinate, making the seed's resources available.
  • malting grains develops the enzymes required to modify the grain's starches into sugars, as well as other enzymes, such as proteases, which break down the proteins in the grain into forms that can be used by the fermenting host.
  • malting process starts with drying the grains to a moisture content below 14%, and then storing for around six weeks to overcome seed dormancy.
  • the moisture content of cereals is raised by steeping in water several times over a time period, usually several days, to allow the grain to absorb moisture and to start to sprout or germinate.
  • the grain has a moisture content of around 46%, it is transferred to the germination floor, where the grain is allowed to germinate. The grain at this point is called “green malt”. The green malt is then kilned to the desired specification.
  • the present disclosure provides compositions and processes for the preparation of malted cereals.
  • compositions and methods are set forth in the following separately numbered paragraphs.
  • a method of producing malted cereal comprising:
  • the method further comprises adding to the cereal an effective amount of a xylanase.
  • the method comprises a steeping step including one or more wetting stages, where the ⁇ -glucanase and/or the xylanase are added one or more times during the one or more of wetting stages.
  • the ⁇ -glucanase and/or the xylanase are added at the beginning of the first wetting of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added during the first wetting of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added at the beginning of the second wetting of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added during the second wetting of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added at the beginning of the third wetting of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added during the third wetting of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added at the beginning of all wetting stages of the cereal.
  • the ⁇ -glucanase and/or the xylanase are added during all wetting stages of the cereal.
  • the one or more wetting stages comprise spraying the cereal and where the ⁇ -glucanase and/or the xylanase are added one or more times, or constantly, during the spraying.
  • the ⁇ -glucanase and/or the xylanase are added after a desired temperature has been reached.
  • the cereal reaches a moisture content of between about 40 to about 50% W/W.
  • the moisture content is reached in less than 12 hours.
  • the moisture content is reached with at least 10% less water than the water used for a malted cereal prepared without the ⁇ -glucanase and/or the xylanase.
  • the cereal has 1-10% W/W of ⁇ -glucans.
  • the cereal has 1-10% W/W of arabinoxylans.
  • the amount of high molecular weight ⁇ -glucans in the cereal is decreased at least 50%.
  • the amount of high molecular weight ⁇ -glucans in the cereal is decreased at least 80%.
  • the cereal is selected from the group consisting of barley, wheat, rye, corn, oats, rice, millet, triticale, cassava, sorghum and a combination thereof.
  • the ⁇ -glucanase is dosed at 0.01-100 mg enzyme protein per kilogram of cereal.
  • the ⁇ -glucanase is dosed at 1-15 mg enzyme protein per kilogram of cereal.
  • the xylanase is dosed at 0.01-100 mg enzyme protein per kilogram of cereal.
  • the xylanase is dosed at 1-15 mg enzyme protein per kilogram of cereal.
  • the ⁇ -glucanase is an endo-1,3(4)- ⁇ -glucanase.
  • the endo-1,3(4)- ⁇ -glucanase enzyme comprises an amino acid sequence having at least 80% identity with any one selected from SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, and SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, or any functional fragment thereof
  • the xylanase is an endo-1,4- ⁇ -xylanase.
  • the endo-1,4- ⁇ -xylanase enzyme comprises an amino acid sequence having at least 80% identity with any one selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:17, and SEQ ID NO:18, or any functional fragment thereof.
  • the ⁇ -glucanase and the xylanase have an amino acid sequence having at least 80% sequence identity with the respective SEQ ID, or any functional fragment thereof, being selected from the list consisting of SEQ ID NO:1 and SEQ ID NO:7; SEQ ID NO:2 and SEQ ID NO:7; SEQ ID NO:3 and SEQ ID NO:7; SEQ ID NO:4 and SEQ ID NO:7; SEQ ID NO:5 and SEQ ID NO:7; SEQ ID NO:6 and SEQ ID NO:7; SEQ ID NO:17 and SEQ ID NO:7; SEQ ID NO:18 and SEQ ID NO:7; SEQ ID NO:1 and SEQ ID NO:8; SEQ ID NO:2 and SEQ ID NO:8; SEQ ID NO:3 and SEQ ID NO:8; SEQ ID NO:4 and SEQ ID NO:8; SEQ ID NO:5 and SEQ ID NO:8; SEQ ID NO:6 and
  • the ⁇ -glucanase and the xylanase have an amino acid sequence having at least 80% sequence identity with the respective SEQ ID, or any functional fragment thereof, being selected from the list consisting of SEQ ID NO:1 and SEQ ID NO:7; SEQ ID NO:2 and SEQ ID NO:8; and SEQ ID NO:2 and SEQ ID NO:8.
  • the xylanase and the beta-glucanase are combined at a ratio of 1:1 per weight.
  • the beta-glucanase has a beta-glucanase activity of at least 9000 U/g, and the xylanase has a xylanase activity of at least 13000 U/g.
  • the ⁇ -glucanase and the xylanase comprises commercially available enzymes having xylanase activity and/or beta-glucanase activity selected from the group consisting of UltraFlo L (available from Novozymes-beta glucanase with cellulase, xylanase side activities), UltraFlo XL (available from Novozymes-beta glucanase with xylanase and alpha amylase side activities), UltraFlo Max (available from Novozymes-beta glucanase and xylanase), Finizyme 250 L(available from Novozymes-beta glucanase with cellulase, xylanase side activities) and Filtrase series(available from DSM-betaglucanase and xylanases).
  • UltraFlo L available from Novozymes-beta glucanase with cellulase, xylan
  • a total steeping time is at least 10% less than the time of a malted cereal prepared without the ⁇ -glucanase and/or the xylanase.
  • a total steeping time does not exceed 25 hours.
  • a total steeping time does not exceed 12 hours.
  • a total amount of water used during the steeping process is at least 10% less than the water used for a malted cereal prepared without the ⁇ -glucanase and/or the xylanase.
  • the amount of high molecular weight ⁇ -glucans in the malted cereal is at least 10% less than the amount of high molecular weight ⁇ -glucans in a malted cereal prepared without the ⁇ -glucanase.
  • the amount of high molecular weight arabinoxylans is at least 10% less than the amount of arabinoxylans in a malted cereal prepared without the xylanase.
  • the amount of high molecular weight ⁇ -glucans and arabinoxylans is at least 50% less than the amount of ⁇ -glucans and/or arabinoxylans in a malted cereal prepared without the ⁇ -glucanase and/or the xylanase.
  • the amount of high molecular weight ⁇ -glucans in the malted cereal is 50 mg/l or less, and the amount of arabinoxylans in the malted cereal is at 2000 mg/l or less.
  • an extract prepared from the malted cereal has lower viscosity that an extract prepared with a malted cereal prepared without the ⁇ -glucanase and/or the xylanase.
  • the malted cereal has increased enzymatic activity.
  • the enzymatic activity is increased by a factor of at least about 2 as compared to a malted cereal prepared without the ⁇ -glucanase and/or the xylanase.
  • the enzymatic activity is selected from the group consisting of ⁇ -glucanase activity, xylanase activity, amylase activity, protease activity, naturally occurring enzyme activity in the cereal and combinations thereof.
  • FIG. 1 shows a schematic representation of the malting process. Enzymes described herein can be added one or more times, or constantly, during one or more step of the process.
  • the present disclosure provides compositions and processes for the preparation of malted cereals, e.g., for the use in production of food and beverages.
  • the present invention provides methods and compositions for improved preparation of malted cereals, e.g., reduced water consumption and/or germination time.
  • the present invention provides methods and compositions for improved preparation of malted cereals having higher enzymatic activity.
  • the present invention provides methods and compositions for improved preparation of malted cereals which improve the processes for food and beverage production, and malted cereals that may improve the properties of said obtained food and beverages.
  • the present invention is directed to composition and methods for the preparation of malted cereals comprising adding one or more enzymes to the malting process.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a cell wall degrading enzyme alone or in combination with other enzymes at some point during the malting process.
  • the cell wall degrading enzyme is a xylanase or a beta glucanase.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase alone or in combination with other enzymes at some point during the malting process.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a xylanase alone or in combination with other enzymes at some point during the malting process.
  • the other enzymes are other cell wall degrading enzymes.
  • the invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase and a xylanase alone or in combination with other enzymes during the malting process.
  • Examples of cereals that can be used in the methods described herein include but are not limited to barley, wheat, rye, corn, oats, rice, millet triticale, cassava, sorghum and the like.
  • Cereals such as barley, wheat, rye, corn, oats, rice, millet triticale, cassava, and sorghum, used in the production of food and beverages (e.g. beer) contain varying levels of ⁇ -glucans and arabinoxylans.
  • (1,3;1,4)- ⁇ -D-Glucans consist of unbranched and unsubstituted chains of (1,3)- and (1,4)- ⁇ -glucosyl residues.
  • the (1,3;1,4)- ⁇ -D-glucans are most abundant in cell walls of the cereals, specifically in the starchy endosperm of grain, where they can contribute up to 70% by weight of the cell walls in barley, rye, and oats.
  • Arabinoxylan is a hemicellulose found in both the primary and secondary cell walls of cereal grains, consisting of copolymers of two pentose sugars-arabinose and xylose. The arabinose moiety may be further substituted.
  • ⁇ -glucans and arabinoxylans in the cell wall might be related with grain hardness as well as water uptake of the cereals (e.g. barley). Kernel hardness is one of the major factors affecting the processing and product quality of the grain. A high ⁇ -glucans and arabinoxylans content in the cereal may lead to insufficient degradation of cell walls, which in turns hinders the diffusion of germination enzymes and the mobilization of kernel reserves, and hence reduces the malt extract. Further studies have suggested that that residual ⁇ -glucans may lead to highly viscous wort, giving rise to filtration problems, and it may participate in causing chill haze.
  • the present invention provides compositions and methods to break down betaglucans and other cell wall components such as arabinoxylans in the grains during the malting process.
  • betaglucans and other cell wall components e.g., arabinoxylans
  • the present invention allows for usage of less water during the malting process by decreasing the water binding capacity of beta-glucans and arabinoxylans in the cell wall of the grain while allowing a better and faster water uptake by the grain.
  • the present invention allows for better diffusion of one or more enzymes in the cereal and for better substrate accessibility for said enzymes.
  • the present invention provides composition and methods to decrease the amount of water needed during malting (e.g. for steeping).
  • the present invention provides composition and methods to improve the water uptake by the grain.
  • the present invention provides composition and methods to decrease the time needed for steeping and the time needed to cause the grains to germinate.
  • the present invention provides methods and compositions for improved preparation of malted cereals having higher enzymatic activity.
  • the preparation process of malted cereals comprises the following steps: a steeping step including one or more wetting stages, a germination step, a drying step (e g kilning) including one or more temperature, and one or more enzymes as described herein which are added one or more times during the process. In some embodiments, the same or different one or more enzymes are added in one or more of the wetting stages of the steeping process.
  • the invention further provides composition and methods for improved preparation of malted cereals having higher enzymatic activity (e.g. betaglucanase and xylanase activity), which can then improve downstream processes for food and beverage production (e.g. easier and more effective processing of the malt in wort and beer production).
  • the invention provides enzymes suitable for the production of food and beverage products, such as in the production of an alcoholic or non-alcoholic beverage, such malt-based beverage like beer or whiskey, malted shakes, malt vinegar, flavored drinks such as Malta, Horlicks, Ovaltine and Milo, and in the production of confections such as Maltesers and Whoppers, and some baked goods, such as malt loaf, bagels and rich tea biscuits.
  • the improved properties of the malted cereals comprise e.g. improved temperature optimums, improved ratio in activity on soluble (WE-AX) to insoluble (WU-AX) arabinoxylan substrates, reduced total pressure built up during mash separation and/or filtration steps of a brewing process, as well as increased filterability of enzyme treated material.
  • beverage and “beverage(s) product” includes such foam forming fermented beverages as beer brewed with 100% malt, beer brewed under different types of regulations, ale, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, non-alcoholic malt liquor and the like.
  • the term “beverages” or “beverages product” also includes non-foaming beer and alternative malt beverages such as fruit flavored malt beverages, e. g. , citrus flavored, such as lemon-, orange-, lime-, or berry-flavored malt beverages, liquor flavored malt beverages, e. g. , vodka-, rum-, or tequila-flavored malt liquor, or coffee flavored malt beverages, such as caffeine-flavored malt liquor, and the like.
  • Beer is traditionally referred to as an alcoholic beverage derived from malt, such as malt derived from barley grain, and optionally adjunct, such as starch containing plant material (e.g. cereal grains) and optionally flavored, e.g. with hops.
  • adjunct such as starch containing plant material (e.g. cereal grains) and optionally flavored, e.g. with hops.
  • the term “beer” includes any fermented wort, produced by fermentation/brewing of a starch-containing plant material, thus in particular beer produced from malt and beer produced from any combination of malt and adjunct. Beer can be made from a variety of starch-containing plant material by essentially the same process, where the starch consists mainly of glucose homopolymers in which the glucose residues are linked by alpha-1, 4- or alpha-1,6-bonds, with the former predominating.
  • breeding or “germinate” or any other equivalent as used herein means the beginning or resumption of growth by a seed. In accordance with the processes described herein, germination begins to occur during and/or after the cereal has been steeped. Germination of cereals is generally understood to mean hydration of the seed, swelling of the cereal and inducing growth of the embryo. Environmental factors affecting germination include moisture, temperature and oxygen level. A rapid increase in cells of the root stem leads to root development, while corresponding growth sends forth a shoot.
  • wetting refers to wetting of the cereal.
  • Wetting may include one or more stages over a time and temperature effective for providing a moisture content desired for a malting process, e.g., between about 20% and about 60% by weight, or between 40% to about 50%.
  • Wetting may also including constant spraying of the cereal, or spraying at one or more stages during the malting process (e.g., during the germination step).
  • the present invention is directed to composition and methods for the preparation of malted cereals comprising adding one or more enzymes to the malting process.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase and/or a xylanase alone or in combination with other enzymes during the malting process.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase alone or in combination with other enzymes during the malting process.
  • the enzyme for the methods and compositions described herein may have cellulolytic activity.
  • the systematic name of cellulose is (1,3;1,4)-beta-D-glucan. 4-glucanohydrolase and cellulolytic enzymes or cellulases are classified in EC 3.2.1.4. Cellulases endohydrolyse (1 4)- beta- D-glucosidic linkages (in, e.g., cellulose, and lichenin), beta-D-glucans, and will also hydrolyse 1,4-linkages in ⁇ -D-glucans (also containing 1,3-linkages).
  • Cellulase also have other names such as endo-1,4-beta-D-glucanase, beta-1,4-glucanase, beta-1,4-endoglucan hydrolase, cellulase A, cellulosin AP, endoglucanase D, alkali cellulose, cellulase A 3, celludextrinase, 9.5 cellulase, avicelase, pancellase SS and 1,4-(1,3;1,4)-beta-D-glucan 4-glucanohydrolase.
  • the cellulase activity of the enzyme composition according to the invention can be measured by the cellulase activity assays as described herein or by any feasible method known in the art.
  • the present invention relates to enzymes having endo-1,3(4)-beta-glucanase activity, which can be determined by the assays described herein or by any feasible method known in the art.
  • ⁇ -glucanase or “beta-glucanase” as used herein refers to an endo-1,3(4)-beta-glucanase of EC 3.2.1.6.
  • ⁇ -glucanases catalyze the endohydrolysis of (1 ⁇ 3)- or (1 ⁇ 4)-linkages in beta-D-glucans.
  • Suitable beta-glucanases to be used alone or in combination with one or more cell wall degrading enzyme includes any one betaglucanase disclosed in WO2004087889, WO2005059084, WO9414953, WO2007056321, WO9531533, WO08023060, WO2005100582, WO9828410, WO9742301, WO2006066582, WO05118769, WO2005003319, and WO10059424.
  • standard assays are carried out at pH 5.0, however, the assays can be performed at different pH values for the additional characterization and specification of enzymes.
  • One unit of endo-1,3(4)-beta-glucanase activity is defined as the amount of enzyme which produces 1 ⁇ mole glucose equivalents per minute under the conditions of the assay (e.g., pH 5.0 (or as specified) and 50° C.).
  • the enzyme for the methods and compositions described herein comprises ⁇ -glucanase activity of at least about 10000 U/g, such as at least about 12000 U/g, such as at least about 14000 U/g, such as at least about 15000 U/g, such as at least about 18000 U/g as measured by the assays described herein or by any feasible method known in the art.
  • a different ⁇ -glucanase activity is used depending of the ⁇ -glucan content in the cereal and/or the malting conditions and/or the malted cereal requirements.
  • the enzyme for the methods and compositions described herein has laminarinase activity or comprises any one or more further enzyme having laminarinase activity.
  • the laminarinase activity can be determined as described in the laminarase assays herein or by any feasible method known in the art.
  • Laminarinase may be an endo-1,3(4)-beta-glucanase classified in E.C. 3.2.1.6 or glucan endo-1,3-beta-D-glucosidase classified in E.C. 3.2.1.39.
  • Endo-1,3(4)-beta-glucanase with the alternative names, laminarinase, endo-1,3-beta-glucanase.
  • Endo-1,4-beta-glucanase is classified in E.C. 3.2.1.6.
  • the substrates include laminarin, lichenin and cereal D-glucans.
  • the enzyme catalyzes endohydrolysis of (1 ⁇ 3)- or (1 ⁇ 4)-linkages in beta-D-glucans when the glucose residue whose reducing group is involved in the linkage to be hydrolyzed is itself substituted at C-3.
  • Glucan endo-1,3-beta-D-glucosidase with the alternative names (1 ⁇ 3)-beta-glucan endohydrolase, Endo-1,3-beta-glucanase and laminarinase is classified in E.C. 3.2.1.39.
  • Glucan endo-1,3-beta-D-glucosidase hydrolyses (1 ⁇ 3)-beta-D-glucosidic linkages in (1 ⁇ 3)-beta-D-glucans in substrates as e.g. laminarin, paramylon and pachyman.
  • the enzyme for the methods and compositions described herein has xyloglucan-specific exo-beta-1,4-glucanase activity or comprises a further enzyme having xyloglucan-specific exo-beta-1,4-glucanase activity
  • xyloglucan-specific exo-beta-1,4-glucanase refers to enzymes of E.C3.2.1.155.
  • Xyloglucan-specific exo-beta-1,4-glucanase catalyze the exohydrolysis of (1 ⁇ 4)-beta-D-glucosidic linkages in xyloglucan.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase alone or in combination with other enzymes during the malting process.
  • the other enzymes are cell wall degrading enzymes.
  • the cell wall degrading enzyme is a xylanase.
  • the invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase and a xylanase alone or in combination with other enzymes during the malting process.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a xylanase alone or in combination with other enzymes during the malting process.
  • the other enzymes are cell wall degrading enzymes.
  • Xylanases are classified in EC 3.2.1.8, EC 3.2.1.32, EC 3.2.1.136 and EC 3.2.1.156.; their activity may be measured e.g. as described herein or by any suitable method known in the art.
  • Suitable xylanases to be used in combination with an enzyme exhibiting endo-1,3(4)-beta-glucanase activity according to the invention includes any xylanase classified in EC 3.2.1.8, EC 3.2.1.32, EC 3.2.1.136 and EC 3.2.1.156, such as any of the ones disclosed in WO 2010072226, WO 2010072225, WO2010072224, WO 2005059084, WO2007056321, WO2008023060A, WO9421785, WO2006114095, WO2006066582, US 2008233175, and W010059424.
  • Endo-1,4-beta xylanase is classified as EC 3.2.1.8.
  • the enzyme causes endohydrolysis of 1,4-beta-D-xylosidic linkages in xylans.
  • family 11 xylanase “Glycoside hydrolase (GH) family 11” or simply “GH 11 xylanase” as used herein refers to an endo-1,4-beta xylanase classified as EC 3.2.1.8, which causes endohydrolysis of 1,4-beta-D-xylosidic linkages in xylans and which is classified as a family 11 xylanase according to B. Henrissat , A classification of glycosyl hydrolases based on amino acid sequence similarities. Biochem. J. 280 (1991), pp. 309-316.
  • GH 10 xylanase comprises enzymes with a number of known activities, such as xylanase (EC:3.2.1.8); endo-1,3-beta-xylanase (EC:3.2.1.32); cellobiohydrolase (EC:3.2.1.91). These enzymes were formerly known as cellulase family F.
  • the enzyme exhibiting endo-1,4-beta-xylanase activity is a family 11 xylanase. In some embodiments the enzyme exhibiting endo-1,4-beta-xylanase activity is a family 10 xylanase.
  • the enzyme exhibiting xylanase activity is a family 5 xylanase.
  • the term “Family 5 xylanase” (formerly family A) includes glycoside hydrolases with varying activities, including: endoglycosylceramidase (EC 3.2.1.123), cellulase (EC 3.2.1.4), licheninase (EC3.2.1.73), beta-mannosidase (EC 3.2.1.25), glucan 1,3-bglucosidase (EC 3.2.1.58), glucan endo-1,6-beta-glucosidase (EC 3.2.1.75), mannan endo-1,4-beta-mannosidase (EC 3.2.1.58), cellulose 1,4-beta-cellobiosidase (EC3.2.1.91), endo-1,6-beta-galactanase (EC 3.2.1.-), 1,3-mannanase (EC 3.2.1.-) and endo-1
  • the enzyme composition according to the invention has endo-1,4-beta xylanase activity as measured by the assays described herein or any suitable assay known in the art.
  • An assay for measuring xylanase activity may be carried out at pH 3.5 or pH 5 and 50° C. using xylan as substrate, or it can be performed at different pH and temperature values for the additional characterization and specification of enzymes. Enzyme activity can be calculated from the increase in absorbance caused by xylose at 540 nm per unit time.
  • the enzyme composition according to the invention comprises a xylanase activity of at least about 5000 U/g, such as at least about 6000 U/g, such as at least about 7000 U/g, such as at least about 8000 U/g, such as at least about 8500 U/g, as measured by in the assays described herein or any suitable assay known in the art.
  • a different 13-xylanase activity is used, e.g., depending of the arabinoxylan content in the cereal and/or the malting conditions and/or the malted cereal requirements.
  • the enzyme composition according to the invention has arabinanase activity or comprises a further enzyme having arabinanase activity.
  • Arabinanase is classified as EC3.2.1.99.
  • the systematic name is 5-alph ⁇ -L-arabinan 5-alph ⁇ -L-arabinanohydrolase but it has several other names such as arabinan endo-1,5-alph ⁇ -L-arabinosidase, and endo-1,5-alph ⁇ -L-arabinanase, endo-alpha-1,5-arabanase, endo-arabanase, 1,5-alph ⁇ -L-arabinan and 1,5-alph ⁇ -L-arabinanohydrolase.
  • Arabinanase also acts on arabinan.
  • the arabinase activity of the enzyme composition according to the invention is measured by arabinase assay as herein or any suitable method known in the art.
  • the assay can be carried out at pH 3.5 and 50° C. using sugar beet arabinan as substrate, and it can be performed at different pH and temperature values for the additional characterization and specification of enzymes.
  • Enzyme activity can be calculated from the increase in absorbance at 540 nm per unit time.
  • One unit of arabinase activity is defined as the amount of enzyme (normalized for total assay volume) that gives an increase in absorbance under the conditions of the assay used (e.g., pH 3.5 and 50° C.).
  • the enzyme composition according to the invention has beta-D-glucoside glucohydrolase activity or comprises a further enzyme having beta-D-glucoside glucohydrolase activity.
  • Beta-D-glucoside glucohydrolase refers to enzymes of E.C 3.2.1.21.
  • the enzyme composition according to the invention has ⁇ -Xylosidase activity or comprises a further enzyme having 13-Xylosidase activity.
  • ⁇ -Xylosidase or “Xylan 1,4-beta-xylosidase” refers to enzymes of E.0 3.2.1.37.
  • ⁇ -Xylosidase catalyze the hydrolysis of (1 ⁇ 4)-beta-D-xylans, to remove successive D-xylose residues from the non-reducing termini.
  • the enzyme composition according to the invention has cellobiohydrolase activity or comprises a further enzyme having cellobiohydrolase activity.
  • “Cellobiohydrolase” or “Cellulose 1,4-beta-cellobiosidase” refers to enzymes of EC 3.2.1.91. Cellulose 1,4-beta-cellobiosidase catalyzes hydrolysis of 1,4-beta-D-glucosidic linkages in cellulose and cellotetraose, releasing cellobiose from the non-reducing ends of the chains.
  • the cellobiohydrolase activity of the enzyme composition according to the invention is measured by the cellobiohydrolase assays as described herein or any suitable assay known in the art.
  • the standard assay is carried out at pH 5.0, and it can be performed at different pH values for the additional characterization and specification of enzymes.
  • One unit of cellobiohydrolase activity is defined as the amount of enzyme which produces 1 ⁇ mole p-nitrophenol from p-nitrophenyl b-D-cellobiopyranoside per minute under the conditions of the assay (e.g., pH 5.0 (or as specified) and 50° C.).
  • the enzyme composition according to the invention has alpha-N-arabinofuranosidase activity or comprises a further enzyme having arabinofuranosidase activity.
  • alpha-N-arabinofuranosidase or “Alpha-N-arabinofuranosidase” refers to enzymes of EC 3.2.1.55. alpha-N-arabinofuranosidase catalyzes the hydrolysis of terminal non-reducing alph ⁇ -L-arabinofuranoside residues in alph ⁇ -L-arabinosides.
  • the arabinofuranosidase activity of the enzyme composition according to the invention is measured by the arabinofuranosidase assay as described herein or by any suitable assay known in the art.
  • the standard assay can be carried out at pH 5.0 and 50° C. and it can be performed at different values of pH and temperatures for the additional characterization and specification of enzymes.
  • One unit of alpha-N-arabinofuranosidase activity is defined as the amount of enzyme which produces 1 ⁇ mole p-nitrophenol from p-nitrophenyl alph ⁇ -L-arabinofuranoside per minute under the conditions of the assay (e.g., pH 5.0 and 50° C. (or as specified)).
  • the enzyme composition according to the invention has glucan 1,4-betaglucosidase activity or comprises a further enzyme having glucan 1,4-beta-glucosidase activity.
  • Glucan 1,4-beta-glucosidase or “glucan 1,4-beta-glucosidase” refers to enzymes of E.C3.2.1.74. Glucan 1,4-beta-glucosidase catalyze the hydrolysis of (1 ⁇ 4)-linkages in (1 ⁇ 4)-beta-D-glucans, to remove successive glucose units.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity provide for improved malting processes.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity provide for a decrease in water consumption during the steeping process.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide for improved and/or faster intake of water by the grain during the steeping process.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide a decrease in the time needed for steeping.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity provide for a decrease in the time needed to cause the grains to germinate.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide for a malted cereal with increase enzymatic activity (e.g., xylanase activity and/or beta-glucanase activity).
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide for better diffusion of one or more cereal enzymes and for better substrate accessibility for said enzymes.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide for a malted cereal with a decrease amount of high molecular weight ⁇ -glucans and arabinoxylans.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide for a malted cereal with lower viscosity.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase activity alone or in combination, provide for a malted cereal with a lower potential for off flavor formation, such as off flavor formation related to arabinoxylan breakdown.
  • one or more enzyme exhibiting endo-1,4-beta-xylanase activity and/or one or more enzyme exhibiting beta-glucanase, alone or in combination provide for a malted cereal with better filterability, such as mash separation and beer filtration.
  • One aspect of the invention relates to an enzyme exhibiting endo-1,4-beta-xylanase activity, which enzyme comprises an amino acid sequence having at least 80% identity with any one selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:17, and SEQ ID NO:18 , or any functional fragment thereof.
  • functional fragment refers to a truncated version of an enzyme with essentially the same or at least a significant degree of enzyme activity as the non-truncated reference enzyme.
  • Another aspect relates to an enzyme exhibiting endo-1,3(4)-beta-glucanase activity, which enzyme comprises an amino acid sequence having at least 80% identity with any one selected from SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, and SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, or any functional fragment thereof.
  • the enzyme has a temperature optimum in the range of 5-80° C., such as in the range of 5-40° C. or 15-80° C., such as in the range 20-80° C., such as in the range 5-15° C., 15-20° C., 45-65° C., 50-65° C., 55-65° C. or 60-80° C.
  • the enzyme has at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% identity with any one amino acid sequence selected from SEQ ID NO: 1-18, or any functional fragment thereof.
  • the enzyme has a total number of amino acids of less than 350, such as less than 340, such as less than 330, such as less than 320, such as less than 310, such as less than 300 amino acids, such as in the range of 200 to 350, such as in the range of 220 to 345 amino acids.
  • the amino acid sequence of the enzyme has at least one, two, three, four, five, six, seven, eight, nine or ten amino acid substitutions as compared to any one amino acid sequence selected from SEQ ID NO: 1-18, or any functional fragment thereof.
  • the amino acid sequence of the enzyme has a maximum of one, two, three, four, five, six, seven, eight, nine or ten amino acid substitutions compared to any one amino acid sequence selected from SEQ ID NO: 1-18, or any functional fragment thereof.
  • the enzyme comprises the amino acid sequence identified by any one of SEQ ID NO: 1-18, or any functional fragment thereof
  • the enzyme consists of the amino acid sequence identified by any one of SEQ ID NO: 1-18, or any functional fragment thereof.
  • a further important aspect of the invention relates to compositions and methods comprising an enzyme exhibiting endo-1,4-p -xylanase activity in combination with any one or more beta-glucanase as described herein.
  • compositions and methods comprising an enzyme exhibiting endo-1,3(4)-beta-glucanase activity in combination with any one or more xylanase as described herein.
  • this one or more xylanase is an enzyme according to SEQ ID NO: 17 and/or SEQ ID NO: 18, or any functional fragment thereof.
  • the combination of an enzyme exhibiting endo-1,4-beta-xylanase activity with an enzyme exhibiting endo-1,3(4)-beta-glucanase activity is according to the following table:
  • any one of the above combination of an enzyme being an enzyme exhibiting endo-1,4-beta-xylanase activity with an enzyme exhibiting endo-1,3(4)-beta-glucanase activity may be combined with a ratio between the two enzymes of 1:10, 2:10, 3:10, 4:10, 5:10, 6:10, 7:10, 8:10, 9:10, 10:10, 10:9, 10:8, 10:7, 10:6, 10:5, 10:4, 10:3, 10:2, or 10:1, such as within a range of 1:10-10:1, such as 2:10-10:2, such as 3:10-10:3, such as 4:10-10:4, such as 5:10-10:5, such as 6:10-10:6, such as 7:10-10:7, such as 8:10-10:8, or within 9:10-10:9.
  • any one of the above combination of an enzyme being an enzyme exhibiting endo-1,4-beta-xylanase activity with an enzyme exhibiting endo-1,3(4)-beta-glucanase activity may be combined with a ratio between the two enzymes of 1:1.
  • composition according to the invention comprises a combination of at least two enzymes, said two enzymes, or two enzymes with an amino acid sequence having at least 80% sequence identity with the respective SEQ ID, or any functional fragment thereof, being selected from the list consisting of: SEQ ID NO 1 and SEQ ID NO:7; SEQ ID NO 2 and SEQ ID NO:7; SEQ ID NO 3 and SEQ ID NO:7; SEQ ID NO 4 and SEQ ID NO:7; SEQ ID NO 5 and SEQ ID NO:7; SEQ ID NO 6 and SEQ ID NO:7; SEQ ID NO 17 and SEQ ID NO:7; SEQ ID NO 18 and SEQ ID NO:7; SEQ ID NO 1 and SEQ ID NO:8; SEQ ID NO 2 and SEQ ID NO:8; SEQ ID NO 3 and SEQ ID NO:8; SEQ ID NO 4 and SEQ ID NO:8; SEQ ID NO 5 and SEQ ID NO:8; SEQ ID NO 6 and SEQ ID NO:8; SEQ ID NO 17 and SEQ ID NO:7;
  • the methods comprise an enzyme having xylanase activity of SEQ ID NO:1 and an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity of SEQ ID NO:7. In some embodiments, the methods comprise an enzyme having xylanase activity of SEQ ID NO:2 and an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity of SEQ ID NO:8. In some embodiments, the methods comprise an enzyme having xylanase activity of SEQ ID NO:2 and an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity of SEQ ID NO:8.
  • any of the above combination of an enzyme being an enzyme exhibiting endo-1,4-beta-xylanase activity with an enzyme exhibiting endo-1,3(4)-beta-glucanase activity may be combined with a ratio between the two enzymes of 1:1 per weight.
  • any of the above combination comprise an enzyme exhibiting endo-1,3(4)-beta-glucanase activity having a minimum activity of 9000 U/g and an enzyme exhibiting endo-1,4-beta-xylanase activity having a minimum activity of 13000U/g.
  • composition and methods according to the invention comprises the use of any suitable commercially available enzymes having xylanase activity and/or beta-glucanase activity such as UltraFlo L (available from Novozymes-beta glucanase with cellulase, xylanase side activities), UltraFlo XL (available from Novozymes-beta glucanase with xylanase and alpha amylase side activities), UltraFlo Max (available from Novozymes-beta glucanase and xylanase), Finizyme 250 L(available from Novozymes-beta glucanase with cellulase, xylanase side activities) Filtrase series(available from DSM-beta-glucanase and xylanases).
  • UltraFlo L available from Novozymes-beta glucanase with cellulase, xylanase side activities
  • the endo-1,3(4)-beta-glucanase activity and the endo-1,4-beta-xylanase activity are derived from at least two different enzymes. In some embodiments, the two different enzymes are from two different species.
  • the composition according to the invention comprises any one or more further enzyme.
  • the one or more further enzyme is selected from a list consisting of a xylanase classified in EC 3.2.1.32, EC 3.2.1.136, or EC 3.2.1.156, a cellulase, a laminarinase, an endo-1,5- ⁇ -L-arabinanase, a beta-D-glucoside glucohydrolase, a beta -Xylosidase, a cellobiohydrolase, a glucan 1,4-beta-glucosidase, a xyloglucan-specific exobeta-1,4-glucanase and an alpha Arabinofuranosidase.
  • Sequences and enzymes identified by a sequence as mentioned herein and used according to the present invention alone or in combinations with other enzymes or compounds may be with or without signal peptide.
  • the present invention is directed to methods for the preparation of malted cereals comprising adding one or more enzymes to the malting process.
  • the present invention provides methods for the preparation of malted cereals comprising adding a cell wall degrading enzyme alone or in combination with other enzymes at some point during the malting process.
  • the cell wall degrading enzyme is a xylanase or a beta glucanase.
  • the present invention provides methods for the preparation of malted cereals comprising adding a beta glucanase alone or in combination with other enzymes at some point during the malting process.
  • the present invention provides compositions and methods for the preparation of malted cereals comprising adding a xylanase alone or in combination with other enzymes at some point during the malting process.
  • the other enzymes are other cell wall degrading enzymes.
  • the invention provides compositions and methods for the preparation of malted cereals comprising adding a beta glucanase and a xylanase alone or in combination with other enzymes during the malting process.
  • the present invention provides methods for the preparation process of malted cereals comprising the following steps: a steeping step including one or more wetting stages, a germination step, a drying step (e g kilning) including one or more temperature, and one or more enzymes as described herein which are added one or more times during the process.
  • a steeping step including one or more wetting stages
  • a germination step including one or more temperature
  • one or more enzymes as described herein which are added one or more times during the process.
  • the same or different one or more enzymes are added in one or more of the wetting stages of the steeping process.
  • the steeping step and/or the germination step involve spraying the cereal, and one or more enzymes as described herein are added one or more times during the process.
  • the one or more enzymes as described herein are added constantly during the spraying of the cereal.
  • the cereals to be malted according to the methods described herein are selected from the group consisting of barley, wheat, rye, corn, oats, rice, millet, triticale, cassava, sorghum and a combination thereof.
  • the one or more enzymes described herein may be introduced before or during the malting process.
  • the one or more enzymes described herein e.g. a beta glucanase and/or a xylanase
  • the one or more enzymes described herein are added at the final stages of the malting process or after the malting process is completed to further increase the enzymatic activity of the malt.
  • the preparation process of malted cereals comprises a steeping step including one or more wetting stages, where one or more enzymes as described herein are added one or more times during one or more of wetting stages. In some embodiments, the same or different enzymes are added one or more times during one or more of wetting stages of the steeping process. In some embodiments, the one or more wetting stages involve spraying the cereal, where one or more enzymes as described herein are added one or more times or constantly during the spraying.
  • the concentration of one or more enzymes described herein may vary depending on the conditions of the malting process, the type of cereal (e.g., ⁇ -glucans and arabinoxylans content in the grain), the desired specification of the final malted product (e.g. viscosity, ⁇ -glucans and arabinoxylans content and final enzyme activity in the malt product, etc. . . . ) and the type of enzyme(s) being utilized. Generally about 0.01-100 mg enzyme protein per kilogram of cereals per gram air dry cereal is utilized.
  • about 0.1-50 mg/kg, or about 1-15 mg/kg or about 10-100 mg/kg are utilized. In some embodiments, about 3.75 mg/kg, or about 5 mg/kg, or about 6.25 mg/kg; or about 7.5 mg/kg; or about 10 mg/kg or about 12.5 mg/kg are utilized. In some embodiments, about 10 U/kg-1000 U/kg are utilized. In some embodiments, about 10 U/kg-100 U/kg, or about 30 U/kg-100 U/kg, or about 50 U/kg-100 U/kg are utilized. In some embodiments about 100 U/kg-1000 U/kg are utilized.
  • the methods comprise an enzyme having xylanase activity selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4,
  • the methods comprise an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity selected from the group consisting of SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, and SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, or any functional fragment thereof.
  • the methods comprise an enzyme exhibiting endo-1,3(4)-beta-glucanase activity in combination with an enzyme exhibiting xylanase activity, each independently selected from the groups described above.
  • the methods comprise an enzyme having xylanase activity of SEQ ID NO:1 and an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity of SEQ ID NO:7.
  • the methods comprise an enzyme having xylanase activity of SEQ ID NO:2 and an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity of SEQ ID NO:8.
  • the methods comprise an enzyme having xylanase activity of SEQ ID NO:2 and an enzyme exhibiting endo-1,3(4)- ⁇ -glucanase activity of SEQ ID NO:8.
  • any of the above combination of an enzyme being an enzyme exhibiting endo-1,4-beta-xylanase activity with an enzyme exhibiting endo-1,3(4)-beta-glucanase activity may be combined with a ratio between the two enzymes of 1:1 per weight.
  • any of the above combination comprise an enzyme exhibiting endo-1,3(4)-beta-glucanase activity having a minimum activity of 9000 U/g and an enzyme exhibiting endo-1,4-beta-xylanase activity having a minimum activity of 13000U/g.
  • composition and methods according to the invention comprises the use of any suitable commercially available enzymes having xylanase activity and/or beta-glucanase activity such as UltraFlo L (available from Novozymes-beta glucanase with cellulase, xylanase side activities), UltraFlo XL (available from Novozymes-beta glucanase with xylanase and alpha amylase side activities), UltraFlo Max (available from Novozymes-beta glucanase and xylanase), Finizyme 250 L(available from Novozymes-beta glucanase with cellulase, xylanase side activities) Filtrase series(available from DSM-betaglucanase and xylanases).
  • UltraFlo L available from Novozymes-beta glucanase with cellulase, xylanase side activities
  • UltraFlo XL
  • the cereal and one or more enzymes described herein are combined at an effective concentration during one or more of the wetting of the cereal, and the combination is held at a temperature (e.g. of at least about 5° C. and not more than about 30° C., preferably between about 10° C.
  • the cereal and one or more enzymes described herein are combined to hydrolyze at least 50% of the ⁇ -glucans and/or arabinoxylans in grain. In some embodiments, the cereal and one or more enzymes described herein (e.g., a beta glucanase and/or a xylanase) are combined to hydrolyze at least 60% of the ⁇ -glucans and/or arabinoxylans in grain.
  • the cereal and one or more enzymes described herein are combined to hydrolyze at least 70% of the ⁇ -glucans and/or arabinoxylans in grain. In some embodiments, the cereal and one or more enzymes described herein (e.g., a beta glucanase and/or a xylanase) are combined to hydrolyze at least 80% of the ⁇ -glucans and/or arabinoxylans in grain.
  • At least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% of the ⁇ -glucans and/or arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • At least 10% of the ⁇ -glucans and/or arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, at least 50% of the ⁇ -glucans and/or arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, at least 60% of the ⁇ -glucans and/or arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • At least 70% of the ⁇ -glucans and/or arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, at least 80% of the ⁇ -glucans and/or arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • At least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% of the ⁇ -glucans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • at least 10% of the ⁇ -glucans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • At least 50% of the 13-glucans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, at least 60% of the ⁇ -glucans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, at least 80% of the ⁇ -glucans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the ⁇ -glucans in grain are broken down such that the concentration of high molecular weight ⁇ -glucan in the malted cereal is less than 150 mg/l , or less than 100 mg/l or less than 90 mg/l , or less than 80 mg/l , or less than 70 mg/l , or less than 60 mg/l , or less than 50 mg/l. In some embodiments, the ⁇ -glucans in grain are broken down such that the concentration of high molecular weight ⁇ -glucan in the malted cereal is 50 mg/l or less.
  • At least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% of the arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • at least 10% of the arabinoxylans in grain are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein
  • At least 50% of the ⁇ -glucans in grain are broken down and at least 50% of the arabinoxylans are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • at least 60% of the ⁇ -glucans in grain are broken down and at least 50% of the arabinoxylans are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • at least70% of the ⁇ -glucans in grain are broken down and at least 50% of the arabinoxylans are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • at least 80% of the ⁇ -glucans in grain are broken down and at least 50% of the arabinoxylans are broken down compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the arabinoxylans in grain are broken down such that the concentration of high molecular weight arabinoxylans in the malted cereal is less than 2400 mg/l , or less than 2200 mg/l , or less than 1900 mg/l , or less 1500 than mg/l , or less than 1000 mg/l , or less than 800 mg/l , or less than 700 mg/l or less than 600 mg/l , or less than 500 mg/l , or less than 100 mg/l , or less than 60 mg/l , or less than 50 mg/l.
  • the arabinoxylans in grain are broken down such that the concentration of high molecular weight arabinoxylans in the malted cereal is 2000 mg/l or less.
  • the cereal and one or more enzymes described herein are combined at an effective concentration during one or more of the wetting of the cereal at a specific temperature(s) for a period of time until the cereal has a moisture content of at least about 20 weight percent.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 20 to about 60 weight percent, or about 40 to 50 weight percent.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 40 to about 47 weight percent, and has germinated.
  • the total time of the steeping process is less compared to the time of a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 20 to about 60 weight percent, or about 40 to 50 weight percent, and the ⁇ -glucans in grain are broken down such that the concentration of high molecular weight ⁇ -glucan in the malted cereal is 50 mg/l or less.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 40 to about 47 weight percent, has germinated and the ⁇ -glucans in grain are broken down such that the concentration of high molecular weight ⁇ -glucan in the malted cereal is 50 mg/l or less.
  • the total time of the steeping process is less compared to the time of a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 20 to about 60 weight percent, or about 40 to 50 weight percent, and the arabinoxylans in grain are broken down such that the concentration of high molecular weight arabinoxylans in the malted cereal is 2000 mg/l or less.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 40 to about 47 weight percent, has germinated and the arabinoxylans in grain are broken down such that the concentration of high molecular weight arabinoxylans in the malted cereal is 2000 mg/l or less.
  • the moistened cereal and the one or more enzymes are combined at an effective concentration during one or more of the wetting of the cereal for a period of time and temperature until the cereal has a moisture content of between about 40 to about 47 weight percent, has germinated and the arabinoxylans in grain are broken down such that the concentration of high molecular weight arabinoxylans in the malted cereal is 1000 mg/l or less.
  • the total time of the steeping process is less compared to the time of a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total time for the steeping process is at least 5, 7, 9, 10, 11, 13, 15, 17, 19, 20, 21, 23, 25, 27, 29, 30, 31, 33, 35, 37, 39, 40, 41, 43, 45, 47, 49, 50, 51, 53, 55, 57, 59, 60, 61, 63, 65, 67, 69, 70, 71, 73, 75, 77, 79, 80, 81, 83, 85, 87, 89, 91, 93 or 95% less than the time of a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total time for the steeping process does not exceed 30 hours. In some embodiments, the total time for the steeping process does not exceed 25 hours. In some embodiments, the total time for the steeping process is about 10 hours to about 25 hours. In some embodiments, the total time for the steeping process is less than 25, 20, 15, or even less than 10 hours.
  • the total amount of water used during the steeping process is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% less than the water used for a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, the total amount of water used during the steeping process is at least 10% less than the water used for a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of water used during the steeping process is at least 20% less than the water used for a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, the total amount of water used during the steeping process is at least 30% less than the water used for a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the invention provides for improved water uptake by the grain.
  • the water uptake by the grain is improved by at least 10, 15, 20, 50, 70, 90 or 95% compared to a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the water uptake by the grain is improved by at least 10%, or at least 20%.
  • the cereal and one or more enzymes described herein are combined at an effective concentration at the beginning of the first wetting of the cereal.
  • the cereal and one or more enzymes described herein e.g., a beta glucanase and/or a xylanase
  • the cereal and one or more enzymes described herein e.g., a beta glucanase and/or a xylanase
  • the wetting stage involves spraying the cereal, where one or more enzymes as described herein are added one or more times, or constantly, during the spraying.
  • the cereal and one or more enzymes described herein are combined at an effective concentration 1, 2, 3 or 4 hours after the beginning of the first wetting of the cereal.
  • the cereal and one or more enzymes described herein are combined during the last hour of the first wetting of the cereal.
  • the cereal and one or more enzymes described herein are combined at an effective concentration at the beginning of the second wetting of the cereal.
  • the cereal and one or more enzymes described herein e.g., a beta glucanase and/or a xylanase
  • the cereal and one or more enzymes described herein e.g., a beta glucanase and/or a xylanase
  • the wetting stage involves spraying the cereal, where one or more enzymes as described herein are added one or more times, or constantly, during the spraying.
  • the cereal and one or more enzymes described herein are combined at an effective concentration 1, 2, 3 or 4 hours after the beginning of the second wetting of the cereal.
  • the cereal and one or more enzymes described herein are combined during the last hour of the second wetting of the cereal.
  • the cereal and one or more enzymes described herein are combined at an effective concentration at the beginning of the third wetting of the cereal.
  • the cereal and one or more enzymes described herein e.g., a beta glucanase and/or a xylanase
  • the cereal and one or more enzymes described herein e.g., a beta glucanase and/or a xylanase
  • the wetting stage involves spraying the cereal, where one or more enzymes as described herein are added one or more times, or constantly, during the spraying.
  • the cereal and one or more enzymes described herein are combined at an effective concentration 1, 2, 3 or 4 hours after the beginning of the third wetting of the cereal.
  • the cereal and one or more enzymes described herein are combined during the last hour of the third wetting of the cereal.
  • the cereal and one or more enzymes described herein are combined at an effective concentration at the beginning of each of the wetting stages of the cereal.
  • the cereal and one or more enzymes described herein are combined at an effective concentration during all the wetting stages of the cereal.
  • the cereal and one or more enzymes described herein are combined at an effective concentration during all the wetting stages of the cereal after a desired temperature have been reached.
  • the one or more wetting stages involve spraying the cereal, where one or more enzymes as described herein are added one or more times, or constantly, during the spraying.
  • the present invention provides malted cereals, obtained according to the process of the invention, which present improved properties.
  • the malted cereals produced by the methods described herein have a lower high molecular weight fraction of beta-glucan and/or arabinoxylans content, and/or a higher enzyme activity such as, for example, beta-glucanase or xylanase activity than a control malted cereal prepared without the one or more enzymes according to the methods described herein. This allows for a better processability of the malt, e.g., in wort and beer production by potentially having increased rates of mash separation and beer filtration.
  • the malted cereals produced by the methods described herein have a concentration of high molecular weight ⁇ -glucan of 100 mg/l, 90 mg/l, 80 mg/l, 70 mg/l, 60 mg/l, 50 mg/l or less. In some embodiments, the malted cereals produced by the methods described herein have a concentration of high molecular weight arabinoxylans of 2500 mg/l, 2200 mg/l, 2100 mg/l, 1900 mg/l, 1500 mg/l, 1000 mg/1800 mg/l, 700 mg/l, 600 mg/l, 500 mg/l, 100 mg/l, 50 mg/l or less.
  • malted cereals produced by the methods described herein have a beta-glucanase activity and/or xylanase activity of about 10 U/kg-100 U/kg, or about 30 U/kg-100 U/kg, or about 50 U/kg-100 U/kg are utilized. In some embodiments about 100 U/kg-1000 U/kg.
  • an object of the present invention concerns the use of the malted cereals according to the invention for the preparation of food and beverages.
  • the invention is also related to these improved beverages.
  • the improved malted cereals according to the invention could also be used in other biotechnological processes well known by a person of ordinary skill in the art, in which in most cases advantage is taken of their improved quality.
  • the methods describes herein provide for a malted cereal with a decrease amount of high molecular weight fraction of ⁇ -glucans and/or arabinoxylans.
  • the total amount of high molecular weight ⁇ -glucans and/or arabinoxylans is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% less than the amount of high molecular weight ⁇ -glucans and/or arabinoxylans in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of high molecular weight ⁇ -glucans is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% less than the amount of ⁇ -glucans in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of high molecular weight ⁇ -glucans is at least 50% less than the amount of high molecular weight ⁇ -glucans in a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, the total amount of high molecular weight ⁇ -glucans is at least 60% less than the amount of high molecular weight ⁇ -glucans in a control malted cereal prepared without the one or more enzymes according to the methods described herein. In some embodiments, the total amount of high molecular weight ⁇ -glucans is at least 70% less than the amount of high molecular weight ⁇ -glucans in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of high molecular weight ⁇ -glucans is at least 80% less than the amount of high molecular weight ⁇ -glucans in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of arabinoxylans is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% less than the amount of arabinoxylans in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of high molecular weight arabinoxylans is at least 50% less than the amount of high molecular weight arabinoxylans in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the total amount of high molecular weight arabinoxylans is at least 50% less than the amount of high molecular weight arabinoxylans and the total amount of high molecular weight ⁇ -glucans is at least 80% less than in a control malted cereal prepared without the one or more enzymes according to the methods described herein.
  • the methods described herein provide for a malted cereal with lower viscosity, when extracted.
  • the viscosity of the malted cereal is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% lower than the viscosity of a malted cereal prepared without the one or more enzymes according to the invention.
  • the malted cereals described herein provide for the production of an extract with lower viscosity.
  • the viscosity of the extract is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% lower than the viscosity of a extract prepared with a control malted cereal prepared without the one or more enzymes according to the invention.
  • the process of the invention may increase the enzymatic activity of the malted cereal.
  • the enzymatic activity is selected from the group consisting of ⁇ -glucanase activity, xylanase activity, amylase activity, protease activity, naturally occurring enzyme activity in the cereal and combinations thereof.
  • the process of the invention may increase a ⁇ -glucanase activity and/or a xylanase activity of a malted cereal by a factor of at least about 2 as compared to a control malted cereal prepared without the one or more enzymes according to the invention.
  • a ⁇ -glucanase activity and/or a xylanase activity of a malted cereal is at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% higher than a control malted cereal prepared without the one or more enzymes according to the invention.
  • malted cereals produced by the methods described herein have a beta-glucanase activity and/or xylanase activity of about 10 U/kg-100 U/kg, or about 30 U/kg-100 U/kg, or about 50 U/kg-100 U/kg are utilized. In some embodiments about 100 U/kg-1000 U/kg.
  • the cereal and one or more enzymes described herein are combined at an effective concentration during at least one of the wetting of the cereal for a period of time and at a temperature to obtain an increase in enzymatic activity of the malted cereal.
  • the enzymatic activity is selected from the group consisting of ⁇ -glucanase activity, xylanase activity, amylase activity, protease activity, naturally occurring enzyme activity in the cereal and combinations thereof.
  • the one or more enzymes described herein are added at the final stages of the malting process or after the malting process is completed to further increase the enzymatic activity of the malt.
  • the methods described herein provide for a malted cereal with a lower potential for off flavor formation, such as off flavor formation related to arabinoxylan breakdown.
  • the methods described herein provide for a malted cereal with a decreased risk of filter bed collapse, such as at lautering.
  • the total pressure built up is reduced to a value of less than 470 mm WC, such as less than 450 mm WC, such as less than 430 mm WC, such as less than 410 mm WC, such as less than 390 mm WC, such as less than 370 mm WC, such as less than 350 mm WC, such as less than 330 mm WC, such as less than 310 mm WC, such as less than 300 mm WC, such as less than 290 mm WC, when a malted cereal according to the present invention is used prior to the mash separation in a brewing application.
  • the total pressure built up is reduced by at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93 or 95% compared to the use of a negative control without said malted cereal; when used prior to the mash separation in a brewing application.
  • the mash separation as measured by volume wort collected after 5 min of separation relative to a control malted cereal is increased to above 1.5, such as above 1.6, such as above 1.7, such as above 1.8, such as above 1.9, such as above 2.0, such as above 2.1, such as above 2.2, such as above 2.3, such as above 2.4, such as above 2.5, when the composition according to the invention is used in a brewing application prior to the mash separation.
  • the mash separation as measured by volume wort collected after 5 min of filtration is increased at least 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300% as compared to the use of a control malted cereal.
  • the process of malting is well known in the art and the specific conditions vary depending on the type of cereal used, the final specifications needed for the malted cereals and the specific malting facilities.
  • the methods described herein can be applied to any malting process known in the art and can be used in any malting facility. It is to be understood that certain parameters of the compositions and methods described herein may be adjusted depending to the properties needed for the malt and/or the specific malting facilities to obtain such optimal properties in the malted cereal, e.g., depending on the cereal varieties and the downstream uses.
  • DNS CMC method DNS Cellulase activity method
  • the assay of cellulase is based on the enzymatic endo-hydrolysis of the 1,4- ⁇ -D-glucosidic bonds in carboxymethylcellulose (CMC), a 13-1,4-glucan.
  • CMC carboxymethylcellulose
  • the products of the reaction ( ⁇ -1,4 glucan oligosaccharides) is determined colorimetrically by measuring the resulting increase in reducing groups using a 3,5 dinitrosalicylic acid reagent.
  • Enzyme activity is calculated from the relationship between the concentration of reducing groups, as glucose equivalents, and absorbance at 540 nm.
  • the assay is carried out at pH 5.0, but it can be performed at different pH values for the additional characterization and specification of enzymes.
  • One unit of cellulase activity is defined as the amount of enzyme which produces 1 ⁇ mole glucose equivalents per minute under the conditions of the assay (pH 5.0 (or as specified) and 50° C.).
  • the enzyme composition is diluted into samples and a glucose standard curve can be made using glucose concentrations of 0, 0.125, 0.25, 0.375, and 0.5 mg/ml.
  • the optical density is measured at 540 nm (OD540 nm) of the different samples.
  • the enzyme activity is determined from the standard curve.
  • the reaction catalysed by laminarinase, involves the endohydrolysis of 1,3-glucosidic bonds in 1,3- ⁇ -D-glucans.
  • Substrates include laminarin, paramylon and pachyman.
  • the products of the reaction ( ⁇ 3-glucan oligosaccharides) are determined colourimetrically by measuring the resulting increase in reducing groups using a 3,5 dinitrosalicylic acid reagent. Enzyme activity is calculated from the relationship between the concentration of reducing groups, as glucose equivalents, and absorbance at 540 nm.
  • the assay can be carried out at pH 5.0 and 50° C., it can also be performed at different values of pH and temperature for the additional characterization and specification of enzymes.
  • One unit of laminarinase activity is defined as the amount of enzyme which produces 1 ⁇ mole glucose equivalents per minute under the conditions of the assay (pH 5.0 and 50° C. (or as specified)).
  • Laminarin (from Laminaria digitata). Supplier: Sigma-Aldrich Co. Ltd. Product no.: L 9634; 1.00%(w/v solution) Laminarin solution (substrate solution 0.1M sodium acetate buffer, pH 5.0); 1.75 ml laminarin solution is mixed with 0.25 ml diluted enzyme solution at 50° C. for 10 minutes and the reaction stopped by addition of 2 ml DNS solution.
  • Standard curve can be made using 0, 0.125, 0.25, 0.5 and 0.75 mg/ml glucose solution.
  • Optical density is measured at 540 nm (OD540 nm).
  • the assay of Arabinase activity is based on colorimetrically determination by measuring the resulting increase in reducing groups using a 3,5 dinitrosalicylic acid reagent. Enzyme activity is calculated from the relationship between the concentration of reducing groups, as arabinose equivalents, and absorbance at 540 nm.
  • the assay can be carried out at pH 3.5, it can also be performed at different pH values for the additional characterization and specification of enzymes.
  • arabinase activity is defined as the amount of enzyme which produces 1 ⁇ mole arabinose equivalents per minute under the conditions of the assay (pH 3.5 (or as specified) and 50° C.).
  • the enzyme composition is diluted into samples and an arabinase standard curve is made using arabinase concentrations of 0, 0.125, 0.25, 0.375, and 0.5 mg/ml.
  • the optical density is measured at 540 nm (OD540 nm) of the different samples.
  • the enzyme activity is determined from the standard curve.
  • 2m1 DNS solution 1% 3,5-Dinitrosalicylic acid (DNS), 1.6% sodium hydroxide, 30% potassium sodium tartrate in distilled water
  • DNS 3,5-Dinitrosalicylic acid
  • Samples, blanks and standards added DNS are placed in a boiling water bath (95° C.) for 5 minutes.
  • samples, blanks and standards are cooled by placing them in a 25° C. water bath for 20 minutes.
  • the optical density of all samples are read at OD540 using a spectrophotometer. Based on the dilution of the samples, the amount of sample used and the standards, the xylanase activity of the sample can be calculated.
  • One Unit of endo-1,4-beta-xylanase activity is defined as the amount of enzyme which produces 1 ⁇ mole xylose equivalents per minute under the conditions mentioned above
  • Samples, to obtain OD540 within the standard curve in this assay and glucose standards (0; 0.125; 0.250; 0.500; and 0.750 mg/ml distilled water) are prepared in distilled water.
  • 1,75 ml barley beta-glucan (1.5% barley beta-glucan (BETA-BGBM, Megazyme, Bray, Ireland)) in 1M sodium acetate/acetic acid, pH 5) is placed in a test tube at 50° C.
  • 250 ⁇ 1 enzyme solution is added to the substrate at 50° C. followed by mixing. Distilled water is used as blank.
  • 2m1 DNS solution 1% 3,5-Dinitrosalicylic acid (DNS), 1,6% sodium hydroxide, 30% potassium sodium tartrate in distilled water
  • DNS 3,5-Dinitrosalicylic acid
  • Samples, blanks and standards added DNS are placed in a boiling water bath (95° C.) for 15 minutes.
  • samples, blanks and standards are cooled by placing them in a 25° C. water bath for 20 minutes.
  • the Optical density of all samples are read at OD540 using a spectrophotometer. Based on the dilution of the samples, the amount of sample used and the standards, the glucanase activity of the sample can be calculated.
  • One unit of endo-1,3(4)- ⁇ -glucanase activity is defined as the amount of enzyme which produces 1 ⁇ mole glucose equivalents per minute under the conditions of the assay (pH 5.0 (or as specified) and 50° C.).
  • the reaction catalysed by a-N-arabinofuranosidase, involves the hydrolysis of the terminal bond, at the non-reducing ⁇ -L-arabinofuranoside residue, of ⁇ -L-arabinosides.
  • the enzyme acts on ⁇ -L-arabinofuranosides, ⁇ -L-arabinans containing (1,3)- and/or (1,5)-linkages, arabinoxylans and arabinogalactans.
  • the assay of a-N-arabinofuranosidase is based upon the enzymatic hydrolysis of p-nitrophenyl ⁇ -L-arabinofuranoside.
  • the assay is a “two-point”, rather than a “continuous monitoring”, method.
  • the calculation of enzyme activity is based on measurements taken only at the beginning and end of the incubation period.
  • a product of the reaction, p-nitrophenol is determined colourimetrically (after pH adjustment).
  • Enzyme activity is calculated from the relationship between the concentration of p-nitrophenol and absorbance at 400 nm.
  • the enzyme solution is prepared and the assay is performed as described in PCT publication number WO2013/037933.
  • the reaction catalyzed by cellobiohydrolase, involves the hydrolysis of 1,4- ⁇ -D-glucosidic linkages in cellulose and cellotetraose, releasing cellobiose from the non-reducing ends of the chains.
  • the assay of cellobiohydrolase is based on the enzymatic hydrolysis of p-nitrophenyl ⁇ -D-cellobiopyranoside.
  • the product of the reaction, p-nitrophenol is determined colorimetrically (after pH adjustment).
  • Enzyme activity is calculated from the relationship between the concentration of p-nitrophenol and absorbance at 400 nm.
  • the assay is performed as described in PCT publication number WO2013/037933.
  • a Joe White micro-malting system can be used to test multiple samples of different cereals from different varieties (e.g., barley: Sebastian, Tipple, Prestige, and Bellini), using different enzymes concentrations at different time points.
  • This micro-malting system allows for steeping, germination, and kilning of samples in one unit while providing uniformity of malting conditions for each batch.
  • Each sample is placed in one compartment of the micro-malting system.
  • a sample of 0.5 kilogram of barley is added to each of the compartments in the micro-malting unit for malting.
  • a mixture of enzymes containing an endo-1,3(4)-beta-glucanase and an endo-1,4-beta-xylanase is added at different times during the steeping process at the different concentrations 0.01-100 mg enzyme protein per kilogram.
  • the table below describes experimental conditions.
  • the barley can be steeped using different experimental conditions:
  • the barley is steeped with the first water immersion for the time necessary for the grain to reach 40-45% moisture at a temperature of 15° C. Following the water immersion, the barley is subjected to air ventilation for 12 hours at a temperature of 15° C. The second immersion is for the time necessary for the grain to reach 40-45% moisture, which is then followed by air ventilation for 10 hours at 15° C. The third steeping is for 2 hours at 15° C. After steeping is completed, germination begins and the grains can be allowed to germinate for 5 days. The time necessary for each of the varieties to reach the desired levels of moisture is recorded.
  • the barley is steeped with the first water immersion for 6 hours at a temperature of 15° C. with a total water to air dry barley ratio of 3:1 for samples with no enzymes, 2:1 for samples in which the enzymes are added during the first wet stage, 1:1 for samples in which enzymes are added during the first and second wet stages; and 0.8:1 for samples in which enzymes are added during all wet stages.
  • the barley is subjected to air ventilation for 12 hours at a temperature of 15° C.
  • the second immersion is for 5 hours, followed by air ventilation for 0 hours at 15° C.
  • the third immersion is for 2 hours at 15° C.
  • Conditions (a) and (b) can be repeated using different enzymes concentrations, to determine differences in water consumption and/or germination time.
  • the germinating barley is subjected to humidified air at a temperature of 15° C.
  • the amount of beta-glucans and arabinoxylans present in the germinating barley and final malt can be measured by any suitable methods known in the art.
  • the amount of beta-glucans present in the germinating barley and final malt can be measured by the methods described in Journal of the Institute of Brewing Volume 91, Issue 5, pages 285-295, September-October 1985.
  • the glucanase and/or xylanase activity present in the malted cereal can be measured as described above.
  • Troubadour bred in The Netherlands and released in Spain in 1983, is very high-yielding under Mediterranean environments. However, its malting quality is fairly poor, giving low extract yields. It has been reported that the low yield could be correlated with the content of beta-glucan in the grain.
  • micromalting plant that allows the processing of 32 samples of 200 g each per batch can be used.
  • the micromalting procedure is as follows:
  • Steeping is performed in the presence or absence of a mixture of enzymes containing an endo-1,3(4)-beta-glucanase and an endo-1,4-beta-xylanase at different times during the steeping process and at the different concentrations ranging from 0.01-100 mg enzyme protein per kilogram.
  • the total protein content, the beta-glucan and arabinoxylan content of barley and the beta-glucanase and xylanase activity of malt are determined as described above.
  • AtuXyn3, Aspergillus tubigensis (SEQ ID NO: 1), 302 aa: QASVSIDTKFKAHGKKYLGNIGDQYTLTKNSKTPAIIKADFGALTPEN SMKWDATEPSRGQFSFSGSDYLVNFAQSNNKLIRGHTLVWHSQLPSWV QAITDKNTLIEVMKNHITTVMQHYKGKIYAWDVVNEIFNEDGSLRDSV FYQVIGEDYVRIAFETARAADPNAKLYINDYNLDSASYPKLTGMVSHV KKWIEAGIPIDGIGSQTHLSAGGGAGISGALNALAGAGTKEIAVTELD IAGASSTDYVEVVEACLDQPKCIGITVWGVADPDSWRSSSTPLLFDSN YNPKPAYTAIANAL TerXyn1, Geosmithia emersonii ( Taleromyces emersonii ) (SEQ ID NO: 2): AGLNTAAKAIGLKYFGTATDNPELSDTAYETQLN

Landscapes

  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Food Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Polymers & Plastics (AREA)
  • Nutrition Science (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Cereal-Derived Products (AREA)
  • Grain Derivatives (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Non-Alcoholic Beverages (AREA)
US15/524,603 2014-11-05 2015-11-05 Enzymes for malting Abandoned US20170318843A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP14191889.6A EP3017706A1 (en) 2014-11-05 2014-11-05 Enzymes for malting
EP14191889.6 2014-11-05
PCT/EP2015/075842 WO2016071463A1 (en) 2014-11-05 2015-11-05 Enzymes for malting

Publications (1)

Publication Number Publication Date
US20170318843A1 true US20170318843A1 (en) 2017-11-09

Family

ID=52023156

Family Applications (1)

Application Number Title Priority Date Filing Date
US15/524,603 Abandoned US20170318843A1 (en) 2014-11-05 2015-11-05 Enzymes for malting

Country Status (9)

Country Link
US (1) US20170318843A1 (zh)
EP (3) EP3017706A1 (zh)
CN (1) CN107109313A (zh)
AU (1) AU2015341731A1 (zh)
BR (1) BR112017008755A2 (zh)
CA (1) CA2966471A1 (zh)
MX (1) MX2017005342A (zh)
RU (1) RU2017119228A (zh)
WO (1) WO2016071463A1 (zh)

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6913113B2 (ja) * 2016-07-01 2021-08-04 カールスベア ブリューアリーズ アー／エス 精製された穀物系飲料
US20180092381A1 (en) * 2016-10-04 2018-04-05 Pepsico, Inc. Mouthfeel blends for low and non-caloric beverages
US11019837B2 (en) 2017-11-08 2021-06-01 Pepsico, Inc. Mouthfeel modulation in reduced and sugar-free beverages using a blend of pectin and xanthan gum
BR102017026595A2 (pt) * 2017-12-08 2019-06-25 Cnpem - Centro Nacional De Pesquisa Em Energia E Materiais Composição e método para mosturação de malte
EP3732279B1 (en) 2017-12-28 2023-08-30 Carlsberg A/S Method for producing an extract of cereal and method for processing this extract into beverage
EP4324902A3 (en) 2017-12-28 2024-05-22 Carlsberg A/S Fast methods for preparing cereal extracts
US11700869B2 (en) 2018-06-27 2023-07-18 Pepsico, Inc. Mouthfeel enhancing composition
CN109182296B (zh) * 2018-09-07 2021-10-26 嘉兴卓盛生物科技有限公司 一种用于提高绿麦芽品质的复合酶溶液及其使用方法
CN110452791B (zh) * 2019-08-29 2023-08-04 中粮麦芽（大连）有限公司 一种具有浓郁咖啡香气的麦芽的制备方法
CN114989907A (zh) * 2022-06-21 2022-09-02 北京燕京啤酒股份有限公司 一种制麦方法

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4251630A (en) * 1978-07-28 1981-02-17 Kurth Malting Corporation Preparation of malt high in alpha-1,6-hydrolase
US20080233175A1 (en) * 2003-07-02 2008-09-25 Brian Steer Glucanases, Nucleic Acids Encoding Them And Methods For Making And Using Them
WO2014019219A1 (en) * 2012-08-03 2014-02-06 Dupont Nutrition Biosciences Aps Enzymes

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL108157A0 (en) 1992-12-23 1994-04-12 Novo Nordisk As An enzyme with endoglucanase activity
ES2316882T3 (es) 1993-03-10 2009-04-16 Novozymes A/S Enzimas de aspergillus aculeatus con una actividad xilanasa.
US5871966A (en) 1994-05-11 1999-02-16 Novo Nordisk A/S Enzyme with endo-1,3(4)-β- Glucanase activity
AU723656B2 (en) 1996-05-03 2000-08-31 Gist-Brocades B.V. Method for making wort having improved filterability and/or increased yield
ES2262197T3 (es) 1996-12-20 2006-11-16 Novozymes A/S Endoglucanasa.
CN1798830A (zh) 2003-04-04 2006-07-05 诺维信公司 减小糖化醪的粘性
DK1706477T3 (en) 2003-12-19 2017-01-23 Novozymes As Method of meshing
WO2005100582A2 (en) 2004-03-25 2005-10-27 Novozymes Inc. Methods for degrading or converting plant cell wall polysaccharides
CA2586779A1 (en) 2004-06-03 2005-12-15 Novozymes A/S Mashing process and enzyme composition useful therein
US20090117630A1 (en) 2004-12-22 2009-05-07 Novozymes A/S Fermentation product processes
CA2910102A1 (en) 2005-04-26 2006-11-02 Novozymes A/S Hydrolysis of arabinoxylan
CN101304949A (zh) 2005-11-08 2008-11-12 诺维信北美公司 酒糟脱水
WO2008023060A1 (en) 2006-08-25 2008-02-28 Novozymes A/S Fermentation process
CN101952409B (zh) * 2007-12-12 2014-12-10 诺维信公司 酿造方法
EP2358872A2 (en) 2008-11-18 2011-08-24 Novozymes Inc. Methods and compositions for degrading cellulosic material
CN102292436A (zh) 2008-12-23 2011-12-21 丹尼斯科公司 具有木聚糖酶活性的多肽
WO2010072226A1 (en) 2008-12-23 2010-07-01 Danisco A/S Polypeptides with xylanase activity
US8765438B2 (en) 2008-12-23 2014-07-01 Dupont Nutrition Biosciences Aps Polypeptides with xylanase activity
CN102071172A (zh) * 2010-12-03 2011-05-25 吴鹏 一种能有效缩短大麦发芽时间的复合酶制剂
CN103814129A (zh) 2011-09-14 2014-05-21 杜邦营养生物科学有限公司 包含具有内切–1,4–β–木聚糖酶活性的酶和具有内切–1,3(4)–β葡聚糖酶活性的酶的组合物
AU2012387043A1 (en) * 2012-08-03 2015-02-26 Dupont Nutrition Biosciences Aps Method
CA2880776A1 (en) * 2012-08-03 2014-02-06 Dupont Nutrition Biosciences Aps Method

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4251630A (en) * 1978-07-28 1981-02-17 Kurth Malting Corporation Preparation of malt high in alpha-1,6-hydrolase
US20080233175A1 (en) * 2003-07-02 2008-09-25 Brian Steer Glucanases, Nucleic Acids Encoding Them And Methods For Making And Using Them
WO2014019219A1 (en) * 2012-08-03 2014-02-06 Dupont Nutrition Biosciences Aps Enzymes

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Scheffler, A. et al. Enz. Microb. Technol. 36: 813-817 (2005) (Year: 2005) *

Also Published As

Publication number Publication date
EP3587568A1 (en) 2020-01-01
RU2017119228A (ru) 2018-12-05
CN107109313A (zh) 2017-08-29
RU2017119228A3 (zh) 2019-05-28
AU2015341731A1 (en) 2017-05-11
WO2016071463A1 (en) 2016-05-12
BR112017008755A2 (pt) 2018-05-15
CA2966471A1 (en) 2016-05-12
MX2017005342A (es) 2017-07-28
EP3017706A1 (en) 2016-05-11
EP3215612A1 (en) 2017-09-13

Similar Documents

Publication Publication Date Title
US20170318843A1 (en) Enzymes for malting
US9279165B2 (en) Mashing process
US20170314004A1 (en) Enzymes
US20150337247A1 (en) Enzymes
EP2427550B1 (en) Enzyme complex from trichoderma reesei and p. funiculosum enzymes
WO2005118769A1 (en) Mashing process and enzyme composition useful therein
WO2015032850A1 (en) Method for production of brewers wort

Legal Events

Date Code Title Description
AS Assignment

Owner name: DUPONT NUTRITION BIOSCIENCES APS, DENMARK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:POULSEN, CHARLOTTE HORSMANS;REEL/FRAME:043292/0655

Effective date: 20170807

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION