US20150148525A1 - Methods of incorporating an amino acid comprising a bcn group into a polypeptide using an orthogonal codon encoding it and an orthorgonal pylrs synthase - Google Patents
Methods of incorporating an amino acid comprising a bcn group into a polypeptide using an orthogonal codon encoding it and an orthorgonal pylrs synthase Download PDFInfo
- Publication number
- US20150148525A1 US20150148525A1 US14/401,803 US201314401803A US2015148525A1 US 20150148525 A1 US20150148525 A1 US 20150148525A1 US 201314401803 A US201314401803 A US 201314401803A US 2015148525 A1 US2015148525 A1 US 2015148525A1
- Authority
- US
- United States
- Prior art keywords
- bcn
- polypeptide
- amino acid
- tetrazine
- group
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 150000001413 amino acids Chemical class 0.000 title claims abstract description 102
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 68
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 67
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 67
- 238000000034 method Methods 0.000 title claims abstract description 59
- 108020004705 Codon Proteins 0.000 title claims description 24
- NSVXZMGWYBICRW-UHFFFAOYSA-N 9-bicyclo[6.1.0]non-4-ynylmethanol Chemical compound C1CC#CCCC2C(CO)C21 NSVXZMGWYBICRW-UHFFFAOYSA-N 0.000 claims abstract description 128
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 claims abstract description 57
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 claims abstract description 57
- 230000035772 mutation Effects 0.000 claims abstract description 34
- -1 lysine amino acid Chemical class 0.000 claims abstract description 20
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims abstract description 15
- 239000004472 Lysine Substances 0.000 claims abstract description 15
- 108040001032 pyrrolysyl-tRNA synthetase activity proteins Proteins 0.000 claims abstract 2
- 238000006243 chemical reaction Methods 0.000 claims description 93
- DPOPAJRDYZGTIR-UHFFFAOYSA-N Tetrazine Chemical group C1=CN=NN=N1 DPOPAJRDYZGTIR-UHFFFAOYSA-N 0.000 claims description 48
- 102000003960 Ligases Human genes 0.000 claims description 24
- 108090000364 Ligases Proteins 0.000 claims description 24
- 108020005038 Terminator Codon Proteins 0.000 claims description 17
- 108020004707 nucleic acids Proteins 0.000 claims description 13
- 102000039446 nucleic acids Human genes 0.000 claims description 13
- 150000007523 nucleic acids Chemical class 0.000 claims description 13
- WGTODYJZXSJIAG-UHFFFAOYSA-N tetramethylrhodamine chloride Chemical compound [Cl-].C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C(O)=O WGTODYJZXSJIAG-UHFFFAOYSA-N 0.000 claims description 8
- 238000005304 joining Methods 0.000 claims description 3
- 238000006117 Diels-Alder cycloaddition reaction Methods 0.000 claims description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 claims description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 2
- 210000004027 cell Anatomy 0.000 description 114
- 238000002372 labelling Methods 0.000 description 111
- 235000001014 amino acid Nutrition 0.000 description 99
- 108090000623 proteins and genes Proteins 0.000 description 86
- 102000004169 proteins and genes Human genes 0.000 description 82
- 235000018102 proteins Nutrition 0.000 description 72
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 69
- HEDRZPFGACZZDS-MICDWDOJSA-N Trichloro(2H)methane Chemical compound [2H]C(Cl)(Cl)Cl HEDRZPFGACZZDS-MICDWDOJSA-N 0.000 description 62
- 239000005090 green fluorescent protein Substances 0.000 description 47
- 239000000243 solution Substances 0.000 description 46
- 150000004905 tetrazines Chemical group 0.000 description 40
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 39
- URYYVOIYTNXXBN-OWOJBTEDSA-N trans-cyclooctene Chemical class C1CCC\C=C\CC1 URYYVOIYTNXXBN-OWOJBTEDSA-N 0.000 description 38
- 239000000203 mixture Substances 0.000 description 36
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 35
- 238000010348 incorporation Methods 0.000 description 34
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 26
- 210000004962 mammalian cell Anatomy 0.000 description 26
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 24
- 230000014509 gene expression Effects 0.000 description 23
- 241000588724 Escherichia coli Species 0.000 description 21
- 239000000975 dye Substances 0.000 description 21
- 108091005946 superfolder green fluorescent proteins Proteins 0.000 description 21
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 20
- 238000003756 stirring Methods 0.000 description 20
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 19
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 18
- 101710123256 Pyrrolysine-tRNA ligase Proteins 0.000 description 17
- 238000010898 silica gel chromatography Methods 0.000 description 17
- 230000008901 benefit Effects 0.000 description 16
- 239000000047 product Substances 0.000 description 16
- 239000000523 sample Substances 0.000 description 16
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 15
- 239000013598 vector Substances 0.000 description 15
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 14
- 239000000499 gel Substances 0.000 description 14
- 229910052938 sodium sulfate Inorganic materials 0.000 description 14
- 235000011152 sodium sulphate Nutrition 0.000 description 14
- 239000012267 brine Substances 0.000 description 13
- 235000019439 ethyl acetate Nutrition 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 13
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 12
- 230000002068 genetic effect Effects 0.000 description 12
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 12
- 239000011541 reaction mixture Substances 0.000 description 12
- 239000008346 aqueous phase Substances 0.000 description 11
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 241000205275 Methanosarcina barkeri Species 0.000 description 10
- 241000205274 Methanosarcina mazei Species 0.000 description 10
- 230000015572 biosynthetic process Effects 0.000 description 10
- 238000011282 treatment Methods 0.000 description 10
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 9
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 9
- 102000001301 EGF receptor Human genes 0.000 description 9
- 108060006698 EGF receptor Proteins 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- 239000012091 fetal bovine serum Substances 0.000 description 9
- 238000002073 fluorescence micrograph Methods 0.000 description 9
- 239000012528 membrane Substances 0.000 description 9
- 239000013612 plasmid Substances 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- 239000007787 solid Substances 0.000 description 9
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 8
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- 239000012230 colorless oil Substances 0.000 description 8
- 239000013058 crude material Substances 0.000 description 8
- 238000005259 measurement Methods 0.000 description 8
- JFNLZVQOOSMTJK-KNVOCYPGSA-N norbornene Chemical compound C1[C@@H]2CC[C@H]1C=C2 JFNLZVQOOSMTJK-KNVOCYPGSA-N 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 8
- 238000001262 western blot Methods 0.000 description 8
- 230000001419 dependent effect Effects 0.000 description 7
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 7
- 239000012074 organic phase Substances 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 0 *N[C@@H](CCCCCC(=O)OC[C@H]1[C@]2([H])CCC#CCC[C@]12[H])C(=O)O.CC.CC1=CC=C(CN2CCNCC2)C=C1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CCC#CCC[C@]1([H])[C@H]2CO Chemical compound *N[C@@H](CCCCCC(=O)OC[C@H]1[C@]2([H])CCC#CCC[C@]12[H])C(=O)O.CC.CC1=CC=C(CN2CCNCC2)C=C1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CCC#CCC[C@]1([H])[C@H]2CO 0.000 description 6
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 6
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 6
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 6
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 6
- 238000002835 absorbance Methods 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 230000003197 catalytic effect Effects 0.000 description 6
- KPUWHANPEXNPJT-UHFFFAOYSA-N disiloxane Chemical compound [SiH3]O[SiH3] KPUWHANPEXNPJT-UHFFFAOYSA-N 0.000 description 6
- 235000019253 formic acid Nutrition 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- PKZBRYXOYZUZIR-DUXPYHPUSA-N (3E)-cyclooct-3-en-1-ol Chemical compound OC1CCCC\C=C\C1 PKZBRYXOYZUZIR-DUXPYHPUSA-N 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 108010026552 Proteome Proteins 0.000 description 5
- 239000004098 Tetracycline Substances 0.000 description 5
- NSVXZMGWYBICRW-ULKQDVFKSA-N [(1s,8r)-9-bicyclo[6.1.0]non-4-ynyl]methanol Chemical compound C1CC#CCC[C@@H]2C(CO)[C@@H]21 NSVXZMGWYBICRW-ULKQDVFKSA-N 0.000 description 5
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 5
- 229960000723 ampicillin Drugs 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 239000006166 lysate Substances 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 238000001228 spectrum Methods 0.000 description 5
- 229960002180 tetracycline Drugs 0.000 description 5
- 229930101283 tetracycline Natural products 0.000 description 5
- 235000019364 tetracycline Nutrition 0.000 description 5
- 150000003522 tetracyclines Chemical class 0.000 description 5
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 4
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 4
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 4
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 4
- KFSLWBXXFJQRDL-UHFFFAOYSA-N Peracetic acid Chemical compound CC(=O)OO KFSLWBXXFJQRDL-UHFFFAOYSA-N 0.000 description 4
- 150000001336 alkenes Chemical class 0.000 description 4
- 125000003275 alpha amino acid group Chemical group 0.000 description 4
- 230000006229 amino acid addition Effects 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 150000001540 azides Chemical class 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 238000006352 cycloaddition reaction Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 150000002118 epoxides Chemical class 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 238000006317 isomerization reaction Methods 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- PBMFSQRYOILNGV-UHFFFAOYSA-N pyridazine Chemical compound C1=CC=NN=C1 PBMFSQRYOILNGV-UHFFFAOYSA-N 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- AKHNMLFCWUSKQB-UHFFFAOYSA-L sodium thiosulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=S AKHNMLFCWUSKQB-UHFFFAOYSA-L 0.000 description 4
- 235000019345 sodium thiosulphate Nutrition 0.000 description 4
- 239000011550 stock solution Substances 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- FPGGTKZVZWFYPV-UHFFFAOYSA-M tetrabutylammonium fluoride Chemical compound [F-].CCCC[N+](CCCC)(CCCC)CCCC FPGGTKZVZWFYPV-UHFFFAOYSA-M 0.000 description 4
- 108020005098 Anticodon Proteins 0.000 description 3
- 241000423300 Desulfitobacterium hafniense DCB-2 Species 0.000 description 3
- 238000005698 Diels-Alder reaction Methods 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- ZFOMKMMPBOQKMC-KXUCPTDWSA-N L-pyrrolysine Chemical compound C[C@@H]1CC=N[C@H]1C(=O)NCCCC[C@H]([NH3+])C([O-])=O ZFOMKMMPBOQKMC-KXUCPTDWSA-N 0.000 description 3
- 241001474685 Methanosarcina barkeri MS Species 0.000 description 3
- 101100410821 Methanosarcina barkeri pylS gene Proteins 0.000 description 3
- 241000205290 Methanosarcina thermophila Species 0.000 description 3
- 102000007999 Nuclear Proteins Human genes 0.000 description 3
- 108010089610 Nuclear Proteins Proteins 0.000 description 3
- 108010039918 Polylysine Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 3
- 108020004566 Transfer RNA Proteins 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- MVMZFAIUUXYFGY-FYZYNONXSA-N [(5s)-5-carboxy-5-(9h-fluoren-9-ylmethoxycarbonylamino)pentyl]azanium;chloride Chemical compound Cl.C1=CC=C2C(COC(=O)N[C@@H](CCCCN)C(O)=O)C3=CC=CC=C3C2=C1 MVMZFAIUUXYFGY-FYZYNONXSA-N 0.000 description 3
- 238000007259 addition reaction Methods 0.000 description 3
- MKOSBHNWXFSHSW-UHFFFAOYSA-N bicyclo[2.2.1]hept-2-en-5-ol Chemical compound C1C2C(O)CC1C=C2 MKOSBHNWXFSHSW-UHFFFAOYSA-N 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229920000656 polylysine Polymers 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 101150052472 pylS gene Proteins 0.000 description 3
- 238000010791 quenching Methods 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 239000012723 sample buffer Substances 0.000 description 3
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 3
- 235000017557 sodium bicarbonate Nutrition 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 238000002054 transplantation Methods 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- MYRTYDVEIRVNKP-UHFFFAOYSA-N 1,2-Divinylbenzene Chemical compound C=CC1=CC=CC=C1C=C MYRTYDVEIRVNKP-UHFFFAOYSA-N 0.000 description 2
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 2
- 238000005160 1H NMR spectroscopy Methods 0.000 description 2
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 241001432458 Desulfitobacterium hafniense PCP-1 Species 0.000 description 2
- 241000981919 Desulfitobacterium hafniense Y51 Species 0.000 description 2
- 241000237641 Desulfotomaculum acetoxidans DSM 771 Species 0.000 description 2
- 241001302160 Escherichia coli str. K-12 substr. DH10B Species 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 241001148031 Methanococcoides burtonii Species 0.000 description 2
- 241001139408 Methanosarcina acetivorans C2A Species 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 2
- QPQRJUISZBATDO-DGAVXFQQSA-N [H][C@@]12CCC#CCC[C@]1([H])[C@H]2COC(=O)CCC[C@H](N)C(=O)O Chemical compound [H][C@@]12CCC#CCC[C@]1([H])[C@H]2COC(=O)CCC[C@H](N)C(=O)O QPQRJUISZBATDO-DGAVXFQQSA-N 0.000 description 2
- 230000001133 acceleration Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- 229910052786 argon Inorganic materials 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- XJHCXCQVJFPJIK-UHFFFAOYSA-M caesium fluoride Chemical compound [F-].[Cs+] XJHCXCQVJFPJIK-UHFFFAOYSA-M 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 125000003636 chemical group Chemical group 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000010779 crude oil Substances 0.000 description 2
- PKZBRYXOYZUZIR-UHFFFAOYSA-N cyclooct-3-en-1-ol Chemical compound OC1CCCCC=CC1 PKZBRYXOYZUZIR-UHFFFAOYSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- GPAYUJZHTULNBE-UHFFFAOYSA-N diphenylphosphine Chemical compound C=1C=CC=CC=1PC1=CC=CC=C1 GPAYUJZHTULNBE-UHFFFAOYSA-N 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 229920001971 elastomer Polymers 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- IKDUDTNKRLTJSI-UHFFFAOYSA-N hydrazine hydrate Chemical compound O.NN IKDUDTNKRLTJSI-UHFFFAOYSA-N 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 235000019136 lipoic acid Nutrition 0.000 description 2
- 238000001972 liquid chromatography-electrospray ionisation mass spectrometry Methods 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- XBXCNNQPRYLIDE-UHFFFAOYSA-M n-tert-butylcarbamate Chemical compound CC(C)(C)NC([O-])=O XBXCNNQPRYLIDE-UHFFFAOYSA-M 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- MPQXHAGKBWFSNV-UHFFFAOYSA-N oxidophosphanium Chemical class [PH3]=O MPQXHAGKBWFSNV-UHFFFAOYSA-N 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- ACVYVLVWPXVTIT-UHFFFAOYSA-N phosphinic acid Chemical class O[PH2]=O ACVYVLVWPXVTIT-UHFFFAOYSA-N 0.000 description 2
- 230000035484 reaction time Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 239000012312 sodium hydride Substances 0.000 description 2
- 229910000104 sodium hydride Inorganic materials 0.000 description 2
- LPXPTNMVRIOKMN-UHFFFAOYSA-M sodium nitrite Chemical compound [Na+].[O-]N=O LPXPTNMVRIOKMN-UHFFFAOYSA-M 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- DYHSDKLCOJIUFX-UHFFFAOYSA-N tert-butoxycarbonyl anhydride Chemical compound CC(C)(C)OC(=O)OC(=O)OC(C)(C)C DYHSDKLCOJIUFX-UHFFFAOYSA-N 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- 229960002663 thioctic acid Drugs 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 238000000870 ultraviolet spectroscopy Methods 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- UCPDHOTYYDHPEN-OWOJBTEDSA-N (4e)-cyclooct-4-en-1-ol Chemical compound OC1CCC\C=C\CC1 UCPDHOTYYDHPEN-OWOJBTEDSA-N 0.000 description 1
- YWFPXWMSGJXUFS-UPHRSURJSA-N (4z)-9-oxabicyclo[6.1.0]non-4-ene Chemical compound C1C\C=C/CCC2OC21 YWFPXWMSGJXUFS-UPHRSURJSA-N 0.000 description 1
- CHADEQDQBURGHL-UHFFFAOYSA-N (6'-acetyloxy-3-oxospiro[2-benzofuran-1,9'-xanthene]-3'-yl) acetate Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(OC(C)=O)C=C1OC1=CC(OC(=O)C)=CC=C21 CHADEQDQBURGHL-UHFFFAOYSA-N 0.000 description 1
- BKWQKVJYXODDAC-UHFFFAOYSA-N 1,2-dihydropyridazine Chemical compound N1NC=CC=C1 BKWQKVJYXODDAC-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 238000004679 31P NMR spectroscopy Methods 0.000 description 1
- QREZLLYPLRPULF-UHFFFAOYSA-N 4-(aminomethyl)benzonitrile;hydron;chloride Chemical compound Cl.NCC1=CC=C(C#N)C=C1 QREZLLYPLRPULF-UHFFFAOYSA-N 0.000 description 1
- HVKOQQBEIHHZLE-UHFFFAOYSA-N 9-bicyclo[6.1.0]non-6-ynylmethanol Chemical compound C1CCCC#CC2C(CO)C21 HVKOQQBEIHHZLE-UHFFFAOYSA-N 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- VXEYLYRRKZIPQR-MLEAJQHESA-N C1=C\CC[C@H]2O[C@H]2CC/1.C1=C\CC[C@H]2O[C@H]2CC/1.CC.CC1CC/C=C\CCC1.CC1CCCC(O)C(P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.OC1CC/C=C\CCC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CCC([H])(O)CCC1.[H]/C1=C(/[H])CC[C@@H](C)CCC1.[H]/C1=C(/[H])CC[C@@H](O)CCC1.[H]/C1=C(/[H])CC[C@H](C)CCC1 Chemical compound C1=C\CC[C@H]2O[C@H]2CC/1.C1=C\CC[C@H]2O[C@H]2CC/1.CC.CC1CC/C=C\CCC1.CC1CCCC(O)C(P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.OC1CC/C=C\CCC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CCC([H])(O)CCC1.[H]/C1=C(/[H])CC[C@@H](C)CCC1.[H]/C1=C(/[H])CC[C@@H](O)CCC1.[H]/C1=C(/[H])CC[C@H](C)CCC1 VXEYLYRRKZIPQR-MLEAJQHESA-N 0.000 description 1
- DGGFWCZMHUNIIK-YAAYQQSBSA-N CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@@H]2O[C@@H]2CC1.CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H]2O[C@H]2CC1.CC1CC/C=C\CCC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S Chemical compound CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@@H]2O[C@@H]2CC1.CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H]2O[C@H]2CC1.CC1CC/C=C\CCC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S DGGFWCZMHUNIIK-YAAYQQSBSA-N 0.000 description 1
- VHEMCSDCUDHZKZ-DFORQZEOSA-N CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](O)[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@@H](O)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](O)[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@H](O)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H]2O[C@@H]2CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@H]2O[C@H]2CC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S Chemical compound CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](O)[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@@H](O)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](O)[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@H](O)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H]2O[C@@H]2CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@H]2O[C@H]2CC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S VHEMCSDCUDHZKZ-DFORQZEOSA-N 0.000 description 1
- XSYJZNYPQZKSHO-WTNDHALXSA-N CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](O)[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@@H](O)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](O)[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@H](O)CC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CC[C@@H](C)CCC1.[H]/C1=C(/[H])CC[C@H](C)CCC1 Chemical compound CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](O)[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@@H]1CCC[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@@H](O)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](O)[C@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)CC1.CC(C)(C)[Si](C)(C)O[C@H]1CCC[C@@H](P(=O)(C2=CC=CC=C2)C2=CC=CC=C2)[C@H](O)CC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CC[C@@H](C)CCC1.[H]/C1=C(/[H])CC[C@H](C)CCC1 XSYJZNYPQZKSHO-WTNDHALXSA-N 0.000 description 1
- WCFBZTDXOZMQGJ-RVQAQMDHSA-N CC1CC/C=C\CCC1.OC1CC/C=C\CCC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S Chemical compound CC1CC/C=C\CCC1.OC1CC/C=C\CCC1.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S WCFBZTDXOZMQGJ-RVQAQMDHSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- XDTMQSROBMDMFD-UHFFFAOYSA-N Cyclohexane Chemical compound C1CCCCC1 XDTMQSROBMDMFD-UHFFFAOYSA-N 0.000 description 1
- 241001509319 Desulfitobacterium Species 0.000 description 1
- 241000228124 Desulfitobacterium hafniense Species 0.000 description 1
- 241000592829 Desulfotomaculum acetoxidans Species 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 1
- 101150026829 JUNB gene Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 241001422708 Methanococcoides burtonii DSM 6242 Species 0.000 description 1
- 241000205276 Methanosarcina Species 0.000 description 1
- 241000205284 Methanosarcina acetivorans Species 0.000 description 1
- 101001132142 Methanosarcina barkeri Pyrrolysine-tRNA ligase Proteins 0.000 description 1
- 241000134675 Methanosarcina barkeri str. Fusaro Species 0.000 description 1
- 241001437647 Methanosarcina mazei Go1 Species 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 102000036675 Myoglobin Human genes 0.000 description 1
- 108010062374 Myoglobin Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 108091060545 Nonsense suppressor Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- NXQRWDARQUYASW-UHFFFAOYSA-N OCC1C2CCC=CCCC12 Chemical compound OCC1C2CCC=CCCC12 NXQRWDARQUYASW-UHFFFAOYSA-N 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- PLMCYZHNEOMACG-PYYXHOJGSA-N S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C Chemical compound S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C PLMCYZHNEOMACG-PYYXHOJGSA-N 0.000 description 1
- KFHSMVYBPRZZOU-YRGNUQMOSA-N S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CC[C@@H](C)CCC1.[H]/C1=C(/[H])CC[C@@H](O)CCC1 Chemical compound S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CC[C@@H](C)CCC1.[H]/C1=C(/[H])CC[C@@H](O)CCC1 KFHSMVYBPRZZOU-YRGNUQMOSA-N 0.000 description 1
- ITISOARNTIMEPN-XARYQOBDSA-N S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H]3O[C@@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H]3O[C@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C Chemical compound S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H]3O[C@@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H]3O[C@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C ITISOARNTIMEPN-XARYQOBDSA-N 0.000 description 1
- HCUBFWJCMFIKII-CPTIVNFASA-N S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CC[C@@H](O)[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H]3O[C@@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](O)[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H]3O[C@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C Chemical compound S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H][C@@]12CC[C@@H](O)[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H]3O[C@@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](O)[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H]3O[C@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C HCUBFWJCMFIKII-CPTIVNFASA-N 0.000 description 1
- GNUMHYZBXZWACQ-UUTWLKPLSA-N S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CC[C@]2([H])[C@@H](CO[Si](C3=CC=CC=C3)(C3=CC=CC=C3)C(C)(C)C)[C@]2([H])CC1.[H][C@@]12CC[C@@H](O)[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](O)[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[NaH] Chemical compound S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S=S.[H]/C1=C(/[H])CC[C@]2([H])[C@@H](CO[Si](C3=CC=CC=C3)(C3=CC=CC=C3)C(C)(C)C)[C@]2([H])CC1.[H][C@@]12CC[C@@H](O)[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](O)[C@@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H](P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)[C@@H](O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[NaH] GNUMHYZBXZWACQ-UUTWLKPLSA-N 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- GPDSTJCNHAYIII-KJWSHHAVSA-N [H]/C1=C(/[H])CC[C@]2([H])[C@@H](CO)[C@]2([H])CC1.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO.[H][C@@]12CCC(O)C(P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CCC(P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)C(O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H]3O[C@@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H]3O[C@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C Chemical compound [H]/C1=C(/[H])CC[C@]2([H])[C@@H](CO)[C@]2([H])CC1.[H][C@@]12CC/C=C\CC[C@]1([H])[C@H]2CO.[H][C@@]12CCC(O)C(P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CCC(P(=O)(C3=CC=CC=C3)C3=CC=CC=C3)C(O)CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@@H]3O[C@@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C.[H][C@@]12CC[C@H]3O[C@H]3CC[C@]1([H])[C@H]2CO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C GPDSTJCNHAYIII-KJWSHHAVSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- XPOLVIIHTDKJRY-UHFFFAOYSA-N acetic acid;methanimidamide Chemical compound NC=N.CC(O)=O XPOLVIIHTDKJRY-UHFFFAOYSA-N 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001345 alkine derivatives Chemical class 0.000 description 1
- 239000004411 aluminium Substances 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- PFYXSUNOLOJMDX-UHFFFAOYSA-N bis(2,5-dioxopyrrolidin-1-yl) carbonate Chemical compound O=C1CCC(=O)N1OC(=O)ON1C(=O)CCC1=O PFYXSUNOLOJMDX-UHFFFAOYSA-N 0.000 description 1
- AZWXAPCAJCYGIA-UHFFFAOYSA-N bis(2-methylpropyl)alumane Chemical compound CC(C)C[AlH]CC(C)C AZWXAPCAJCYGIA-UHFFFAOYSA-N 0.000 description 1
- 238000001460 carbon-13 nuclear magnetic resonance spectrum Methods 0.000 description 1
- 108020001778 catalytic domains Proteins 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000013626 chemical specie Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000011903 deuterated solvents Substances 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- IJKVHSBPTUYDLN-UHFFFAOYSA-N dihydroxy(oxo)silane Chemical compound O[Si](O)=O IJKVHSBPTUYDLN-UHFFFAOYSA-N 0.000 description 1
- SIPUZPBQZHNSDW-UHFFFAOYSA-N diisobutylaluminium hydride Substances CC(C)C[Al]CC(C)C SIPUZPBQZHNSDW-UHFFFAOYSA-N 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000000132 electrospray ionisation Methods 0.000 description 1
- 238000000295 emission spectrum Methods 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- PQVSTLUFSYVLTO-UHFFFAOYSA-N ethyl n-ethoxycarbonylcarbamate Chemical compound CCOC(=O)NC(=O)OCC PQVSTLUFSYVLTO-UHFFFAOYSA-N 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 238000003818 flash chromatography Methods 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 238000001215 fluorescent labelling Methods 0.000 description 1
- PTCGDEVVHUXTMP-UHFFFAOYSA-N flutolanil Chemical compound CC(C)OC1=CC=CC(NC(=O)C=2C(=CC=CC=2)C(F)(F)F)=C1 PTCGDEVVHUXTMP-UHFFFAOYSA-N 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 238000007654 immersion Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 238000013383 initial experiment Methods 0.000 description 1
- JEIPFZHSYJVQDO-UHFFFAOYSA-N iron(III) oxide Inorganic materials O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 1
- YOBAEOGBNPPUQV-UHFFFAOYSA-N iron;trihydrate Chemical compound O.O.O.[Fe].[Fe] YOBAEOGBNPPUQV-UHFFFAOYSA-N 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- GLXDVVHUTZTUQK-UHFFFAOYSA-M lithium hydroxide monohydrate Substances [Li+].O.[OH-] GLXDVVHUTZTUQK-UHFFFAOYSA-M 0.000 description 1
- 229940040692 lithium hydroxide monohydrate Drugs 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000003760 magnetic stirring Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 150000002848 norbornenes Chemical class 0.000 description 1
- 238000000655 nuclear magnetic resonance spectrum Methods 0.000 description 1
- 239000011022 opal Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000012286 potassium permanganate Substances 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 238000004237 preparative chromatography Methods 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 150000003138 primary alcohols Chemical class 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 1
- 238000010926 purge Methods 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 239000012047 saturated solution Substances 0.000 description 1
- 150000003333 secondary alcohols Chemical class 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000003595 spectral effect Effects 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- MHYGQXWCZAYSLJ-UHFFFAOYSA-N tert-butyl-chloro-diphenylsilane Chemical compound C=1C=CC=CC=1[Si](Cl)(C(C)(C)C)C1=CC=CC=C1 MHYGQXWCZAYSLJ-UHFFFAOYSA-N 0.000 description 1
- BCNZYOJHNLTNEZ-UHFFFAOYSA-N tert-butyldimethylsilyl chloride Chemical compound CC(C)(C)[Si](C)(C)Cl BCNZYOJHNLTNEZ-UHFFFAOYSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/58—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
- G01N33/582—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances with fluorescent label
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/006—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length of peptides containing derivatised side chain amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C271/00—Derivatives of carbamic acids, i.e. compounds containing any of the groups, the nitrogen atom not being part of nitro or nitroso groups
- C07C271/06—Esters of carbamic acids
- C07C271/08—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms
- C07C271/10—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms
- C07C271/22—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/13—Labelling of peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2/00—Peptides of undefined number of amino acids; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/93—Ligases (6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
- C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
- C12Y601/01026—Pyrrolysine-tRNAPyl ligase (6.1.1.26)
-
- C07C2102/24—
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2602/00—Systems containing two condensed rings
- C07C2602/02—Systems containing two condensed rings the rings having only two atoms in common
- C07C2602/14—All rings being cycloaliphatic
- C07C2602/24—All rings being cycloaliphatic the ring system containing nine carbon atoms, e.g. perhydroindane
Definitions
- the invention relates to site-specific incorporation of bio-orthogonal groups via the (expanded) genetic code.
- the invention relates to incorporation of chemical groups into polypeptides via accelerated inverse electron demand Diels-Alder reactions between genetically incorporated amino acid groups such as dienophiles, and chemical groups such as tetrazines.
- bio-orthogonal groups via genetic code expansion provides a powerful general strategy for site specifically labelling proteins with any probe.
- the slow reactivity of the bio-orthogonal functional groups that can be genetically encoded has limited this strategy's utility.
- enzyme mediated labeling approaches may be rapid, but use protein or peptide fusions that introduce perturbations into the protein under study and may limit the sites that can be labeled, while many ‘bio-orthogonal’ reactions for which a component can be genetically encoded are too slow to effect the quantitative and site specific labeling of proteins on a time-scale that is useful to study many biological processes.
- TCO trans-cycclooctene containing amino acid
- the present invention seeks to overcome problem(s) associated with the prior art.
- the present inventors have provided a new amino acid bearing a bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) group.
- BCN bicyclo[6.1.0]non-4-yn-9-ylmethanol
- This allows a dramatically increased reaction rate, which is advantageous.
- this allows a single-product addition reaction to be carried out.
- This leads to a homogeneous product, which is an advantage.
- This also eliminates isomeric variations (spatial isomers) in the product, which provides technical benefits in a range of applications as demonstrated herein.
- the product of the BCN addition reaction does not epimerise, whereas the products from (for example) norbornene and/or TCO reactions do give rise to epimers.
- the problems of epimers are also avoided.
- the invention provides a polypeptide comprising an amino acid having a bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) group.
- BCN bicyclo[6.1.0]non-4-yn-9-ylmethanol
- This has the advantage of providing a single reaction product following addition of (for example) tetrazine compounds. Alternate techniques such as norbornene addition or TCO addition give a mixture of products comprising different isomers, such as regio or stereo isomers.
- One reason for this advantage is that the BCN part of the molecule has mirror symmetry so that the product is the same, whereas for TCO/norbornene that part of the molecule is chiral and so attachment can be to the ‘top face’ or ‘bottom face’ of the double bond, leading to different isomers in the products.
- the invention provides the advantage of homogeneity of product when used in the attachment of further groups to the polypeptide such as tetrazine compounds.
- said BCN group is present as a residue of a lysine amino acid.
- the invention in another aspect, relates to a method of producing a polypeptide comprising a BCN group, said method comprising genetically incorporating an amino acid comprising a BCN group into a polypeptide.
- nucleic acid encoding the polypeptide which nucleic acid comprises an orthogonal codon encoding the amino acid having a BCN group
- said amino acid comprising a BCN group is a BCN lysine.
- said orthogonal codon comprises an amber codon (TAG), said tRNA comprises MbtRNA CUA .
- said amino acid having a BCN group comprises a bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) lysine.
- said tRNA synthetase comprises a PylRS synthetase having the mutations Y271M, L274G and C313A (BCNRS).
- said amino acid having a BCN group is incorporated at a position corresponding to a lysine residue in the wild type polypeptide.
- the invention relates to a polypeptide as described above which comprises a single BCN group.
- the polypeptide comprises a single BCN group.
- This has the advantage of maintaining specificity for any further chemical modifications which might be directed at the BCN group. For example when there is only a single BCN group in the polypeptide of interest then possible issues of partial modification (e.g. where only a subset of BCN groups in the polypeptide are subsequently modified), or issues of reaction microenvironments varying between alternate BCN groups in the some polypeptides (which could lead to unequal reactivity between different BCN group(s) at different locations in the polypeptide) are advantageously avoided.
- a key advantage of incorporation of a BCN group is that is permits a range of extremely useful further compounds such as labels to be easily and specifically attached to the BCN group.
- the invention relates to a polypeptide as described above wherein said BCN group is joined to a tetrazine group.
- the invention relates to a polypeptide as described above wherein said tetrazine group is further joined to a fluorophore.
- said fluorophore comprises fluorescein, tetramethyl rhodamine (TAMRA) or boron-dipyrromethene (BODIPY).
- TAMRA tetramethyl rhodamine
- BODIPY boron-dipyrromethene
- the invention relates to a novel unnatural amino acid comprising a BCN group.
- the invention relates to an amino acid comprising bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN).
- the invention relates to an amino acid which is bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) lysine.
- BCN lysine as described above has the structure:
- the invention in another aspect, relates to a method of producing a polypeptide comprising a tetrazine group, said method comprising providing a polypeptide as described above, contacting said polypeptide with a tetrazine compound, and incubating to allow joining of the tetrazine to the BCN group by on inverse electron demand Diels-Alder cycloaddition reaction.
- the tetrazine is selected from 6 to 17 of FIG. 1 .
- the pseudo first order rate constant for the reaction is at least 80 M ⁇ 1 s ⁇ 1 .
- the tetrazine is selected from 6, 7, 8 and 9 of FIG. 1 and the pseudo first order rate constant for the reaction is at least 80 M ⁇ 1 s ⁇ 1 .
- This chemistry has the advantage of speed of reaction.
- reaction is allowed to proceed for 10 minutes or less.
- reaction is allowed to proceed for 1 minute or less.
- reaction is allowed to proceed for 30 seconds or less.
- reaction times may affect reaction times. Most suitably the shortest times such as 30 seconds or less are applied to in vitro reactions.
- Reactions in vivo, or in eukaryotic culture conditions such as tissue culture medium or other suitable media for eukaryotic cells may need to be conducted for longer than 30 seconds to achieve maximal labelling.
- the skilled operator can determine optimum reaction times by trial and error based on the guidance provided herein.
- said tetrazine compound is a tetrazine compound selected from the group consisting of 11 and 17 of FIG. 1 .
- the invention relates to a PylRS tRNA synthetase comprising the mutations Y271M, L274G and C313A.
- said PylRS tRNA synthetase has a sequence corresponding to MbPylRS tRNA synthetase comprising the mutations Y271M, L274G and C313A.
- the invention relates to the use of the PylRS tRNA synthetase(s) of the invention for the incorporation of amino acid comprising bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) into a polypeptide.
- BCN bicyclo[6.1.0]non-4-yn-9-ylmethanol
- the invention relates to a method for the incorporation of amino acid comprising bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) into a polypeptide comprising use of the PylRS tRNA synthetase(s) of the invention to incorporate same.
- BCN bicyclo[6.1.0]non-4-yn-9-ylmethanol
- the invention relates to a homogenous recombinant polypeptide as described above.
- said polypeptide is made by a method as described above.
- polypeptide produced according to the method(s) described herein. As well as being the product of those new methods, such a polypeptide has the technical feature of comprising BCN.
- Mutating has it normal meaning in the art and may refer to the substitution or truncation or deletion of the residue, motif or domain referred to. Mutation may be effected at the polypeptide level e.g. by synthesis of a polypeptide having the mutated sequence, or may be effected at the nucleotide level e.g. by making a nucleic acid encoding the mutated sequence, which nucleic acid may be subsequently translated to produce the mutated polypeptide. Where no amino acid is specified as the replacement amino acid for a given mutation site, suitably a randomisation of said site is used. As a default mutation, alanine (A) may be used. Suitably the mutations used at particular site(s) are as set out herein.
- a fragment is suitably at least 10 amino acids in length, suitably at least 25 amino acids, suitably at least 50 amino acids, suitably at least 100 amino acids, suitably at least 200 amino acids, suitably at least 250 amino acids, suitably at least 300 amino acids, suitably at least 313 amino acids, or suitably the majority of the polypeptide of interest.
- a polypeptide comprising an amino acid having a dienophile group characterised in that said dienophile group comprises a bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) group.
- BCN bicyclo[6.1.0]non-4-yn-9-ylmethanol
- the methods of the invention may be practiced in vivo or in vitro.
- the methods of the invention are not applied to the human or animal body.
- the methods of the invention are in vitro methods.
- the methods do not require the presence of the human or animal body.
- the methods are not methods of diagnosis or of surgery or of therapy of the human or animal body.
- the invention relates to a polypeptide comprising an amino acid having a dienophile group capable of reacting with a tetrazine group.
- said dienophile group is present as a residue of a lysine amino acid.
- the invention relates to a method of producing a polypeptide comprising a dienophile group, said method comprising genetically incorporating an amino acid comprising a dienophile group into a polypeptide.
- nucleic acid encoding the polypeptide which nucleic acid comprises an orthogonal codon encoding the amino acid having a dienophile group
- said amino acid comprising a dienophile group is a dienophile lysine.
- said orthogonal codon comprises an amber codon (TAG)
- said tRNA comprises MbtRNA CUA
- said amino acid having a dienophile group comprises a trans-cyclooctene-4-ol (TCO) containing amino acid
- said tRNA synthetase comprises a PylRS synthetase having the mutations Y271A, L274M and C313A (TCORS).
- said PylRS tRNA synthetase has a sequence corresponding to MbPylRS tRNA synthetase comprising the mutations Y271A, L274M and C313A (TCORS).
- the invention relates to the use of the PylRS tRNA synthetase(s) of the invention for the incorporation of amino acid comprising trans-cyclooctene-4-ol (TCO) into a polypeptide.
- the invention relates to a method for the incorporation of amino acid comprising trans-cyclooctene-4-ol (TCO) into a polypeptide comprising use of the PylRS tRNA synthetase(s) of the invention to incorporate same.
- TCO trans-cyclooctene-4-ol
- BCN tetrazine reaction leads to the formation of a single product. This may be an advantage in applications where homogeneity in the orientation of probe attachment may be important, including single molecule spectroscopy, and FRET approaches.
- said genetic incorporation preferably uses an orthogonal or expanded genetic code, in which one or more specific orthogonal codons have been allocated to encode the specific amino acid residue with the BCN group so that it can be genetically incorporated by using on orthogonal tRNA synthetase/tRNA pair.
- the orthogonal tRNA synthetase/tRNA pair can in principle be any such pair capable of charging the tRNA with the amino acid comprising the BCN group and capable of incorporating that amino acid comprising the BCN group into the polypeptide chain in response to the orthogonal codon.
- the orthogonal codon may be the orthogonal codon amber, ochre, opal or a quadruplet codon.
- the codon simply has to correspond to the orthogonal tRNA which will be used to carry the amino acid comprising the BCN group.
- the orthogonal codon is amber.
- the anticodon region of the tRNA may simply be swapped for the desired anticodon region for the codon of choice.
- the anticodon region is not involved in the charging or incorporation functions of the tRNA nor recognition by the tRNA synthetase so such swaps are entirely within the ambit of the skilled operator.
- orthogonal tRNA synthetase/tRNA pairs may be used if desired.
- the orthogonal synthetase/tRNA pair are Methanosarcina barkeri MS pyrrolysine tRNA synthetase (MbPylRS) and its cognate amber suppressor tRNA (MbtRNA CUA ).
- McPylRS Methanosarcina barkeri MS pyrrolysine tRNA synthetase
- MctRNA CUA amber suppressor tRNA
- the Methanosarcina barkeri PylT gene encodes the MbtRNA CUA tRNA.
- the Methanosarcina barkeri PylS gene encodes the MbPylRS tRNA synthetase protein.
- MbPylRS Methanosarcina barkeri pyrrolysyl ⁇ tRNA synthetase amino acid sequence as the reference sequence (i.e. as encoded by the publicly available wild type Methanosarcina barkeri PylS gene Accession number Q46E77):
- Said sequence has been annotated here below as SEQ ID NO. 1.
- MbPylRS tRNA synthetase protein may be mutating it so as to optimise for the BCN amino acid to be used.
- the need for mutation depends on the BCN amino acid used.
- An example where the MbPylRS tRNA synthetase may need to be mutated is when the BCN amino acid is not processed by the MbPylRS tRNA synthetase protein.
- Such mutation may be carried out by introducing mutations into the MbPylRS tRNA synthetase, for example at one or more of the following positions in the MbPylRS tRNA synthetase: M241, A267, Y271, L274 and C313.
- said amino acid having a BCN group comprises a bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN) lysine.
- said tRNA synthetase comprises a PylRS synthetase such as MbPylRS having the mutations Y271M, L274G and C313A (BCNRS).
- said amino acid having a dienophile group comprises a trans-cyclooctene-4-ol (TCO) containing amino acid.
- said tRNA synthetase comprises a PylRS synthetase such as MbPylRS having the mutations Y271A, L274M and C313A (TCORS).
- tRNA synthetase of the invention may be varied. Although specific tRNA synthetase sequences may have been used in the examples, the invention is not intended to be confined only to those examples.
- any tRNA synthetase which provides the same tRNA charging (aminoacylation) function can be employed in the invention.
- the tRNA synthetase may be from any suitable species such as from archea, for example from Methanosarcina barkeri MS; Methanosarcina barkeri sir, Fusaro; Methanosarcina mazei Gol; Methanosarcina acetivorans C2A; Methanosarcina thermophila ; or Methanococcoides burtonii .
- the tRNA synthetase may be from bacteria, for example from Desulfitobacterium hafniense DCB-2 ; Desulfitobacterium hafniense Y51 ; Desulfitobacterium hafniense PCP1 ; Desulfotomaculum acetoxidans DSM 771.
- Exemplary sequences from these organisms are the publically available sequences.
- the following examples are provided as exemplary sequences for pyrrolysine tRNA synthetases:
- barkeri MS/1-419/ Methanosarcina barkeri MS VERSION Q6WRH6.1 GI: 74501411 MDKKPLDVLISATGLWMSRTGTLHKIKHHEVSRSKIYIEMACGDHLVVNNSRSCRTARAFRHHKYRKTC KRCRVSDEDINNFLTRSTESKNSVKVRVVSAPKVKKAMPKSVSRAPKPLENSVSAKASTNTSRSVPSPAK STPNSSVPASAPAPSLTRSQLDRVEALLSPEDKISLNMAKPFRELEPELVTRRKNDFQRLYTNDREDYLGK LERDITKFFVDRGFLEIKSPILIPAEYVERMGINNDTELSKQIFRVDKNLCLRPMLAPTLYNYLRKLDRILPGP IKIFEVGPCYRKESDGKEHLEEFTMVNFCQMGSGCTRENLEALIKEFLDYLEIDFEIVGDSCMVYGDTL DIMHGDLELSSAVVGPVSLDREWGIDKPWIGAGFGLERLLK
- thermophila /1-478 Methanosarcina thermophila VERSION DQ017250.1 GI: 67773308 MDKKPLNTUSATGLWMSRTGKLHKIRHHEVSKRKIYIEMECGERLVVNNSRSCRAARALRHHKYRKIC KHCRVSDEDLNKFLTRTNEDKSNAKVTVVSAPKIRKVMPKSVARTPKPLENTAPVQTLPSESQPAPTTPIS ASTTAPASTSTTAPAPASTTAPAPASTTAPASASTTISTSAMPASTSAQGTTKFNYISGGFPRPIPVQASAP ALTKSQIDRLQGLLSPKDEISLDSGTPFRKLESELLSRRRKDLKQIYAEEREHYLGKLEREITKFFVDRGFLEIK SPILIPMEYIERMGIDNDKELSKQIFRVDNNFCLRPMLAPNLYNYLRKLNRALPDPIKTFBGPCYRKESDG KEHLEERMLNFCQMGSGCTRENEAHKDFLDYLGIDFEIVGD
- hafniense _DCB-2/1-279 Desulfitobacterium hafniense DCB-2 VERSION YP_002461289.1 GI: 219670854 MSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLEL EEGLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERL WDKPIRIFEIGTCYRKESQGAQHLNEFTMLNTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSV VYGDTVDVMKGDLELASGAMGPHFLDEKWEIVDPWVGLGFGLERLLMIREGTQHVQSMARSLSYL DGVRLNIN > D.
- hafniense _Y51/1-312 Desulfitobacterium hanfniense Y51 VERSION YP_521192.1 GI: 89897705 MDRIDHTDSKFVQAGETPVLPATFMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDR AFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEGLAKALHQQGFVQVVTPTIITSKALAKMTIGEDH PLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNTELGT PLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIVD PWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN >D.
- tRNA charging (aminoacylation) function When the particular tRNA charging (aminoacylation) function has been provided by mutating the tRNA synthetase, then it may not be appropriate to simply use another wild-type tRNA sequence, for example one selected from the above. In this scenario, it will be important to preserve the same tRNA charging (aminoacylation) function. This is accomplished by transferring the mutation(s) in the exemplary tRNA synthetase into an alternate tRNA synthetase backbone, such as one selected from the above.
- Target tRNA synthetase proteins/backbones may be selected by alignment to known tRNA synthetases such as exemplary M. barkeri and/or M. mazei sequences.
- FIG. 6 provides an alignment of all PylS sequences. These can have a low overall % sequence identity. Thus it is important to study the sequence such as by aligning the sequence to known tRNA synthetases (rather than simply to use a low sequence identity score) to ensure that the sequence being used is indeed a tRNA synthetase.
- sequence identity when sequence identity is being considered, suitably it is considered across the tRNA synthetases as in FIG. 6 .
- % identity may be as defined from FIG. 6 .
- FIG. 7 shows a diagram of sequence identities between the tRNA synthetases.
- % identity may be as defined from FIG. 7 .
- FIG. 8 aligns just the catalytic regions. The aim of this is to provide a tRNA catalytic region from which a high % identity can be defined to capture/identify backbone scaffolds suitable for accepting mutations transplanted in order to produce the same tRNA charging (aminoacylation) function, for example new or unnatural amino acid recognition.
- sequence identity when sequence identity is being considered, suitably it is considered across the catalytic region as in FIG. 8 .
- the % identity may be as defined from FIG. 8 .
- FIG. 9 shows a diagram of sequence identities between the catalytic regions.
- the % identity may be as defined from FIG. 9 .
- ‘Transferring’ or ‘transplanting’ mutations onto an alternate tRNA synthetase backbone can be accomplished by site directed mutagenesis of a nucleotide sequence encoding the tRNA synthetase backbone. This technique is well known in the art. Essentially the backbone pylS sequence is selected (for example using the active site alignment discussed above) and the selected mutations are transferred to (i.e. made in) the corresponding/homologous positions.
- MbPylRS Methanosarcina barkeri pyrrolysyl-tRNA synthetase amino acid sequence as the reference sequence (i.e. as encoded by the publicly available wild type Methanosarcina barkeri PylS gene Accession number Q46E77):
- L266M means that the amino acid corresponding to L at position 266 of the wild type sequence is replaced with M.
- transplantation of mutations between alternate tRNA backbones is now illustrated with reference to exemplary M. barkeri and M. mazei sequences, but the same principles apply equally to transplantation onto or from other backbones.
- Mb AcKRS is an engineered synthetase for the incorporation of AcK Parental protein/backbone: M. barkeri PylS
- PCKRS engineered synthetase for the Incorporation of PCK
- Synthetases with the same substrate specificities can be obtained by transplanting these mutations into M. mazei PylS.
- the sequence homology of the two synthetases con be seen in FIG. 10 .
- the following synthetases may be generated by transplantation of the mutations from the Mb backbone onto the Mm tRNA backbone: Mm AcKRS introducing mutations L301V, L305I, Y306F, L309A, C348F into M. mazei PylS,
- Mm PCKRS introducing mutations M276F, A302S, Y306C, L309M into M. mazei PylS.
- Transplanted polypeptides produced in this manner should advantageously be tested to ensure that the desired function/substrate specificities have been preserved.
- Polynucleotides encoding the polypeptide of interest for the method described above can be incorporated into a recombinant replicable vector.
- the vector may be used to replicate the nucleic acid in a compatible host cell.
- the invention provides a method of making polynucleotides of the invention by introducing a polynucleotide of the invention into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
- the vector may be recovered from the host cell. Suitable host cells include bacteria such as E. coli.
- a polynucleotide of the invention in a vector is operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the host cell, i.e. the vector is an expression vector.
- operably linked means that the components described are in a relationship permitting them to function in their intended manner.
- a regulatory sequence “operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences.
- Vectors of the invention may be transformed or transfected into a suitable host cell as described to provide for expression of a protein of the invention. This process may comprise culturing a host cell transformed with an expression vector as described above under conditions to provide for expression by the vector of a coding sequence encoding the protein, and optionally recovering the expressed protein.
- the vectors may be for example, plasmid or virus vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide and optionally a regulator of the promoter.
- the vectors may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid. Vectors may be used, for example, to transfect or transform a host cell.
- Control sequences operably linked to sequences encoding the protein of the invention include promoters/enhancers and other expression regulation signals. These control sequences may be selected to be compatible with the host cell for which the expression vector is designed to be used in.
- promoter is well-known in the art and encompasses nucleic acid regions ranging in size and complexity from minimal promoters to promoters including upstream elements and enhancers.
- Another aspect of the invention is a method, such as an in vitro method, of incorporating the BCN containing amino acid(s) genetically and site-specifically into the protein of choice, suitably in a eukaryotic cell.
- One advantage of incorporating genetically by said method is that it obviates the need to deliver the proteins comprising the BCN amino acid into a cell once formed, since in this embodiment they may be synthesised directly in the target cell.
- the method comprises the following steps:
- Step (i) entails or replacing a specific codon with an orthogonal codon such as an amber codon at the desired site in the genetic sequence of the protein.
- This can be achieved by simply introducing a construct, such as a plasmid, with the nucleotide sequence encoding the protein, wherein the site where the BCN containing amino acid is desired to be introduced/replaced is altered to comprise an orthogonal codon such as an amber codon.
- a construct such as a plasmid
- Step (ii) requires an orthogonal expression system to specifically incorporate the BCN containing amino acid at the desired location (e.g. the amber codon).
- a specific orthogonal tRNA synthetase such as an orthogonal pyrollysyl-tRNA synthetase and a specific corresponding orthogonal tRNA pair which are together capable of charging said tRNA with the BCN containing amino acid are required. Examples of these are provided herein.
- Host cells comprising polynucleotides of the invention may be used to express proteins of the invention.
- Host cells may be cultured under suitable conditions which allow expression of the proteins of the invention.
- Expression of the proteins of the invention may be constitutive such that they are continually produced, or inducible, requiring a stimulus to initiate expression.
- protein production can be initiated when required by, for example, addition of an inducer substance to the culture medium, for example dexamethasone or IPTG.
- Proteins of the invention can be extracted from host cells by a variety of techniques known in the art, including enzymatic, chemical and/or osmotic lysis and physical disruption.
- Proteins of the invention can be purified by standard techniques known in the art such as preparative chromatography, affinity purification or any other suitable technique.
- FIG. 1 shows structural formulae of unnatural amino acids 1 to 5 and tetrazine derivatives (6-17) used in this study.
- TAMRA-X, Bodipy TMR-X, Bodipy-FL and CFDA are common names for fluorophores; their structural formulae are shown in Supplementary Figure S4).
- FIG. 2 shows kinetic and spectrometric characterization of the BCN-tetrazine reaction.
- FIG. 3 shows efficient, genetically encoded incorporation of unnatural amino acids using the BCNRS/tRNA CUA or TCORS/tRNA CUA pair in E. coli .
- FIG. 4 shows rapid and specific labeling of recombinant proteins with tetrazine-fluorophores.
- tetrazine-dye conjugate 11 10 eq
- SDS-PAGE and in-gel fluorescence For sfGFP-His 6 produced in the presence of 3 only very faint, sub-stoichiometric labeling is visible.
- FIG. 5 shows site specific incorporation of 1 and 2 into proteins in mammalian cells and the rapid and specific labeling of cell surface and intracellular mammalian proteins with 11.
- a) Western blots demonstrate that the expression of full length mCherry(TAG)eGFP-HA is dependent on the presence of 1 or 2 and tRNA CUA .
- BCNRS, TCORS are FLAG tagged.
- EGFR-GFP bearing 1, 2 or 5 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels). Treatment of cells with 11 (400 nM) leads to selective labeling of EGFR that contains 1 or 2 (middle panels).
- FIG. 6 shows alignment of PylS sequences.
- FIG. 7 shows sequence identity of PylS sequences.
- FIG. 8 shows alignment of the catalytic domain of PylS sequences (from 350 to 480; numbering from alignment of FIG. 6 ).
- FIG. 9 shows sequence identity of the catalytic domains of PylS sequences.
- FIG. 10 shows alignment of synthetases with transplanted mutations based on M. barkeri PylS or M. mazei PylS. The red asterisks indicate the mutated positions.
- FIG. 11 shows scheme 1. We demonstrate the synthesis, genetic encoding and fluorogenic labeling of unnatural amino acids 1 and 2 in vitro, in E. coli and in mammalian cells.
- FIG. 12 shows LC/MS traces (254 nm) showing the formation of pyridazine products (6-BCN, 7-BCN, 9-BCN, 8-BCN) from reaction of the corresponding tetrazines (6, 7, 9 and 8) with 2 equivalents of BCN (exo/endo mixture ⁇ 4/1) in MeOH. All masses are given in Daltons. The HPLC traces were taken after incubating the reactions for 10 to 30 minutes at room temperature. The overall yield for conversion to pyridazine products was >98%.
- FIG. 13 shows determination of rate constants k for the reaction of various tetrazines with BCN by UV-spectroscopy using a stopped-flow device.
- (a) Response of the UV absorbance at 320 nm of compound 6 upon BCN addition (100 eq 5 mM); by fitting the data to a single exponential equation, k′ values were determined (left panel); each measurement was carried out three to five times and the mean of the observed rates k′ was plotted against the concentration of BCN to obtain the rate constant k from the slope of the plot. For all four tetrazines complete measurement sets were done in duplicate (middle and right panel) and the mean of values is reported in Supplementary Table 1.
- FIG. 14 shows determination of rate constants k for the reaction of tetrazines 6 and 7 with TCO by UV-spectroscopy using a stopped-flow device.
- (a) Response of the UV absorbance at 320 nm of compound 6 upon TCO addition (100 eq 5 mM): by fitting the data to the sum of two single exponential equations, k′ values for the fast single exponential equations were determined (left panel): each measurement was carried out three to five times and observed rates k′ were plotted against the concentration of TCO to obtain the rate constant k from the slope of the plot.
- k′ values for the fast single exponential equations were determined (left panel): each measurement was carried out three to five times and observed rates k′ were plotted against the concentration of TCO to obtain the rate constant k from the slope of the plot.
- FIG. 15 (Supplementary Figure S4) shows structural formulae of various tetrazine-fluorophores used in this study. Details on synthesis and characterization of these tetrazine-fluorophores can be found in reference 2.
- FIG. 16 shows “Turn on” fluorescence of tetrazine—fluorophores upon reaction with 9-hydroxymethylbicyclo[6.1.0]nonyne (BCN).
- BCN 9-hydroxymethylbicyclo[6.1.0]nonyne
- FIG. 17 shows amino acid dependent expression of sfGFP-Hiss bearing an amber codon at position 150.
- the expressed protein was detected in lysates using an anti-Hiss antibody.
- Using purified exo or endo diastereomers of amino acid 1 demonstrated that the exo form is preferentially incorporated into sfGFP by BCNRS/tRNA CUA .
- FIG. 18 shows LC-MS characterization of the labelling reaction of sfGFP-1 with various tetrazines. Black peaks denote the found mass of sfGFP-1 before labelling, colored peaks the found masses after reaction of sfGFP-1 with 6, 7, 9 and 8. All masses are given in Daltons. Labelling with all tetrazines is specific and quantitative.
- Reaction conditions to a ⁇ 10 ⁇ M solution of sfGFP-1 (in 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 7.4) 10 equivalents of the corresponding tetrazine (1 mM stock solution in methanol) were added and the reaction mixture incubated for 10 to 30 minutes at room temperature.
- FIG. 19 shows LC-MS shows specific and quantitative labelling of sfGFP-1 with tetrazine fluorophore conjugates 12, 16, 13 and 14. Red peaks denote the found mass of sfGFP-1 before labelling, colored peaks the found masses after reaction of sfGFP-1 with 12(a), 16(b), 13(c) and 14(d). Expected and found mass values are given in Daltons. Labelling with all tetrazine-fluorophores is specific and quantitative.
- Reaction conditions to a ⁇ 10 ⁇ M solution of sfGFP-1 (in 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 7.4) 10 equivalents of the corresponding tetrazine dye (2 mM stock solution in DMSO) were added and the reaction mixture incubated for 10 to 30 minutes at room temperature.
- FIG. 20 shows specificity of labeling 1 and 2 in stGFP versus the E. coli proteome.
- the coomassie stained gel shows proteins from E. coli producing sfGFP in the presence of the indicated concentration of unnatural amino acids 1, 2, 3 (both exo and endo diastereomers) and 5.
- In gel fluorescence gels show specific labeling with tetrazine-dye conjugate 11.
- amino acids 1, 2 and 3-exo are incorporated at a similar level (as judged from coomassie stained gels and western blots), we observe only very faint, sub-stoichiometric labeling of sfGFP produced in the presence of 3-exo and 3-endo.
- FIG. 21 shows specificity of labeling 1 in sfGFP versus the E. coli proteome.
- Lanes 1-5 Coomassie stained gel showing proteins from E. coli producing sfGFP in the presence of the indicated concentration of unnatural amino acids 1 and 5.
- Lanes 6-10 The expressed protein was detected in lysates using an anti-His6 antibody.
- Lanes 11-15 fluorescence images of protein labeled with the indicated fluorophore 11.
- FIG. 22 shows specific and ultra-rapid labelling of EGFR-GFP with tetrazine-fluorophore conjugate 11 for 2 minutes.
- EGFR-GFP bearing 1 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels).
- Treatments of cells with 11 leads to selective labelling of EGFR-GFP containing 1 (middle panels).
- FIG. 23 shows specific and ultra-rapid labelling of EGFR-GFP with tetrazine-fluorophore conjugate 11 for 5 minutes.
- EGFR-GFP bearing 1 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels).
- Treatments of cells with 11 (400 nM) leads to selective labelling of EGFR-GFP containing 1 (middle panels).
- FIG. 24 shows specific and ultra-rapid labelling of EGFR-GFP with tetrazine-fluorophore conjugate 11 for 10 minutes.
- EGFR-GFP bearing 1 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels).
- Treatments of cells with 11 (400 nM) leads to selective labelling of EGFR-GFP containing 1 (middle panels).
- FIG. 25 shows that in contrast to the ultra-rapid labelling of EGFR-GFP containing amino acid 1, it took 2 hours to specifically label cells bearing EGFR-4-GFP with tetrazine-fluorophore conjugate 11.
- FIG. 26 shows specific and ultra-rapid labelling of EGFR-GFP with tetrazine-fluorophore conjugate 11 for 2 minutes.
- EGFR-GFP bearing 2 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels).
- 11 400 nM
- Cells were imaged 2 minutes after addition of 11. No labelling was observed for cells in the same sample that did not express EGFR-GFP, and cells bearing EGFR-5-GFP were not labeled with 11.
- FIG. 27 shows specific and ultra-rapid labelling of EGFR-GFP with tetrazine-fluorophore conjugate 11 for 5 minutes.
- EGFR-GFP bearing 2 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels).
- 11 400 nM
- Cells were imaged 5 minutes after addition of 11. No labelling was observed for cells in the same sample that did not express EGFR-GFP, and cells bearing EGFR-5-GFP were not labeled with 11.
- FIG. 28 shows site specific incorporation of 3 in mammalian cells and the labeling of EGFR-GFP with tetrazine-fluorophore conjugate 11 for 30 and 60 minutes.
- a) Western blots demonstrate that the expression of full length mCherry(TAG)eGFP-HA is dependent on the presence of 3 or 5 and tRNA CUA .
- BCNRS and PylRS are FLAG tagged.
- B and c) EGFR-GFP in the presence 3 at position 128 is visible as green fluorescence at the membrane of transfected cells (left panels).
- FIG. 29 shows specific and ultra-rapid labelling of a nuclear protein in live mammalian cells.
- Jun-1-mCherry is visible as red fluorescence in the nuclei of transfected cells (left panels).
- Treatment of cells with the cell permeable tetrazine dye 17 (200 nM) leads to selective labeling of jun-1-mCherry (middle panel).
- Right panels show merged red and green fluorescence.
- DIC differential interference contrast. Cells were imaged 15 minutes after addition of 11. No labelling was observed for cells in the some sample that did not express jun-mCherry, and cells bearing jun-5-mCherry were not labeled with 11
- the fluorogenic reaction between BCN and these tetrazines is advantageous for imaging experiments since it maximizes the labeling signal while minimizing fluorescence arising from the free tetrazine fluorophore.
- the PylRS/tRNA CUA pair is emerging as perhaps the most versatile system for incorporating unnatural amino acids into proteins since it is orthogonal in a range of hosts, allowing synthetases evolved in E. coli to be used for genetic code expansion in a growing list of cells and organisms, including: E. coli, Salmonella typhimurium , yeast, human cells and C. elegans 7,27-31 .
- the amino acids were synthesized as described in the Supplementary Information.
- MbPylRS/tRNA CUA pair was screened along with a panel of mutants of MbPylRS, previously generated in our laboratory for the site-specific incorporation of diverse unnatural amino acids into proteins, for their ability to direct the incorporation of 1, 2 and 3 in response to an amber codon introduced at position 150 in a C-terminally hexahistidine- (His 6 ) tagged superfolder green fluorescent protein (sfGFP).
- the MbPylRS/tRNA CUA pair did not direct the incorporation of any of the unnatural amino acids tested, as judged by western blot against the C-terminal His 6 tag.
- cells containing a mutant of MbPylRS, containing three amino acid substitutions Y271M, L274G, C313A 32 in the enzyme active site (which we named BCN-tRNA synthetase, BCNRS), and a plasmid that encodes MbtRNA CUA and sfGFP-His 6 with an amber codon at position 150 (psfGFP150TAGPylT-His 6 ) led to amino acid dependent synthesis of full length sfGFP-His 6 , as judged by anti-Hiss western blot and coomassie staining ( FIG. 3 a ).
- ESI-MS demonstrates that sfGFP-1 can be efficiently and specifically derivatized with a range of tetrazines 6, 7, 8 and 9 (Supplementary Figure S7), and with tetrazine fluorophore conjugates 12, 13, 14 and 16 (Supplementary Figure S8).
- tetrazines 6, 7, 8 and 9 tetrazines 6, 7, 8 and 9
- tetrazine fluorophore conjugates 12, 13, 14 and 16 Supplementary Figure S8
- purified sfGFP-2-His 6 can be quantitatively labeled with tetrazine fluorophore 11 ( FIGS. 4 a and 4 c ).
- tetrazine fluorophore 11 FIGS. 4 a and 4 c
- EGFR epidermal growth factor receptor
- GFP green fluorescent protein
- E. coli DH10B cells To express sfGFP with incorporated unnatural amino acid 1, we transformed E. coli DH10B cells with pBKBCNRS (which encodes MbBCNRS) and psfGFP150TAGPylT-His 6 (which encodes MbtRNA CUA and a C-terminally hexahistidine tagged sfGFP gene with an amber codon at position 150).
- pBKBCNRS which encodes MbBCNRS
- psfGFP150TAGPylT-His 6 which encodes MbtRNA CUA and a C-terminally hexahistidine tagged sfGFP gene with an amber codon at position 150.
- the extract was clarified by centrifugation (20 min, 21.000 g, 4° C.), 600 ⁇ L of Ni 2+ -NTA beads (Qiagen) were added to the extract and the mixture was incubated with agitation for 1 h at 4° C. Beads were collected by centrifugation (10 min, 1000 g). The beads were three times resuspended in 30 mL wash buffer (20 mM Tris-HCl, 30 mM imidazole, 300 mM NaCl, pH 8) and spun down at 1000 g. Subsequently, the beads were resuspended in 10 mL of wash buffer and transferred to a column.
- the protein was eluted with 3 ml of wash buffer supplemented with 200 mM imidazole and further purified by size-exclusion chromatography employing a HiLoad 16/60 Superdex 75 Prep Grade column (GE Life Sciences) at a flow rate of 1 mL/min (buffer: 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 7.4). Fractions containing the protein were pooled and concentrated with an Amicon Ultra-15 3 kDa MWCO centrifugal filter device (Millipore). Purified proteins were analyzed by 4-12% SDS-PAGE and their mass confirmed by mass spectrometry (see Supplementary Information).
- sfGFP-2, sfGFP-3 were prepared in the same way, expect that cells were transformed with pBKTCORS (which encodes MbTCORS) and psfGFP150TAGPylT-His 6 (which encodes MbtRNA CUA and a C-terminally hexahistidine tagged sfGFP gene with an amber codon at position 150).
- pBKTCORS which encodes MbTCORS
- psfGFP150TAGPylT-His 6 which encodes MbtRNA CUA and a C-terminally hexahistidine tagged sfGFP gene with an amber codon at position 150.
- SfGFP with incorporated 4 and 5 were prepared in the same way, expect that cells were transformed with pBKPylRS (which encodes MbPylRS) and psfGFP150TAGPylT-His 6 (which encodes MbtRNA CUA and a C-terminally hexahistidine tagged sfGFP gene with an amber codon at position 150). Yields of purified proteins were up to 6-12 mg/L.
- ESI-MS was carried out with a 6130 Quadrupole spectrometer.
- the solvent system consisted of 0.2% formic acid in H 2 O as buffer A, and 0.2% formic acid in acetonitrile (MeCN) as buffer B.
- LC-ESI-MS on proteins was carried out using a Phenomenex Jupiter C4 column (150 ⁇ 2 mm, 5 ⁇ m) and samples were analyzed in the positive mode, following protein UV absorbance at 214 and 280 nm. Total protein masses were calculated by deconvolution within the MS Chemstation software (Agilent Technologies).
- protein total mass was determined on an LCT time-of-flight mass spectrometer with electrospray ionization (ESI, Micromass). Proteins were rebuffered in 20 mM of ammonium bicarbonate and mixed 1:1 acetonitrile, containing 1% formic acid. Alternatively samples were prepared with a C4 Ziptip (Millipore) and infused directly in 50% aqueous acetonitrile containing 1% formic acid. Samples were injected at 10 ⁇ L min ⁇ 1 and calibration was performed in positive ion mode using horse heart myoglobin. 30 scans were averaged and molecular masses obtained by maximum entropy deconvolution with MassLynx version 4.1 (Micromass). Theoretical masses of wild-type proteins were calculated using Protparam (http://us.expasy.org/tools/protparam.html), and theoretical masses for unnatural amino acid containing proteins were adjusted manually.
- Protparam http://us.expasy.org
- sfGFP-1 or sfGFP-2 Purified recombinant sfGFP with site-specifically incorporated 1 or 2, sfGFP-1 or sfGFP-2 ( ⁇ 10 ⁇ M in 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 7.4), was incubated with 10 equivalents of the tetrazine-dye conjugates 11, 12, 13, 14, 15 or 16, respectively (2 mM in DMSO). The solution was incubated at room temperature and aliquots were taken after 30 min to 3 hours and analyzed by SDS PAGE and —after desalting with a C4-ZIPTIP—by ESI-MS. The SDS PAGE gels were either stained with coomassie or scanned with a Typhoon imager to visualize in-gel fluorescence ( FIG. 4 and Supplementary Figure S8).
- E. coli DH10B cells containing either psfGFP150TAGPylT-His 6 and pBKBCNRS or psfGFP150TAGPylT-His 6 and pBKPylRS were inoculated into LB containing ampicillin (for pBKBCNRS, 100 ⁇ g/mL) or kanamycin (for pBKPylRS 50 ⁇ g/mL) and tetracycline (25 ⁇ g/mL). The cells were incubated with shaking overnight at 37° C., 250 rpm.
- 2 mL of overnight culture was used to inoculate into 100 mL of LB supplemented with ampicillin (50 ⁇ g/mL) and tetracycline (12 ⁇ g/mL) or kanamycin (25 ⁇ g/mL) and tetracycline (12 ⁇ g/mL) and incubated at 37° C.
- OD 600 0.5
- 3 ml culture aliquots were removed and supplemented with different concentrations (1 mM, 2 mM and 5 mM) of 1 and 1 mM of 5. After 30 min of incubation with shaking at 37° C., protein expression was induced by the addition of 30 ⁇ L of 20% arabinose.
- cells were collected by centrifugation (16000 g, 5 min) of 1 mL of cell suspension. The cells were resuspended in PBS buffer, spun down again and the supernatant was discarded. This process was repeated twice more. Finally, the washed cell pellet was suspended in 100 ⁇ L PBS and incubated with 3 ⁇ L of tetrazine-dye conjugate 11 (2 mM in DMSO) at rt for 30 minutes.
- tetrazine-dye conjugate 11 2 mM in DMSO
- the cells were resuspended in 100 ⁇ L of NuPAGE LDS sample buffer supplemented with 5% ⁇ -mercaptoethanol, heated at 90° C. for 10 min and centrifuged at 16000 g for 10 min.
- the crude cell lysate was analyzed by 4-12% SDS-PAGE to assess protein levels.
- Gels were either Coomassie stained or scanned with a Typhoon imager to make fluorescent bands visible (Supplementary Figures S9 and S10).
- Western blots were performed with antibodies against the hexahistidine tag (Cell Signaling Technology, His tag 27E8 mouse mAb #2366).
- Rate constants k for different tetrazines were measured under pseudo first order conditions with a 10- to 100-fold excess of BCN or TCO in methanol/water mixtures by following the exponential decay in UV absorbance of the tetrazine at 320, 300 or 280 nm over time with a stopped-flow device (Applied Photophysics, Supplementary Figures S2 and S3 and Supplementary Table 1).
- Stock solutions were prepared for each tetrazine (0.1 mM in 9/1 water/methanol) and for BCN and TCO (1 to 10 mM in methanol). Both tetrazine and BCN and TCO solutions were thermostatted in the syringes of the stopped flow device before measuring.
- the plasmids pMmPylS-mCherry-TAG-EGFP-HA 1,2 and pMmPylRS-EGFR-(128TAG)-GFP-HA 2 were both digested with the enzymes AflII and EcoRV (NEB) to remove the wild-type MmPylRS.
- a synthetic gene of the mutant synthetase MbBCNRS and MbTCORS was made by GeneArt with the same flanking sites.
- the synthetic MbBCNRS and MbTCORS were also digested with AflII and EcoRV and cloned in place of the wild-type synthetase (MmPylS).
- pMbBCNRS-mCherry-TAG-EGFP-HA pMbBCNRS-EGFR(128TAG)-GFP-HA
- pMbTCORS-EGFR(128TAG)-GFP-HA were created.
- the pCMV-cJun-TAG-mCherry-MbBCNRS plasmid was created from a pCMV-cJun-TAG-mCherry-MmPylRS plasmid (created by Fiona Townsley) by exchanging MmPylRS for MbBCNRS. This was carried out as for the pMbBCNRS-mCherry-TAG-EGFP-HA plasmid.
- HEK293 cells were plated on poly-lysine coated ⁇ -dishes (Ibidi). After growing to near confluence in 10% fetal bovine serum (FBS) Dulbecco's modified eagle medium (DMEM) cells were transfected with 2 ⁇ g of pMbBCNRS-EGFR(128TAG)-GFP-HA and 2 ⁇ g of p4CMVE-U6-PylT (which contains four copies of the wild-type pyrrolysyl tRNA) 1,2 using lipofectamin 2000 (Life Technologies). After transfection cells were left to grow overnight in 10% FBS DMEM at 37° C. and 5% CO 2 .
- FBS fetal bovine serum
- DMEM Dulbecco's modified eagle medium
- the samples were run out by SDS-PAGE, transferred to a nitrocellulose membrane and blotted using primary rat anti-HA (Roche) and mouse anti-FLAG (Ab frontier), secondary antibodies were anti-rat (Santa Cruz Biotech) and anti-mouse (Cell Signaling) respectively.
- Cells were plated onto a poly-lysine coated ⁇ -dish and after growing to near confluence were transfected with 2 ⁇ g each of pMbBCNRS-EGFR(128TAG)-GFP-HA or pMbTCORS-EGFR(128TAG)-GFP-HA and p4CMVE-U6-PylT. After 8-16 hours growth at 37° C. and at 5% CO 2 in DMEM with 0.1% FBS in the presence of 0.5 mM 1 (0.5% DMSO), 1 mM 2 or 1 mM 3 cells were washed in DMEM with 0.1% FBS and then incubated in DMEM with 0.1% FBS overnight.
- Controls were performed similarly but transfected with pMmPylRS-EGFR(128TAG)-GFP-HA instead of pMbBCNRS-EGFR(128TAG)-GFP-HA.
- Cells were grown overnight in the presence of 1 mM 5 and in the absence or presence of 0.5% DMSO (as would be the case for amino acid 1).
- Cells were plated onto a poly-lysine coated ⁇ -dish and after growing to near confluence were transfected with 2 ⁇ g each of pCMV-cJun-TAG-mCherry and p4CMVE-U6-PylT. After approximately 16 hrs growth at 37° C. and at 5% CO 2 in DMEM with 0.1% FBS in the presence of 0.5 mM 1 (0.5% DMSO) cells were washed in DMEM 0.1% FBS and then incubated in DMEM 0.1% FBS overnight. The following day cells were washed repeatedly, using two media exchanges followed by 30 minutes incubation over 2 hours. 200 nM tetrazine-dye conjugate 11 was added for 15 minutes, the cells were then repeatedly washed again for 90 mins. Imaging was carried out as for the cell surface labeling
- NMR spectra were recorded on a Bruker UltrashieldTM 400 Plus spectrometer ( 1 H: 400 MHz, 13 C: 101 MHz, 31 P: 162 MHz). Chemical shifts ( ⁇ ) are reported in ppm and are referenced to the residual non-deuterated solvent peak: CDCl 3 (7.26 ppm), d 6 -DMSO (2.50 ppm) for 1 H-NMR spectra, CDCl 3 (77.0 ppm), d 6 -DMSO (39.5 ppm) for 13 C-NMR spectra. 13 C- and 31 P-NMR resonances are proton decoupled. Coupling constants (J) are measured to the nearest 0.1 Hz and are presented as observed.
- Splitting patterns are designated as follows: s, singlet; d, doublet; t, triplet; q, quartet; quin, quintet; sext, sextet; m, multiplet.
- Analytical thin-layer chromatography was carried out on silica 60F-254 plates. The spots were visualized by UV light (254 nm) and/or by potassium permanganate staining. Flash column chromatography was carried out on silica gel 60 (230-400 mesh or 70-230 mesh).
- ESI-MS was carried out using an Agilent 1200 LC-MS system with a 6130 Quadrupole spectrometer.
- the solvent system consisted of 0.2% formic acid in H 2 O as buffer A, and 0.2% formic acid in acetonitrile (MeCN) as buffer B.
- Small molecule LC-MS was carried out using a Phenomenex Jupiter C18 column (150 ⁇ 2 mm, 5 m). Variable wavelengths were used and MS acquisitions were carried out in positive and negative ion modes.
- Preparative HPLC purification was carried out using a Varian PrepStar/ProStar HPLC system, with automated fraction collection from a Phenomenex C18 column (250 ⁇ 30 mm, 5 ⁇ m). Compounds were identified by UV absorbance at 191 nm. All solvents and chemical reagents were purchased from commercial suppliers and used without further purification.
- Bicyclo[6.1.0]non-4-yn-9-ylmethanol (BCN, exo/endo mixture ⁇ 4/1) was purchased from SynAffix, Netherlands. Non-aqueous reactions were carried out in oven-dried glassware under an inert atmosphere of argon unless stated otherwise. All water used experimentally was distilled. Brine refers to a saturated solution of sodium chloride in water.
- exo-Bicyclo[6.1.0]non-4-yn-9-ylmethanol (exo-BCN, S18) was synthesised according to a literature procedure. 3
- N,N′-disuccinimidyl carbonate (1.38 g, 5.37 mmol) was added to a stirring solution of exo-BCN-OH S18 (538 mg, 3.58 mmol) and triethylamine (2.0 mL, 14.3 mmol) in MeCN (10 mL) at 0° C. The solution was warmed to room temperature and stirred for 3 h and concentrated under reduced pressure. The crude oil was purified through a short pad of silica gel chromatography (eluting with 60% EtOAc in hexane) to yield the exo-BCN-succinimidyl carbonate, which was used without further purification.
- exo-BCN-OSu (1.25 g, 4.29 mmol) in DMF (4 mL) was added via cannula to a stirring solution of Fmoc-Lys-OH.HCl (2.61 g, 6.45 mmol) and DIPEA (1.49 mL, 8.58 mmol) in DMF (10 mL).
- the solution was stirred at room temperature for 14 h, diluted with Et 2 O (100 mL) and washed with H 2 O (3 ⁇ 100 mL).
- the organic phase was dried over sodium sulfate, filtered and concentrated under reduced pressure.
- exo-H-BCNK-OH 1 was further purified by reverse-phase HPLC (0:1 H 2 O:MeCN to 9:1 H 2 O:MeCN gradient).
- a glass vial (Biotage® Ltd.) equipped with a magnetic stirring bar was charged with compound 6 (39.2 mg, 0.096 mmol) and was sealed with an air-tight aluminium/rubber septum. The contents in the vial were dried in vacuo and purged with argon gas ( ⁇ 3). MeOH (1 ml) was added to the vial, followed by addition of a solution of exo-Bicyclo[6.1.0]non-4-yn-9-ylmethanol (exo-BCN, S18) (20.2 mg in 1 ml of MeOH, 0.1344 mmol). The mixture was stirred at room temperature. Within 2 min, the reaction mixture decolorised and the contents were left stirring for additional 1 min.
- Tetrazine 10 was synthesised by modification of a literature procedure. 4 Hydrazine monohydrate (1.024 mL, 21.10 mmol) was added to a stirring suspension of tert-butylcarbamate S22 (98 mg, 0.44 mmol), formamidine acetate (439 mg, 4.22 mmol), and Zn(OTf) 2 (77 mg, 0.22 mmol) in 1,4-dioxane (0.5 mL) at room temperature. The reaction was heated to 60° C. and stirred for 16 h. The reaction was cooled to room temperature and diluted with EtOAc (10 mL).
- the reaction was washed with 1M HCl (10 mL) and the aqueous phase extracted with EtOAc (2 ⁇ 5 mL). The organic phase was dried over sodium sulfate, filtered and evaporated under reduced pressure. The resulting crude residue was dissolved in a mixture of DCM and acetic acid (1:1, 5 mL), and NaNO 2 (584 mg, 8.44 mmol) was added slowly over a period of 15 minutes, during which time the reaction turned bright red. The nitrous fumes were chased with an active air purge and the reaction then diluted with DCM (25 mL).
- reaction mixture was washed with sodium bicarbonate (sat., aq., 25 mL) and the aqueous phase extracted with DCM (2 ⁇ 10 mL). The organic phase was dried over sodium sulfate, filtered and evaporated under reduced pressure. The resulting residue was purified by silica gel chromatography (20% EtOAc in hexane) to yield tetrazine 10 as a pink solid (85 mg, 70%).
- E-5-hydroxycyclooctene and E-exo-Bicyclo[6.1.0]non-4-ene-9-ylmethanol were either made by previously described photochemical procedures 5,6 , or by the non-photochemical protocols described below.
- Diisobutylaluminium hydride (1.0 M solution in cyclohexane, 89 mL, 89 mmol) was added drop-wise to a stirring solution of commercially available 9-oxabicyclo[6.1.0]non-4-ene S24 (10 g, 80.53 mmol) in DCM (300 mL) at 0° C. The solution was stirred at 0° C. for 30 min, warmed to room temperature and stirred for 16 h. After this time, the reaction was cooled to 0° C. and propan-2-ol (50 mL) was added slowly followed by HCl (1M, aq., 100 mL). The aqueous phase was extracted with DCM (3 ⁇ 200 mL).
- tert-Butyl(chloro)dimethylsilane (13.3 g, 88.0 mmol) was added to a stirring solution of cyclooctene-4-ol S25 (5.6 g, 44.0 mmol), imidazole (7.5 g, 0.11 mol) and DMAP (1 crystal) in DCM (30 mL) at 0° C.
- the solution was warmed to room temperature and stirred for 90 min, during which time a white precipitate formed.
- the reaction was cooled to 0° C., diluted with DCM (100 mL) and sodium bicarbonate (sat., aq., 100 mL) was added. The phases were separated and the aqueous phase was extracted with DCM (3 ⁇ 100 mL).
- n-Butyllithium (2.5 M in hexanes, 14.8 mL, 37.0 mmol) was added drop-wise over 15 min to a stirring solution of epoxides S27/S28 (7.9 g, 30.8 mmol) and diphenylphosphine (6.43 mL, 37.0 mmol) in THF (80 mL) at ⁇ 78° C.
- the resulting mixture was stirred at ⁇ 78° C. for 1 h, warmed to room temperature and stirred for 14 h.
- the reaction mixture was diluted with THF (80 mL) and cooled to 0° C.
- Tetrabutylammonium fluoride (1M solution in THF, 23.8 mL. 23.8 mmol) and cesium fluoride (1.08 g, 7.14 mmol) were added to a stirring solution of silyl ether S34 (573 mg, 2.38 mmol) in MeCN (5 mL) at room temperature. The resulting mixture was wrapped in tin foil and stirred at room temperature for 36 h. After this period the reaction was cooled to 0° C., diluted with DCM (100 mL) and H 2 O (100 mL) was added. The phases were separated, the organic phase washed with brine (2 ⁇ 100 mL), dried over sodium sulfate, filtered and concentrated under reduced pressure.
- Succimidyl carbonate S36 200 mg, 0.75 mmol was added to a stirring solution of Fmoc-Lys-OH.HCl (303 mg, 0.75 mmol) and DIPEA (0.19 g, 1.50 mmol) in DMF (7.5 mL) at 0° C. The solution was warmed to room temperature, wrapped in tin foil and stirred for 12 h. After this period the solution was concentrated under reduced pressure and purified by silica gel chromatography (0-10% MeOH in DCM) to yield Fmoc-TCOK-OH S37/S38 as a yellow oil that still contained DMF (350 mg, 81%).
- tert-Butyl(chloro)diphenylsilane (7.45 g, 27.1 mmol) was added to a stirring solution of exo-bicyclo[6.1.0]non-4-ene-9-ylmethanol S18 (2.75 g, 18.1 mmol), imidazole (2.15 g, 31.6 mmol) and DMAP (2.21 g, 18.1 mmol) in DCM (35 ml) at 0° C.
- the solution was warmed to room temperature and stirred for 24 h, during which a white precipitate formed.
- the reaction was cooled to 0° C., diluted with DCM (100 mL) and sodium bicarbonate (sat., aq., 100 mL) was added. The phases were separated and the aqueous phase was extracted with DCM (3 ⁇ 100 mL). The combined organics were washed with brine (200 mL), dried over sodium sulfate, filtered and concentrated under reduced pressure.
- n-Butyllithium (2.5 M in hexanes, 5.92 mL, 14.8 mmol) was added drop wise over 15 min to a stirring solution of epoxides S40/S41 (5.47 g, 13.5 mmol) and diphenylphosphine (2.57 mL, 14.80 mmol) in THF (50 mL) at ⁇ 78° C.
- THF 50 mL
- the resulting mixture was stirred at ⁇ 78° C. for 1 h, warmed to room temperature and stirred for additional 14 h.
- the reaction mixture was diluted with THF (80 mL) and cooled to 0° C.
- Acetic acid (1.54 mL, 26.9 mmol) was added followed by addition of hydrogen peroxide (30% solution in H 2 O, 3.05 mL, 26.9 mmol).
- the reaction mixture was warmed to room temperature and stirred for 4 h.
- Sodium thiosulfate (sat., aq., 100 mL) was added and the mixture stirred for 10 min.
- the aqueous phase was extracted with EtOAc (3 ⁇ 200 mL). The combined organics were washed with brine (3 ⁇ 200 mL), dried over sodium sulfate, filtered and concentrated under reduced pressure.
- Tetrabutylammonium fluoride (1M solution in THF, 10.0 ml, 10.0 mmol) was added to a stirring solution of silyl ether S46 (0.78 g, 2 mmol) in THF (5 mL) at room temperature, wrapped in tin foil and stirred for 45 min. After this period, the reaction mixture was concentrated under reduced pressure, diluted with DCM (100 mL) and washed with brine (100 mL). The phases were separated and the organic phase washed with brine (2 ⁇ 100 mL). The combined organics were dried over sodium sulfate, filtered and concentrated under reduced pressure.
- pNO 2 -phenyl carbonate S48 (250 mg, 0.79 mmol) was added to a stirring solution of Fmoc-Lys-OH.HCl (478 mg, 1.18 mmol) and DIPEA (0.27 mL, 1.58 mmol) in DMF (3 mL) at 0° C. The solution was warmed to room temperature, wrapped in tin foil and stirred for 16 h. After this period the solution was concentrated under reduced pressure and purified by silica gel chromatography (0-5% MeOH in DCM) to yield Fmoc-exo-sTCOK S49 as a white foam (373 mg, 87%).
- Lithium hydroxide monohydrate (94 mg, 0.75 mmol) was added to a stirring solution of exo-sTCOK S49 in THF:H 2 O (3:1, 8 mL). The solution was wrapped in tin foil, stirred for 4 h at room temperature and EtOAc (100 mL) and H 2 O (100 mL) were added. The aqueous phase was carefully acidified to pH 4 by the addition of AcOH and extracted with EtOAc (4 ⁇ 100 mL). The aqueous phase was evaporated under reduced pressure and freeze-dried to yield exo-sTCOK 3 as a white solid.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Analytical Chemistry (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Enzymes And Modification Thereof (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Applications Claiming Priority (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1208875.3A GB201208875D0 (en) | 2012-05-18 | 2012-05-18 | Methods |
| GB1208875.3 | 2012-05-18 | ||
| GB1210303.2 | 2012-06-08 | ||
| GBGB1210303.2A GB201210303D0 (en) | 2012-06-08 | 2012-06-08 | Polypeptides and methods |
| PCT/GB2013/051249 WO2013171485A1 (en) | 2012-05-18 | 2013-05-15 | Methods of incorporating an amino acid comprising a bcn group into a polypeptide using an orthogonal codon encoding it and an orthorgonal pylrs synthase. |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2013/051249 A-371-Of-International WO2013171485A1 (en) | 2012-05-18 | 2013-05-15 | Methods of incorporating an amino acid comprising a bcn group into a polypeptide using an orthogonal codon encoding it and an orthorgonal pylrs synthase. |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/872,826 Division US11732001B2 (en) | 2012-05-18 | 2020-05-12 | Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20150148525A1 true US20150148525A1 (en) | 2015-05-28 |
Family
ID=48748281
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/401,803 Abandoned US20150148525A1 (en) | 2012-05-18 | 2013-05-15 | Methods of incorporating an amino acid comprising a bcn group into a polypeptide using an orthogonal codon encoding it and an orthorgonal pylrs synthase |
| US16/872,826 Active US11732001B2 (en) | 2012-05-18 | 2020-05-12 | Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase |
| US18/198,205 Abandoned US20230340013A1 (en) | 2012-05-18 | 2023-05-16 | Polypeptides and methods |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/872,826 Active US11732001B2 (en) | 2012-05-18 | 2020-05-12 | Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase |
| US18/198,205 Abandoned US20230340013A1 (en) | 2012-05-18 | 2023-05-16 | Polypeptides and methods |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US20150148525A1 (https=) |
| EP (1) | EP2852664B1 (https=) |
| JP (1) | JP6343604B2 (https=) |
| CN (2) | CN108410827B (https=) |
| BR (1) | BR112014028588B1 (https=) |
| CA (1) | CA2873793C (https=) |
| IN (1) | IN2014DN09922A (https=) |
| WO (1) | WO2013171485A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10774039B2 (en) | 2014-03-14 | 2020-09-15 | United Kingdom Research And Innovation | Cyclopropene amino acids and methods |
| US11732001B2 (en) | 2012-05-18 | 2023-08-22 | United Kingdom Research And Innovation | Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase |
| US12286657B2 (en) | 2018-10-26 | 2025-04-29 | United Kingdom Research And Innovation | Methods and compositions |
| US12378547B2 (en) | 2019-05-14 | 2025-08-05 | United Kingdom Research And Innovation | Synthetic genome |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104744293B (zh) * | 2013-12-31 | 2016-08-17 | 深圳先进技术研究院 | 胆碱类似物及其制备方法和应用、由染料分子标记的四嗪探针及其制备方法和应用 |
| WO2016176689A1 (en) | 2015-04-30 | 2016-11-03 | Oregon State University | Reagents and methods for bioorthogonal labeling of biomolecules in living cells |
| US10906990B2 (en) * | 2015-08-19 | 2021-02-02 | Riken | Antibody with non-natural amino acid introduced therein |
| CN105254655B (zh) * | 2015-11-20 | 2017-03-22 | 江汉大学 | 一种基于bodipy的荧光氨基酸及其合成方法与应用 |
| CN106565762B (zh) * | 2016-11-17 | 2018-10-23 | 陕西师范大学 | 一种原位产生近红外荧光的bodipy类染料及其制备和应用 |
| SG10202107829YA (en) | 2017-03-22 | 2021-08-30 | Genentech Inc | Hydrogel cross-linked hyaluronic acid prodrug compositions and methods |
| JOP20190245A1 (ar) | 2017-04-20 | 2019-10-15 | Novartis Ag | أنظمة توصيل إطلاق مستدام تتضمن روابط بلا أثر لنقطة الربط |
| US11560384B2 (en) | 2017-05-04 | 2023-01-24 | University Of Utah Research Foundation | Benzonorbornadiene derivatives and reactions thereof |
| AR111963A1 (es) * | 2017-05-26 | 2019-09-04 | Univ California | Método y moléculas |
| AR116566A1 (es) | 2018-10-03 | 2021-05-19 | Novartis Ag | Administración sostenida de polipéptidos similares a la angiopoyetina 3 |
| CN111849929B (zh) * | 2019-04-30 | 2021-05-11 | 苏州鲲鹏生物技术有限公司 | 高效引入赖氨酸衍生物的氨酰基—tRNA合成酶 |
| IL267744A (en) * | 2019-06-30 | 2019-08-29 | Nat Inst Biotechnology Negev Ltd | Labelling molecules and methods of use thereof |
| CN115701451B (zh) * | 2021-08-02 | 2023-08-01 | 宁波鲲鹏生物科技有限公司 | 高效引入赖氨酸衍生物的氨酰基-tRNA合成酶及其应用 |
| AU2024262114A1 (en) | 2023-04-28 | 2025-10-09 | United Kingdom Research And Innovation | ACYL-tRNA SYNTHETASES |
| GB202307998D0 (en) | 2023-05-29 | 2023-07-12 | Res & Innovation Uk | Aminoacyl-irna synthetase sets |
| CN119613545B (zh) * | 2024-12-16 | 2025-09-16 | 天津大学 | 非天然氨基酸修饰的抗ccl5纳米抗体 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110027829A1 (en) * | 2007-10-30 | 2011-02-03 | Medical Research Council | Methods and Compositions |
| WO2011136645A1 (en) * | 2010-04-27 | 2011-11-03 | Stichting Katholieke Universiteit, More Particularly Radboud University Nijmegen | Fused cyclooctyne compounds and their use in metal-free click reactions |
| US20130066063A1 (en) * | 2011-09-09 | 2013-03-14 | John Cooke Hodges | Bicyclo[6.1.0]non-4-yne regents for chemical modification of oligonucleotides |
| US20150005481A1 (en) * | 2012-01-20 | 2015-01-01 | North Carlolina State University | Norbornene Modified Peptides and Their Labelling With Tetrazine Compounds |
Family Cites Families (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040029129A1 (en) * | 2001-10-25 | 2004-02-12 | Liangsu Wang | Identification of essential genes in microorganisms |
| JP5275566B2 (ja) | 2003-06-18 | 2013-08-28 | ザ スクリプス リサーチ インスティチュート | 反応性非天然アミノ酸遺伝コード付加 |
| WO2005019415A2 (en) * | 2003-07-07 | 2005-03-03 | The Scripps Research Institute | Compositions of orthogonal lysyl-trna and aminoacyl-trna synthetase pairs and uses thereof |
| AU2004321117B2 (en) | 2003-12-18 | 2010-09-02 | The Scripps Research Institute | Selective incorporation of 5-hydroxytryptophan into proteins in mammalian cells |
| CA2580840A1 (en) | 2004-09-21 | 2006-03-30 | The Scripps Research Institute | In vivo incorporation of alkynyl amino acids into proteins in eubacteria |
| EP1807515A4 (en) | 2004-10-27 | 2008-06-18 | Scripps Research Inst | Orthogonal translation components for the in vivo incorporation of unnatural amino acids |
| US8431558B2 (en) * | 2004-11-01 | 2013-04-30 | The Regents Of The University Of California | Compositions and methods for modification of biomolecules |
| JP2007037445A (ja) | 2005-08-02 | 2007-02-15 | Institute Of Physical & Chemical Research | tRNA合成方法、核酸、アミノアシルtRNA合成方法及び非天然型アミノ酸組み込み蛋白質の製造方法 |
| US20090081669A1 (en) | 2006-02-01 | 2009-03-26 | Encode Bio, Inc. | Fluorescent Assays Using Orthogonal tRNA - Aminoacyl Synthetase Pairs |
| US20080096819A1 (en) | 2006-05-02 | 2008-04-24 | Allozyne, Inc. | Amino acid substituted molecules |
| US20090110662A1 (en) | 2007-04-30 | 2009-04-30 | Intezyne Technologies, Inc. | Modification of biological targeting groups for the treatment of cancer |
| JP5590649B2 (ja) * | 2007-09-20 | 2014-09-17 | 独立行政法人理化学研究所 | 変異体ピロリジル−tRNA合成酵素及びこれを用いる非天然アミノ酸組み込みタンパク質の製造方法 |
| CN102414217A (zh) * | 2009-02-25 | 2012-04-11 | 彼格泰格私人有限公司 | 用于检测基孔肯雅病毒的探针和引物 |
| GB2470770A (en) | 2009-06-04 | 2010-12-08 | Medical Res Council | Incorporation of unnatural amino acids having an orthogonal functional group into polypeptides using orthogonal tRNA/tRNA synthetase pairs |
| GB0917240D0 (en) * | 2009-10-01 | 2009-11-18 | Medical Res Council | Incorporation of methyl lysine into poiypeptide |
| GB0917242D0 (en) * | 2009-10-01 | 2009-11-18 | Medical Res Council | Acetyl lysine incorporation with tRNA synthetase |
| US8697688B2 (en) | 2010-04-15 | 2014-04-15 | Seattle Genetics Inc. | Pyrrolobenzodiazepines used to treat proliferative diseases |
| US20120077186A1 (en) | 2010-05-07 | 2012-03-29 | Oregon Health & Science University | Use of cysteine-derived suppressor trnas for non-native amino acid incorporation |
| WO2011156686A2 (en) | 2010-06-11 | 2011-12-15 | The Regents Of The University Of Colorado, A Body Corporate | Method for synthesizing a cyclic multivalent peptide using a thiol-mediated reaction |
| DK2670767T3 (en) | 2011-02-03 | 2018-03-26 | European Molecular Biology Laboratory | Non-naturally occurring amino acids comprising a cyclooctynyl or transcyclooctynyl analog group and uses thereof |
| GB201110815D0 (en) * | 2011-06-24 | 2011-08-10 | Medical Res Council | Incorporation of subtituted lysines into polypeptides |
| IN2014DN09922A (https=) | 2012-05-18 | 2015-08-14 | Medical Res Council | |
| HRP20220455T1 (hr) | 2012-08-31 | 2022-05-27 | Sutro Biopharma, Inc. | Modificirane aminokiseline koje sadrže azid grupu |
| SG10201702387YA (en) | 2012-09-24 | 2017-04-27 | Medimmune Ltd | Cell lines |
| GB2528227A (en) | 2014-03-14 | 2016-01-20 | Medical Res Council | Cyclopropene amino acids and methods |
| GB201419109D0 (en) | 2014-10-27 | 2014-12-10 | Medical Res Council | Incorporation of unnatural amino acids into proteins |
| EP3274459A4 (en) * | 2015-03-27 | 2018-08-22 | The University of Queensland | Platform for non-natural amino acid incorporation into proteins |
| GB201817444D0 (en) | 2018-10-26 | 2018-12-12 | Res & Innovation Uk | Methods and compositions |
| EP3868882A1 (en) * | 2020-02-21 | 2021-08-25 | European Molecular Biology Laboratory | Archaeal pyrrolysyl trna synthetases for orthogonal use |
-
2013
- 2013-05-15 IN IN9922DEN2014 patent/IN2014DN09922A/en unknown
- 2013-05-15 CN CN201810228028.9A patent/CN108410827B/zh active Active
- 2013-05-15 US US14/401,803 patent/US20150148525A1/en not_active Abandoned
- 2013-05-15 CN CN201380037290.0A patent/CN104718285A/zh active Pending
- 2013-05-15 JP JP2015512124A patent/JP6343604B2/ja active Active
- 2013-05-15 BR BR112014028588-8A patent/BR112014028588B1/pt active IP Right Grant
- 2013-05-15 EP EP13734818.1A patent/EP2852664B1/en active Active
- 2013-05-15 WO PCT/GB2013/051249 patent/WO2013171485A1/en not_active Ceased
- 2013-05-15 CA CA2873793A patent/CA2873793C/en active Active
-
2020
- 2020-05-12 US US16/872,826 patent/US11732001B2/en active Active
-
2023
- 2023-05-16 US US18/198,205 patent/US20230340013A1/en not_active Abandoned
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110027829A1 (en) * | 2007-10-30 | 2011-02-03 | Medical Research Council | Methods and Compositions |
| WO2011136645A1 (en) * | 2010-04-27 | 2011-11-03 | Stichting Katholieke Universiteit, More Particularly Radboud University Nijmegen | Fused cyclooctyne compounds and their use in metal-free click reactions |
| US20130137763A1 (en) * | 2010-04-27 | 2013-05-30 | Synaffix B.V. | Fused cyclooctyne compounds and their use in metal-free click reactions |
| US20130066063A1 (en) * | 2011-09-09 | 2013-03-14 | John Cooke Hodges | Bicyclo[6.1.0]non-4-yne regents for chemical modification of oligonucleotides |
| US20150005481A1 (en) * | 2012-01-20 | 2015-01-01 | North Carlolina State University | Norbornene Modified Peptides and Their Labelling With Tetrazine Compounds |
Non-Patent Citations (8)
| Title |
|---|
| Agard et al., A Strain-Promoted [3+2] Azide-Alkyne Cycloaddition for Covalent Modification of Biomolecules in Living Systems, J. Am. Chem. Soc., vol. 126:15046-15047 (Nov. 2, 2004) * |
| Canalle et al., Clickable Enzyme-linked Immunosorbent Assay, BioMacromolecules, vol 12:3692-3697 (2011) * |
| Chen et al., Clicking 1,2,4,5-tetrazine and cyclooctynes with tunable reaction rates, Chem. Commun,. Vol. 48:1736-1738 (online Nov. 24, 2011) * |
| Chin, Reprogramming the genetic code, EMBO Journal, vol. 30:2312-2324 (2011) * |
| Davis et al., Designer proteins: applications of genetic code expansion in cell biology, Nature Reviews Molecular Cell Biology, vol. 13: 168-182 (March 2012) * |
| Devaraj et al., Tetrazine-based Cycloadditions: Applications to Pretargeted Live cell Imaging, Bioconjugate Chem., Vol 19(12):2297-2299 (2008) * |
| Lang et al., Genetically encoded norbornene directs site-specific cellular protein labeling via a rapid biorthogonal reaction, Nat. Chem., vol 4:298-304 and Supplemental data S1-S35(Published online Feb 5, 2012) * |
| Mukai et al., Adding L-Lysine Derivatives to the genetic code of mammalian cells with engineered pyrrolysyl-tRNA synthetases, Biochemical and Biophysical Research Communications, vol. 371:818-822 (2008) * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11732001B2 (en) | 2012-05-18 | 2023-08-22 | United Kingdom Research And Innovation | Methods of incorporating an amino acid comprising a BCN group into a polypeptide using an orthogonal codon encoding it and an orthogonal pylrs synthase |
| US10774039B2 (en) | 2014-03-14 | 2020-09-15 | United Kingdom Research And Innovation | Cyclopropene amino acids and methods |
| US12286657B2 (en) | 2018-10-26 | 2025-04-29 | United Kingdom Research And Innovation | Methods and compositions |
| US12378547B2 (en) | 2019-05-14 | 2025-08-05 | United Kingdom Research And Innovation | Synthetic genome |
| US12385035B2 (en) | 2019-05-14 | 2025-08-12 | United Kingdom Research And Innovation | Synthetic genome |
Also Published As
| Publication number | Publication date |
|---|---|
| HK1208704A1 (en) | 2016-03-11 |
| EP2852664A1 (en) | 2015-04-01 |
| CA2873793C (en) | 2022-02-22 |
| BR112014028588A2 (pt) | 2017-06-27 |
| CA2873793A1 (en) | 2013-11-21 |
| JP2015523965A (ja) | 2015-08-20 |
| EP2852664B1 (en) | 2017-09-06 |
| CN108410827A (zh) | 2018-08-17 |
| WO2013171485A1 (en) | 2013-11-21 |
| US11732001B2 (en) | 2023-08-22 |
| IN2014DN09922A (https=) | 2015-08-14 |
| CN104718285A (zh) | 2015-06-17 |
| BR112014028588A8 (pt) | 2021-06-29 |
| US20200271658A1 (en) | 2020-08-27 |
| CN108410827B (zh) | 2023-05-09 |
| US20230340013A1 (en) | 2023-10-26 |
| BR112014028588B1 (pt) | 2023-03-21 |
| JP6343604B2 (ja) | 2018-06-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230340013A1 (en) | Polypeptides and methods | |
| US9968690B2 (en) | Norbornene modified peptides and their labelling with tetrazine compounds | |
| Miyake-Stoner et al. | Generating permissive site-specific unnatural aminoacyl-tRNA synthetases | |
| US9868956B2 (en) | Methods | |
| US20150125904A1 (en) | Probe incorporation mediated by enzymes | |
| Aphicho et al. | Visualizing the complexity of proteins in living cells with genetic code expansion | |
| US10774039B2 (en) | Cyclopropene amino acids and methods | |
| To et al. | Residue-Specific Exchange of Proline by Proline Analogs in Fluorescent Proteins: How" Molecular Surgery" of the Backbone Affects Folding and Stability. | |
| HK1208704B (en) | Methods of incorporating an amino acid comprising a bcn group into a polypeptide using an orthogonal codon encoding it and an orthorgonal pylrs synthase | |
| US20250243238A1 (en) | Tetrazine amino acids and methods for their production and use | |
| EP4725952A1 (en) | Compounds comprising non-canonical amino acids and uses thereof | |
| Lightle et al. | Site-specific protein conjugates incorporating Para-Azido-L-Phenylalanine for cellular and in vivo imaging | |
| Scinto | Dual-reactivity trans-cyclooctenol probes for sulfenylation in live cells and affinity bioorthogonal chemistry tags for site-selective synthesis of protein-protein and protein-material conjugates | |
| de Jesus Pereira | Dual Fluorine Tag Incorporation into SARS-CoV-2 NNTD Protein for 19F NMR Spectroscopy | |
| Michels | Precision crosslinking and active-site modifications via site-specific protein engineering | |
| Zhang et al. | Design of 365 nm-Light-triggered Fluorogenic Crosslinking via a Genetically Encoded 3-CF 3-p-phenylenediamine-Lysine Featuring Red-shifted Photo-defluorination | |
| Chen | Adding new chemistry to proteins via genetic incorporation | |
| Wu | Techniques for labelling biological macromolecules for spectroscopic studies | |
| Sungwienwong | The Development Of Intrinsically Fluorescent Unnatural Amino Acids For In Vivo Incorporation Into Proteins | |
| Borrmann | Expanding and exploring the bioconjugation toolbox | |
| HK1231504B (en) | Cyclopropene amino acids and methods | |
| Brustad | Applications of an expanded genetic code |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MEDICAL RESEARCH COUNCIL, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LANG, KATHRIN;CHIN, JASON W;SIGNING DATES FROM 20150401 TO 20150407;REEL/FRAME:035568/0201 |
|
| AS | Assignment |
Owner name: UNITED KINGDOM RESEARCH AND INNOVATION, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MEDICAL RESEARCH COUNCIL;REEL/FRAME:046469/0108 Effective date: 20180401 Owner name: UNITED KINGDOM RESEARCH AND INNOVATION, UNITED KIN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MEDICAL RESEARCH COUNCIL;REEL/FRAME:046469/0108 Effective date: 20180401 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |