US20080274129A1 - Hla-A2 Tumor Associated Antigen Peptides and Compositions - Google Patents
Hla-A2 Tumor Associated Antigen Peptides and Compositions Download PDFInfo
- Publication number
- US20080274129A1 US20080274129A1 US10/553,703 US55370304A US2008274129A1 US 20080274129 A1 US20080274129 A1 US 20080274129A1 US 55370304 A US55370304 A US 55370304A US 2008274129 A1 US2008274129 A1 US 2008274129A1
- Authority
- US
- United States
- Prior art keywords
- seq
- peptide
- peptides
- ctl
- epitope
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 733
- 239000000203 mixture Substances 0.000 title claims abstract description 140
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 314
- 206010028980 Neoplasm Diseases 0.000 title claims description 196
- 108091007433 antigens Proteins 0.000 title description 115
- 102000036639 antigens Human genes 0.000 title description 114
- 239000000427 antigen Substances 0.000 title description 113
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims description 291
- 230000027455 binding Effects 0.000 claims description 149
- 125000000539 amino acid group Chemical group 0.000 claims description 113
- 210000002443 helper t lymphocyte Anatomy 0.000 claims description 105
- 201000011510 cancer Diseases 0.000 claims description 101
- 238000000034 method Methods 0.000 claims description 100
- 210000004443 dendritic cell Anatomy 0.000 claims description 99
- 239000002502 liposome Substances 0.000 claims description 44
- 239000002671 adjuvant Substances 0.000 claims description 43
- 238000011282 treatment Methods 0.000 claims description 33
- 150000007523 nucleic acids Chemical class 0.000 claims description 32
- 102000039446 nucleic acids Human genes 0.000 claims description 30
- 108020004707 nucleic acids Proteins 0.000 claims description 30
- 210000000612 antigen-presenting cell Anatomy 0.000 claims description 27
- 206010009944 Colon cancer Diseases 0.000 claims description 17
- 208000029742 colonic neoplasm Diseases 0.000 claims description 17
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 15
- 208000020816 lung neoplasm Diseases 0.000 claims description 14
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 14
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 12
- 150000002632 lipids Chemical class 0.000 claims description 12
- 206010006187 Breast cancer Diseases 0.000 claims description 11
- 208000026310 Breast neoplasm Diseases 0.000 claims description 11
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 11
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 10
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 10
- 201000005202 lung cancer Diseases 0.000 claims description 9
- 206010033128 Ovarian cancer Diseases 0.000 claims description 8
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 8
- 238000001356 surgical procedure Methods 0.000 claims description 8
- 238000002512 chemotherapy Methods 0.000 claims description 7
- 206010027476 Metastases Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 5
- 239000002480 mineral oil Substances 0.000 claims description 5
- 235000010446 mineral oil Nutrition 0.000 claims description 5
- 229940124531 pharmaceutical excipient Drugs 0.000 claims description 5
- 208000026037 malignant tumor of neck Diseases 0.000 claims description 4
- 230000009401 metastasis Effects 0.000 claims description 4
- 206010017758 gastric cancer Diseases 0.000 claims description 3
- 230000002265 prevention Effects 0.000 claims description 3
- 238000001959 radiotherapy Methods 0.000 claims description 3
- 201000011549 stomach cancer Diseases 0.000 claims description 3
- 230000005855 radiation Effects 0.000 claims description 2
- 206010025654 Malignant melanoma of sites other than skin Diseases 0.000 claims 2
- 230000001934 delay Effects 0.000 claims 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 abstract description 34
- 102000025850 HLA-A2 Antigen Human genes 0.000 abstract description 34
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 abstract description 19
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 abstract description 19
- 101150029707 ERBB2 gene Proteins 0.000 abstract description 16
- 101001005718 Homo sapiens Melanoma-associated antigen 2 Proteins 0.000 abstract description 11
- 102100025081 Melanoma-associated antigen 2 Human genes 0.000 abstract description 11
- 101001005719 Homo sapiens Melanoma-associated antigen 3 Proteins 0.000 abstract description 7
- 102100025082 Melanoma-associated antigen 3 Human genes 0.000 abstract description 7
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 abstract 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 abstract 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 abstract 1
- 230000004044 response Effects 0.000 description 179
- 229960005486 vaccine Drugs 0.000 description 155
- 210000004027 cell Anatomy 0.000 description 144
- 108091033319 polynucleotide Proteins 0.000 description 73
- 239000002157 polynucleotide Substances 0.000 description 73
- 102000040430 polynucleotide Human genes 0.000 description 73
- 108020004414 DNA Proteins 0.000 description 62
- 239000013598 vector Substances 0.000 description 62
- 238000003556 assay Methods 0.000 description 59
- 108090000623 proteins and genes Proteins 0.000 description 55
- 230000028993 immune response Effects 0.000 description 51
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 50
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 50
- 230000005847 immunogenicity Effects 0.000 description 48
- 241000699670 Mus sp. Species 0.000 description 46
- 238000000338 in vitro Methods 0.000 description 45
- 238000011830 transgenic mouse model Methods 0.000 description 45
- 230000002163 immunogen Effects 0.000 description 40
- 102000004169 proteins and genes Human genes 0.000 description 40
- 239000012634 fragment Substances 0.000 description 39
- 241000699660 Mus musculus Species 0.000 description 38
- 235000018102 proteins Nutrition 0.000 description 38
- 230000006698 induction Effects 0.000 description 37
- 108700028369 Alleles Proteins 0.000 description 36
- 241001465754 Metazoa Species 0.000 description 36
- 230000014509 gene expression Effects 0.000 description 35
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 34
- 238000001727 in vivo Methods 0.000 description 34
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 33
- 201000010099 disease Diseases 0.000 description 33
- 239000000839 emulsion Substances 0.000 description 33
- 239000000047 product Substances 0.000 description 32
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 28
- 230000003053 immunization Effects 0.000 description 28
- 238000002649 immunization Methods 0.000 description 28
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 28
- 239000000523 sample Substances 0.000 description 27
- 210000001744 T-lymphocyte Anatomy 0.000 description 26
- 235000001014 amino acid Nutrition 0.000 description 26
- 239000000243 solution Substances 0.000 description 26
- 229940024606 amino acid Drugs 0.000 description 25
- 230000000694 effects Effects 0.000 description 25
- 238000002347 injection Methods 0.000 description 25
- 239000007924 injection Substances 0.000 description 25
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 24
- 239000013612 plasmid Substances 0.000 description 24
- 210000004881 tumor cell Anatomy 0.000 description 24
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 23
- 241000282412 Homo Species 0.000 description 22
- -1 and Proteins 0.000 description 22
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 22
- 238000013459 approach Methods 0.000 description 21
- 238000002474 experimental method Methods 0.000 description 21
- 230000001225 therapeutic effect Effects 0.000 description 21
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 20
- 201000001441 melanoma Diseases 0.000 description 20
- 238000002255 vaccination Methods 0.000 description 20
- 108010074328 Interferon-gamma Proteins 0.000 description 19
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 18
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 18
- 150000001413 amino acids Chemical class 0.000 description 18
- 238000012360 testing method Methods 0.000 description 18
- 230000003612 virological effect Effects 0.000 description 18
- 239000013604 expression vector Substances 0.000 description 17
- 230000001965 increasing effect Effects 0.000 description 17
- 238000004519 manufacturing process Methods 0.000 description 17
- 238000002360 preparation method Methods 0.000 description 17
- 239000000463 material Substances 0.000 description 16
- 210000004988 splenocyte Anatomy 0.000 description 16
- 102100037850 Interferon gamma Human genes 0.000 description 15
- 230000001580 bacterial effect Effects 0.000 description 15
- 238000005516 engineering process Methods 0.000 description 15
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 15
- 238000004458 analytical method Methods 0.000 description 14
- 125000002091 cationic group Chemical group 0.000 description 14
- 210000001072 colon Anatomy 0.000 description 14
- 238000009472 formulation Methods 0.000 description 14
- 239000002245 particle Substances 0.000 description 14
- 108010058597 HLA-DR Antigens Proteins 0.000 description 13
- 102000006354 HLA-DR Antigens Human genes 0.000 description 13
- 102000004388 Interleukin-4 Human genes 0.000 description 13
- 108090000978 Interleukin-4 Proteins 0.000 description 13
- 230000001939 inductive effect Effects 0.000 description 13
- 125000006850 spacer group Chemical group 0.000 description 13
- 230000004083 survival effect Effects 0.000 description 13
- VYZAMTAEIAYCRO-BJUDXGSMSA-N Chromium-51 Chemical compound [51Cr] VYZAMTAEIAYCRO-BJUDXGSMSA-N 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 12
- 108091008874 T cell receptors Proteins 0.000 description 12
- 230000005867 T cell response Effects 0.000 description 12
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 12
- 206010046865 Vaccinia virus infection Diseases 0.000 description 12
- 239000000969 carrier Substances 0.000 description 12
- 239000003153 chemical reaction reagent Substances 0.000 description 12
- 230000001404 mediated effect Effects 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 208000007089 vaccinia Diseases 0.000 description 12
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 11
- 241000700721 Hepatitis B virus Species 0.000 description 11
- 230000000875 corresponding effect Effects 0.000 description 11
- 230000036039 immunity Effects 0.000 description 11
- 238000005259 measurement Methods 0.000 description 11
- 229940023041 peptide vaccine Drugs 0.000 description 11
- 239000000126 substance Substances 0.000 description 11
- 241000588724 Escherichia coli Species 0.000 description 10
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 10
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 10
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 10
- 235000018417 cysteine Nutrition 0.000 description 10
- 230000009089 cytolysis Effects 0.000 description 10
- 229940126534 drug product Drugs 0.000 description 10
- 239000012636 effector Substances 0.000 description 10
- 229920000140 heteropolymer Polymers 0.000 description 10
- 210000000265 leukocyte Anatomy 0.000 description 10
- 230000004048 modification Effects 0.000 description 10
- 238000012986 modification Methods 0.000 description 10
- 210000005087 mononuclear cell Anatomy 0.000 description 10
- 239000008194 pharmaceutical composition Substances 0.000 description 10
- 239000000825 pharmaceutical preparation Substances 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 10
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 10
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 10
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 10
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 10
- 239000011347 resin Substances 0.000 description 10
- 229920005989 resin Polymers 0.000 description 10
- XVQKZSLOGHBCET-INVHGPFASA-N tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine Chemical compound CCCCCCCCCCCCCCCC(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O)CSCC(OC(=O)CCCCCCCCCCCCCCC)COC(=O)CCCCCCCCCCCCCCC XVQKZSLOGHBCET-INVHGPFASA-N 0.000 description 10
- 229910001868 water Inorganic materials 0.000 description 10
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 9
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 9
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 9
- 108091028043 Nucleic acid sequence Proteins 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- 210000000481 breast Anatomy 0.000 description 9
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 9
- 230000002596 correlated effect Effects 0.000 description 9
- 238000011161 development Methods 0.000 description 9
- 230000018109 developmental process Effects 0.000 description 9
- 238000007918 intramuscular administration Methods 0.000 description 9
- 210000004072 lung Anatomy 0.000 description 9
- 230000000069 prophylactic effect Effects 0.000 description 9
- 230000008685 targeting Effects 0.000 description 9
- QWCKQJZIFLGMSD-UHFFFAOYSA-N 2-Aminobutanoic acid Natural products CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 8
- 238000011510 Elispot assay Methods 0.000 description 8
- 102000000588 Interleukin-2 Human genes 0.000 description 8
- 108010002350 Interleukin-2 Proteins 0.000 description 8
- QWCKQJZIFLGMSD-VKHMYHEASA-N L-alpha-aminobutyric acid Chemical compound CC[C@H](N)C(O)=O QWCKQJZIFLGMSD-VKHMYHEASA-N 0.000 description 8
- 108091061960 Naked DNA Proteins 0.000 description 8
- 108010038807 Oligopeptides Proteins 0.000 description 8
- 102000015636 Oligopeptides Human genes 0.000 description 8
- 108010090804 Streptavidin Proteins 0.000 description 8
- 230000008901 benefit Effects 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 230000002939 deleterious effect Effects 0.000 description 8
- 238000004128 high performance liquid chromatography Methods 0.000 description 8
- 210000000987 immune system Anatomy 0.000 description 8
- 238000009169 immunotherapy Methods 0.000 description 8
- 208000015181 infectious disease Diseases 0.000 description 8
- 239000003446 ligand Substances 0.000 description 8
- 230000007935 neutral effect Effects 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 235000002639 sodium chloride Nutrition 0.000 description 8
- 230000004936 stimulating effect Effects 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 7
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 7
- 230000000890 antigenic effect Effects 0.000 description 7
- 239000002585 base Substances 0.000 description 7
- 230000009260 cross reactivity Effects 0.000 description 7
- 239000003085 diluting agent Substances 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 238000011065 in-situ storage Methods 0.000 description 7
- 238000001802 infusion Methods 0.000 description 7
- 230000003834 intracellular effect Effects 0.000 description 7
- 210000004698 lymphocyte Anatomy 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- IPCSVZSSVZVIGE-UHFFFAOYSA-N palmitic acid group Chemical group C(CCCCCCCCCCCCCCC)(=O)O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 7
- 229920000642 polymer Polymers 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 230000010076 replication Effects 0.000 description 7
- 230000003393 splenic effect Effects 0.000 description 7
- 238000010186 staining Methods 0.000 description 7
- 230000000638 stimulation Effects 0.000 description 7
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 7
- 235000002374 tyrosine Nutrition 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- SNKAWJBJQDLSFF-NVKMUCNASA-N 1,2-dioleoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC SNKAWJBJQDLSFF-NVKMUCNASA-N 0.000 description 6
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 6
- 201000009030 Carcinoma Diseases 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 6
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 description 6
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 6
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 6
- 108010028921 Lipopeptides Proteins 0.000 description 6
- 102000043129 MHC class I family Human genes 0.000 description 6
- 108091054437 MHC class I family Proteins 0.000 description 6
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 6
- 108091034117 Oligonucleotide Proteins 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- 241000700618 Vaccinia virus Species 0.000 description 6
- DSNRWDQKZIEDDB-GCMPNPAFSA-N [(2r)-3-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-2-[(z)-octadec-9-enoyl]oxypropyl] (z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C/CCCCCCCC DSNRWDQKZIEDDB-GCMPNPAFSA-N 0.000 description 6
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 6
- 229960003767 alanine Drugs 0.000 description 6
- 238000002617 apheresis Methods 0.000 description 6
- 229940022399 cancer vaccine Drugs 0.000 description 6
- 239000006285 cell suspension Substances 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 6
- 230000008878 coupling Effects 0.000 description 6
- 238000010168 coupling process Methods 0.000 description 6
- 238000005859 coupling reaction Methods 0.000 description 6
- 230000002338 cryopreservative effect Effects 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- MWRBNPKJOOWZPW-CLFAGFIQSA-N dioleoyl phosphatidylethanolamine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(COP(O)(=O)OCCN)OC(=O)CCCCCCC\C=C/CCCCCCCC MWRBNPKJOOWZPW-CLFAGFIQSA-N 0.000 description 6
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 6
- 238000011156 evaluation Methods 0.000 description 6
- 108020001507 fusion proteins Proteins 0.000 description 6
- 102000037865 fusion proteins Human genes 0.000 description 6
- 229920001519 homopolymer Polymers 0.000 description 6
- 230000001024 immunotherapeutic effect Effects 0.000 description 6
- 230000001976 improved effect Effects 0.000 description 6
- 239000010410 layer Substances 0.000 description 6
- 125000005647 linker group Chemical group 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 238000012737 microarray-based gene expression Methods 0.000 description 6
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 210000000056 organ Anatomy 0.000 description 6
- 244000052769 pathogen Species 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 239000000902 placebo Substances 0.000 description 6
- 229940068196 placebo Drugs 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 238000004007 reversed phase HPLC Methods 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 229960000814 tetanus toxoid Drugs 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 5
- 101710121417 Envelope glycoprotein Proteins 0.000 description 5
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 5
- 108010088729 HLA-A*02:01 antigen Proteins 0.000 description 5
- 102000008100 Human Serum Albumin Human genes 0.000 description 5
- 108091006905 Human Serum Albumin Proteins 0.000 description 5
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 5
- 102100022297 Integrin alpha-X Human genes 0.000 description 5
- 102000013462 Interleukin-12 Human genes 0.000 description 5
- 108010065805 Interleukin-12 Proteins 0.000 description 5
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 5
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 5
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 5
- 206010060862 Prostate cancer Diseases 0.000 description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 5
- 230000004075 alteration Effects 0.000 description 5
- 230000001363 autoimmune Effects 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 238000004422 calculation algorithm Methods 0.000 description 5
- 238000009566 cancer vaccine Methods 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Chemical group CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 238000007912 intraperitoneal administration Methods 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 210000003734 kidney Anatomy 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 230000036210 malignancy Effects 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 208000021039 metastatic melanoma Diseases 0.000 description 5
- 238000012544 monitoring process Methods 0.000 description 5
- 239000013642 negative control Substances 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 235000019198 oils Nutrition 0.000 description 5
- 210000005259 peripheral blood Anatomy 0.000 description 5
- 239000011886 peripheral blood Substances 0.000 description 5
- 125000006239 protecting group Chemical group 0.000 description 5
- 230000003248 secreting effect Effects 0.000 description 5
- 210000000952 spleen Anatomy 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical compound OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 4
- KWVJHCQQUFDPLU-YEUCEMRASA-N 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC KWVJHCQQUFDPLU-YEUCEMRASA-N 0.000 description 4
- 206010057248 Cell death Diseases 0.000 description 4
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 4
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 4
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 4
- 102000008070 Interferon-gamma Human genes 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 4
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 4
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 4
- 102100038358 Prostate-specific antigen Human genes 0.000 description 4
- XZKQVQKUZMAADP-IMJSIDKUSA-N Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(O)=O XZKQVQKUZMAADP-IMJSIDKUSA-N 0.000 description 4
- 241000713311 Simian immunodeficiency virus Species 0.000 description 4
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 4
- 230000021736 acetylation Effects 0.000 description 4
- 238000006640 acetylation reaction Methods 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 208000009956 adenocarcinoma Diseases 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 4
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 4
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 229940126600 bulk drug product Drugs 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 4
- 150000002148 esters Chemical group 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 230000002538 fungal effect Effects 0.000 description 4
- 239000005090 green fluorescent protein Substances 0.000 description 4
- 210000005260 human cell Anatomy 0.000 description 4
- 229960003130 interferon gamma Drugs 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 4
- 230000003472 neutralizing effect Effects 0.000 description 4
- 229910052757 nitrogen Inorganic materials 0.000 description 4
- 231100000252 nontoxic Toxicity 0.000 description 4
- 230000003000 nontoxic effect Effects 0.000 description 4
- 201000002528 pancreatic cancer Diseases 0.000 description 4
- 208000008443 pancreatic carcinoma Diseases 0.000 description 4
- 230000007170 pathology Effects 0.000 description 4
- 230000008488 polyadenylation Effects 0.000 description 4
- 230000037452 priming Effects 0.000 description 4
- 239000003380 propellant Substances 0.000 description 4
- 210000002307 prostate Anatomy 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 238000000527 sonication Methods 0.000 description 4
- 210000004989 spleen cell Anatomy 0.000 description 4
- 238000010254 subcutaneous injection Methods 0.000 description 4
- 239000007929 subcutaneous injection Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 230000001988 toxicity Effects 0.000 description 4
- 231100000419 toxicity Toxicity 0.000 description 4
- 102000003390 tumor necrosis factor Human genes 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- 238000003260 vortexing Methods 0.000 description 4
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 3
- 208000030507 AIDS Diseases 0.000 description 3
- 102000009027 Albumins Human genes 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 3
- 241000193738 Bacillus anthracis Species 0.000 description 3
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 3
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 3
- 208000017667 Chronic Disease Diseases 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 241000702421 Dependoparvovirus Species 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 208000000666 Fowlpox Diseases 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241000696272 Gull adenovirus Species 0.000 description 3
- 102000011786 HLA-A Antigens Human genes 0.000 description 3
- 108010075704 HLA-A Antigens Proteins 0.000 description 3
- 108010035452 HLA-A1 Antigen Proteins 0.000 description 3
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 3
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 3
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 241000701806 Human papillomavirus Species 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- 102000008072 Lymphokines Human genes 0.000 description 3
- 108010074338 Lymphokines Proteins 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 108091054438 MHC class II family Proteins 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 206010029260 Neuroblastoma Diseases 0.000 description 3
- 208000002193 Pain Diseases 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 3
- 230000006052 T cell proliferation Effects 0.000 description 3
- 108010034949 Thyroglobulin Proteins 0.000 description 3
- 102000009843 Thyroglobulin Human genes 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 3
- 102000015098 Tumor Suppressor Protein p53 Human genes 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 108010015780 Viral Core Proteins Proteins 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 239000008186 active pharmaceutical agent Substances 0.000 description 3
- 230000010933 acylation Effects 0.000 description 3
- 238000005917 acylation reaction Methods 0.000 description 3
- 238000009098 adjuvant therapy Methods 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 239000000443 aerosol Substances 0.000 description 3
- 230000009435 amidation Effects 0.000 description 3
- 238000007112 amidation reaction Methods 0.000 description 3
- 229910021529 ammonia Inorganic materials 0.000 description 3
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 3
- 229960000723 ampicillin Drugs 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- 239000008365 aqueous carrier Substances 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- 230000002238 attenuated effect Effects 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 125000001589 carboacyl group Chemical group 0.000 description 3
- 208000019065 cervical carcinoma Diseases 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 235000012000 cholesterol Nutrition 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 238000004891 communication Methods 0.000 description 3
- 230000006854 communication Effects 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 239000006185 dispersion Substances 0.000 description 3
- 229940088679 drug related substance Drugs 0.000 description 3
- 239000002158 endotoxin Substances 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 238000004108 freeze drying Methods 0.000 description 3
- 238000007710 freezing Methods 0.000 description 3
- 230000008014 freezing Effects 0.000 description 3
- 230000002496 gastric effect Effects 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 230000033687 granuloma formation Effects 0.000 description 3
- 210000003128 head Anatomy 0.000 description 3
- 230000002489 hematologic effect Effects 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 238000000265 homogenisation Methods 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 108700010900 influenza virus proteins Proteins 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 238000007913 intrathecal administration Methods 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 206010061289 metastatic neoplasm Diseases 0.000 description 3
- 239000000693 micelle Substances 0.000 description 3
- 238000010172 mouse model Methods 0.000 description 3
- 210000001672 ovary Anatomy 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 150000003904 phospholipids Chemical class 0.000 description 3
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 3
- 229920002643 polyglutamic acid Polymers 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 230000001177 retroviral effect Effects 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- WPLOVIFNBMNBPD-ATHMIXSHSA-N subtilin Chemical compound CC1SCC(NC2=O)C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(CCCCN)C(=O)NC(C(C)CC)C(=O)NC(=C)C(=O)NC(CCCCN)C(O)=O)CSC(C)C2NC(=O)C(CC(C)C)NC(=O)C1NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C1NC(=O)C(=C/C)/NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C2NC(=O)CNC(=O)C3CCCN3C(=O)C(NC(=O)C3NC(=O)C(CC(C)C)NC(=O)C(=C)NC(=O)C(CCC(O)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)CC=4C5=CC=CC=C5NC=4)CSC3)C(C)SC2)C(C)C)C(C)SC1)CC1=CC=CC=C1 WPLOVIFNBMNBPD-ATHMIXSHSA-N 0.000 description 3
- 239000004094 surface-active agent Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 229960002175 thyroglobulin Drugs 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- 239000002691 unilamellar liposome Substances 0.000 description 3
- 229940125575 vaccine candidate Drugs 0.000 description 3
- 238000010200 validation analysis Methods 0.000 description 3
- SNKUSVNHTCUELQ-UHFFFAOYSA-N 2-[[4-amino-2-[[2-[[2-[2-[[2-[[2-[[2-[[2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]acetyl]amino]propanoylamino]-3-carboxypropanoyl]amino]-4-methylpentanoyl]amino]-4-oxobutanoyl]amino]-4-methylpentanoic aci Chemical compound CC(C)CC(C(O)=O)NC(=O)C(CC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(C)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(N)CC1=CC=C(O)C=C1 SNKUSVNHTCUELQ-UHFFFAOYSA-N 0.000 description 2
- OZDAOHVKBFBBMZ-UHFFFAOYSA-N 2-aminopentanedioic acid;hydrate Chemical compound O.OC(=O)C(N)CCC(O)=O OZDAOHVKBFBBMZ-UHFFFAOYSA-N 0.000 description 2
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 2
- 102100034540 Adenomatous polyposis coli protein Human genes 0.000 description 2
- 241000710929 Alphavirus Species 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- 108010077333 CAP1-6D Proteins 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- 102000012410 DNA Ligases Human genes 0.000 description 2
- 108010061982 DNA Ligases Proteins 0.000 description 2
- 108010041986 DNA Vaccines Proteins 0.000 description 2
- 229940021995 DNA vaccine Drugs 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 229930186217 Glycolipid Natural products 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 description 2
- 108010058607 HLA-B Antigens Proteins 0.000 description 2
- 229910004373 HOAc Inorganic materials 0.000 description 2
- 206010019233 Headaches Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 2
- 101000972485 Homo sapiens Lupus La protein Proteins 0.000 description 2
- 101001114052 Homo sapiens P antigen family member 4 Proteins 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000006992 Interferon-alpha Human genes 0.000 description 2
- 108010047761 Interferon-alpha Proteins 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 2
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 2
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 2
- 108090001030 Lipoproteins Proteins 0.000 description 2
- 102000004895 Lipoproteins Human genes 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 108010010995 MART-1 Antigen Proteins 0.000 description 2
- 102000043131 MHC class II family Human genes 0.000 description 2
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 2
- 108010046117 N-palmitoyl-5,6-dipalmitoyl-S-glycerylcysteinyl-seryl-serine Proteins 0.000 description 2
- 206010028813 Nausea Diseases 0.000 description 2
- 108700001237 Nucleic Acid-Based Vaccines Proteins 0.000 description 2
- 102100023240 P antigen family member 4 Human genes 0.000 description 2
- 235000021314 Palmitic acid Nutrition 0.000 description 2
- 239000004952 Polyamide Substances 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 102100035703 Prostatic acid phosphatase Human genes 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 206010070834 Sensitisation Diseases 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 206010052779 Transplant rejections Diseases 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 239000003929 acidic solution Substances 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 239000003957 anion exchange resin Substances 0.000 description 2
- 125000000129 anionic group Chemical group 0.000 description 2
- RDOXTESZEPMUJZ-UHFFFAOYSA-N anisole Chemical compound COC1=CC=CC=C1 RDOXTESZEPMUJZ-UHFFFAOYSA-N 0.000 description 2
- 230000003466 anti-cipated effect Effects 0.000 description 2
- 230000005975 antitumor immune response Effects 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 238000012209 assay specification Methods 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 239000003637 basic solution Substances 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000002051 biphasic effect Effects 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 210000002798 bone marrow cell Anatomy 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 238000011088 calibration curve Methods 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 229910052804 chromium Inorganic materials 0.000 description 2
- 239000011651 chromium Substances 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 150000001944 cysteine derivatives Chemical class 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 230000001627 detrimental effect Effects 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 206010016256 fatigue Diseases 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 239000013020 final formulation Substances 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 2
- 235000008191 folinic acid Nutrition 0.000 description 2
- 239000011672 folinic acid Substances 0.000 description 2
- 238000002825 functional assay Methods 0.000 description 2
- 230000000799 fusogenic effect Effects 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000003306 harvesting Methods 0.000 description 2
- 231100000869 headache Toxicity 0.000 description 2
- 102000052972 human La Human genes 0.000 description 2
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000008105 immune reaction Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 230000003308 immunostimulating effect Effects 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 229940079322 interferon Drugs 0.000 description 2
- 238000004969 ion scattering spectroscopy Methods 0.000 description 2
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 229960001691 leucovorin Drugs 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 230000033001 locomotion Effects 0.000 description 2
- 239000003287 lymphocyte surface marker Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000012976 mRNA stabilization Effects 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 230000002906 microbiologic effect Effects 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 2
- 230000008693 nausea Effects 0.000 description 2
- 230000010807 negative regulation of binding Effects 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 239000003002 pH adjusting agent Substances 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000036285 pathological change Effects 0.000 description 2
- 231100000915 pathological change Toxicity 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 230000000737 periodic effect Effects 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 108010054442 polyalanine Proteins 0.000 description 2
- 229920002647 polyamide Polymers 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 108010043671 prostatic acid phosphatase Proteins 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000008313 sensitization Effects 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000012289 standard assay Methods 0.000 description 2
- 210000002784 stomach Anatomy 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- 230000005030 transcription termination Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000003151 transfection method Methods 0.000 description 2
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 2
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 2
- 238000010798 ubiquitination Methods 0.000 description 2
- 230000034512 ubiquitination Effects 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 210000004291 uterus Anatomy 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- 239000008215 water for injection Substances 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- HKUAWRVNDCVEHT-NSHDSACASA-N (2s)-2-(pyren-4-ylamino)propanoic acid Chemical compound C1=CC=C2C(N[C@@H](C)C(O)=O)=CC3=CC=CC4=CC=C1C2=C34 HKUAWRVNDCVEHT-NSHDSACASA-N 0.000 description 1
- SHAPQBYCPZRQIP-YFKPBYRVSA-N (2s)-2-(thiophen-2-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=CS1 SHAPQBYCPZRQIP-YFKPBYRVSA-N 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 125000001431 2-aminoisobutyric acid group Chemical group [#6]C([#6])(N*)C(*)=O 0.000 description 1
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 1
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- 108010051457 Acid Phosphatase Proteins 0.000 description 1
- 102000013563 Acid Phosphatase Human genes 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- 206010001233 Adenoma benign Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102000052587 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Human genes 0.000 description 1
- 108700004606 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Proteins 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 102000052609 BRCA2 Human genes 0.000 description 1
- 108700020462 BRCA2 Proteins 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 208000009137 Behcet syndrome Diseases 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 206010004659 Biliary cirrhosis Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 101150008921 Brca2 gene Proteins 0.000 description 1
- 101150108242 CDC27 gene Proteins 0.000 description 1
- 206010006895 Cachexia Diseases 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 102100023126 Cell surface glycoprotein MUC18 Human genes 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 108010058546 Cyclin D1 Proteins 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 102000013701 Cyclin-Dependent Kinase 4 Human genes 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 101710116148 DNA N-6-adenine-methyltransferase Proteins 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 101100216227 Dictyostelium discoideum anapc3 gene Proteins 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 208000000471 Dysplastic Nevus Syndrome Diseases 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-N Fluorane Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 1
- 102100037948 GTP-binding protein Di-Ras3 Human genes 0.000 description 1
- 206010060891 General symptom Diseases 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 208000002966 Giant Cell Tumor of Bone Diseases 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 108010054017 Granulocyte Colony-Stimulating Factor Receptors Proteins 0.000 description 1
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 108010086377 HLA-A3 Antigen Proteins 0.000 description 1
- 108010093013 HLA-DR1 Antigen Proteins 0.000 description 1
- 108010064885 HLA-DR3 Antigen Proteins 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 1
- 101000983528 Homo sapiens Caspase-8 Proteins 0.000 description 1
- 101000623903 Homo sapiens Cell surface glycoprotein MUC18 Proteins 0.000 description 1
- 101100280298 Homo sapiens FAM162A gene Proteins 0.000 description 1
- 101000878536 Homo sapiens Focal adhesion kinase 1 Proteins 0.000 description 1
- 101000951235 Homo sapiens GTP-binding protein Di-Ras3 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101001005716 Homo sapiens Melanoma-associated antigen 11 Proteins 0.000 description 1
- 101001036406 Homo sapiens Melanoma-associated antigen C1 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101001114057 Homo sapiens P antigen family member 1 Proteins 0.000 description 1
- 101000743264 Homo sapiens RNA-binding protein 6 Proteins 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000341655 Human papillomavirus type 16 Species 0.000 description 1
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 1
- 206010022095 Injection Site reaction Diseases 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000002260 Keloid Diseases 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical group 0.000 description 1
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 1
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 206010024264 Lethargy Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 108010013709 Leukocyte Common Antigens Proteins 0.000 description 1
- 102000017095 Leukocyte Common Antigens Human genes 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 108700005089 MHC Class I Genes Proteins 0.000 description 1
- 108010066345 MHC binding peptide Proteins 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 102100022430 Melanocyte protein PMEL Human genes 0.000 description 1
- 108010071463 Melanoma-Specific Antigens Proteins 0.000 description 1
- 102000007557 Melanoma-Specific Antigens Human genes 0.000 description 1
- 102100025083 Melanoma-associated antigen 11 Human genes 0.000 description 1
- 102100039447 Melanoma-associated antigen C1 Human genes 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 208000032818 Microsatellite Instability Diseases 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100034263 Mucin-2 Human genes 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 241000687607 Natalis Species 0.000 description 1
- 206010028851 Necrosis Diseases 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 239000012124 Opti-MEM Substances 0.000 description 1
- 239000012570 Opti-MEM I medium Substances 0.000 description 1
- 208000001715 Osteoblastoma Diseases 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 1
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102100023788 Protein FAM162A Human genes 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 101150040459 RAS gene Proteins 0.000 description 1
- 101150076031 RAS1 gene Proteins 0.000 description 1
- 102100038150 RNA-binding protein 6 Human genes 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 206010074268 Reproductive toxicity Diseases 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 101800001271 Surface protein Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000037453 T cell priming Effects 0.000 description 1
- 101150006914 TRP1 gene Proteins 0.000 description 1
- 108010017842 Telomerase Proteins 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000057032 Tissue Kallikreins Human genes 0.000 description 1
- 108700022175 Tissue Kallikreins Proteins 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 108010091356 Tumor Protein p73 Proteins 0.000 description 1
- 102000018252 Tumor Protein p73 Human genes 0.000 description 1
- 102000003425 Tyrosinase Human genes 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 102100027244 U4/U6.U5 tri-snRNP-associated protein 1 Human genes 0.000 description 1
- 101710155955 U4/U6.U5 tri-snRNP-associated protein 1 Proteins 0.000 description 1
- 206010046798 Uterine leiomyoma Diseases 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 208000028752 abnormal posture Diseases 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 231100000354 acute hepatitis Toxicity 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 238000011360 adjunctive therapy Methods 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 238000012382 advanced drug delivery Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 150000001295 alanines Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- FUOOLUPWFVMBKG-UHFFFAOYSA-N alpha-amino-isobutyric acid Natural products CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- DIZPMCHEQGEION-UHFFFAOYSA-H aluminium sulfate (anhydrous) Chemical compound [Al+3].[Al+3].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O DIZPMCHEQGEION-UHFFFAOYSA-H 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 238000012801 analytical assay Methods 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000012865 aseptic processing Methods 0.000 description 1
- 231100001152 autoimmune toxicity Toxicity 0.000 description 1
- 230000005812 autoimmune toxicity Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 208000034158 bleeding Diseases 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000005859 cell recognition Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 210000004671 cell-free system Anatomy 0.000 description 1
- 230000008614 cellular interaction Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 208000007951 cervical intraepithelial neoplasia Diseases 0.000 description 1
- 150000001793 charged compounds Chemical class 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 208000006571 choroid plexus carcinoma Diseases 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 231100000026 common toxicity Toxicity 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000005138 cryopreservation Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012926 crystallographic analysis Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000011461 current therapy Methods 0.000 description 1
- 201000010305 cutaneous fibrous histiocytoma Diseases 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 238000004163 cytometry Methods 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229940029030 dendritic cell vaccine Drugs 0.000 description 1
- 238000000151 deposition Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- UMGXUWVIJIQANV-UHFFFAOYSA-M didecyl(dimethyl)azanium;bromide Chemical compound [Br-].CCCCCCCCCC[N+](C)(C)CCCCCCCCCC UMGXUWVIJIQANV-UHFFFAOYSA-M 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 231100000371 dose-limiting toxicity Toxicity 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 230000008846 dynamic interplay Effects 0.000 description 1
- 238000004945 emulsification Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 238000011124 ex vivo culture Methods 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 238000001125 extrusion Methods 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000008175 fetal development Effects 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 102000006815 folate receptor Human genes 0.000 description 1
- 108020005243 folate receptor Proteins 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 230000009454 functional inhibition Effects 0.000 description 1
- 238000004362 fungal culture Methods 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 108010008486 gp100 Melanoma Antigen Proteins 0.000 description 1
- 102000007192 gp100 Melanoma Antigen Human genes 0.000 description 1
- 238000004019 gradient elution chromatography Methods 0.000 description 1
- 208000010758 granulomatous inflammation Diseases 0.000 description 1
- 230000005484 gravity Effects 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 208000024348 heart neoplasm Diseases 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 239000012456 homogeneous solution Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000000887 hydrating effect Effects 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910000040 hydrogen fluoride Inorganic materials 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 238000007654 immersion Methods 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000037189 immune system physiology Effects 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 238000010324 immunological assay Methods 0.000 description 1
- 230000002134 immunopathologic effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 239000013546 insoluble monolayer Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940028885 interleukin-4 Drugs 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 125000001972 isopentyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])C([H])([H])* 0.000 description 1
- 210000001117 keloid Anatomy 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000000867 larynx Anatomy 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 201000010260 leiomyoma Diseases 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000004973 liquid crystal related substance Substances 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 210000003794 male germ cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- UZKWTJUDCOPSNM-UHFFFAOYSA-N methoxybenzene Substances CCCCOC=C UZKWTJUDCOPSNM-UHFFFAOYSA-N 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 108700043516 mouse H-2Kb Proteins 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 208000009091 myxoma Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 210000003928 nasal cavity Anatomy 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 230000006654 negative regulation of apoptotic process Effects 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 208000004649 neutrophil actin dysfunction Diseases 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000002414 normal-phase solid-phase extraction Methods 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 229940023146 nucleic acid vaccine Drugs 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 235000021313 oleic acid Nutrition 0.000 description 1
- 150000002889 oleic acids Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000001582 osteoblastic effect Effects 0.000 description 1
- 108700025694 p53 Genes Proteins 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 238000003921 particle size analysis Methods 0.000 description 1
- 230000009543 pathological alteration Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 238000009520 phase I clinical trial Methods 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 125000001095 phosphatidyl group Chemical group 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 108010094020 polyglycine Proteins 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000027317 positive regulation of immune response Effects 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 125000003226 pyrazolyl group Chemical group 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 125000000168 pyrrolyl group Chemical group 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 102000016914 ras Proteins Human genes 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000012429 release testing Methods 0.000 description 1
- 230000007696 reproductive toxicity Effects 0.000 description 1
- 231100000372 reproductive toxicity Toxicity 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- UQDJGEHQDNVPGU-UHFFFAOYSA-N serine phosphoethanolamine Chemical compound [NH3+]CCOP([O-])(=O)OCC([NH3+])C([O-])=O UQDJGEHQDNVPGU-UHFFFAOYSA-N 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- 229960002668 sodium chloride Drugs 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000010972 statistical evaluation Methods 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 125000001544 thienyl group Chemical group 0.000 description 1
- 239000010409 thin film Substances 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 108091007466 transmembrane glycoproteins Proteins 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 238000003211 trypan blue cell staining Methods 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 201000007954 uterine fibroid Diseases 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 201000011531 vascular cancer Diseases 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/19—Dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/24—Antigen-presenting cells [APC]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4203—Receptors for growth factors
- A61K40/4205—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4238—Regulators of development
- A61K40/424—Apoptosis related proteins, e.g. survivin or livin
- A61K40/4241—Apoptosis related proteins, e.g. survivin or livin p53
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4264—Cancer antigens from embryonic or fetal origin
- A61K40/4266—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4267—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K40/4268—MAGE
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55566—Emulsions, e.g. Freund's adjuvant, MF59
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
Definitions
- This invention relates to the field of biology.
- it relates to peptides, polynucleotides, and compositions useful to monitor or elicit an immune response to selected tumor-associated antigens.
- HLA Human Leukocyte Antigen
- PSA prostate specific antigen
- CTL cytotoxic T-cell lymphocyte
- Rosenberg, et al. evaluated the safety and mechanism of action of a synthetic HLA-A2 binding peptide derived from the melanoma associated antigen, gp100, as a cancer vaccine to treat patients with metastatic melanoma (Rosenberg et al., Nature Med., 4:321-327 (1998)).
- CTL directly lyse tumor cells and also secrete an array of cytokines such as interferon gamma (IFN ⁇ ), tumor necrosis factor (TNF) and granulocyte-macrophage colony stimulating factor (GM-CSF), that further amplify the immune reactivity against the tumor cells.
- CTL recognize tumor associated antigens (TAA) in the form of a complex composed of 8-11 amino acid residue peptide epitopes, bound to Major Histocompatibility Complex (MHC) molecules (Schwartz, B. D., The human major histocompatibility complex HLA in basic & clinical immunology Stites et al., eds., Lange Medical Publication: Los Altos, pp.
- TAA tumor associated antigens
- MHC Major Histocompatibility Complex
- Peptide epitopes are generated through intracellular processing of proteins.
- the processed peptides bind to newly synthesized MHC molecules and the epitope-MHC complexes are expressed on the cell surface.
- These epitope-MHC complexes are recognized by the T cell receptor of the CTL. This recognition event is required for the activation of CTL as well as induction of the effector functions such as lysis of the target tumor cell.
- HLA human leukocyte antigen
- HLA class I molecules can be divided into several families or “supertypes” based upon their ability to bind similar repertoires of peptides. Vaccines which bind to multiple HLA supertypes, such as for example A2, A3, and B7, will afford broad, non-ethnically biased population coverage. As seen in Table 1, population coverage is approximately 84-90% for various ethnicities, with an average coverage of the sample ethnicities at approximately 87%.
- immune response mounted against the pathogen, infected cell, or malignant cell. In many conditions such immune responses control the disease.
- immune responses against a pathogen can control the pathogen, prevent progression to severe disease and/or eliminate the pathogen.
- a common theme is the requirement for a multispecific T cell response, and that narrowly focused responses appear to be less effective.
- tumors commonly have the ability to mutate, thereby changing their immunological recognition.
- the presence of monospecific CTL was also correlated with control of tumor growth, until antigen loss emerged (Riker A, et al., Immune selection after antigen-specific immunotherapy of melanoma Surgery , August: 126(2):112-20, 1999; Marchand M, et al., Tumor regressions were observed in patients with metastatic melanoma treated with an antigenic peptide derived from the MAGE-3 gene and presented by HLA-A1 Int. J. Cancer 80(2):219-30, Jan. 18, 1999).
- HLA class I expression appears to be reflective of past immune pressures, and may also have prognostic value (van Duinen S G, et al, Level of HLA antigens in locoregional metastases and clinical course of the disease in patients with melanoma Cancer Research 48, 1019-1025, February 1988; Möller P, et al., Influence of major histocompatibility complex class I and II antigens on survival in colorectal carcinoma Cancer Research 51, 729-736, January 1991).
- HLA class I expression is altered in a large fraction of the tumor types, possibly as a reflection of immune pressure, or simply a reflection of the accumulation of pathological changes and alterations in diseased cells.
- HLA class I A majority of tumors express HLA class I, with a general tendency for the more severe alterations to be found in later stage and less differentiated tumors. This pattern is encouraging in the context of immunotherapy, especially considering that: 1) the relatively low sensitivity of immunohistochemical techniques might underestimate HLA expression in tumors; 2) class I expression can be induced in tumor cells as a result of local inflammation and lymphokine release; and, 3) class I negative cells are sensitive to lysis by NK cells.
- the invention is directed to an isolated peptide comprising or consisting of one or more HLA-A2 epitopes and/or HLA-A2 analogs.
- the peptide may comprise multiple epitopes and/or analogs, and may comprise additional amino acid residues, including but not limited to, other CTL epitopes, universal HTL epitopes, HTL epitopes, linkers, spacers, carriers, etc.
- the invention is directed to polynucleotides encoding such peptides.
- the invention is directed to a composition comprising two, three, four, five, six, seven, eight, nine, ten, eleven or twelve peptide epitopes and/or analogs.
- One or more of the peptides and/or analogs in these embodiments may also further comprise additional amino acid residues including, but not limited to, other CTL epitopes, HTL epitopes, universal HTL epitopes, linkers, spacers, carriers, etc.
- the invention is directed to a composition
- a composition comprising one or more of the above peptides and/or polynucleotides and one or more additional components.
- Additional components include diluents, excipients, CTL epitopes, HTL epitopes, carriers, liposomes, HLA heavy chains, ⁇ 2-microglobulin, strepavidin, antigen-presenting cells, adjuvants, etc.
- the invention is directed to prophylactic, therapeutic, diagnostic, and prognostic methods using the peptides, polynucleotides, and compositions of the invention.
- FIG. 1 depicts that splenic DC from ProGP-treated mice induce CTL responses in vivo.
- Splenic DC from ProGP treated HLA-A2.1 transgenic mice 33 ⁇ g/mouse, QD, SC for 7 days
- HBV Pol 455 peptide 10 6 cell per ml peptide at 10 ⁇ g/ml
- Opti-MEM I medium Gibco Life Sciences
- DC were washed twice and 10 6 cells were injected IV into groups of three transgenic mice.
- Epitope-pulsed GM-CSF/IL-4 expanded DC and “mock-pulsed” ProGP derived DC were also tested for comparison. Seven days after receiving the primary immunization with DC, animals were boosted with the same DC populations. At fourteen days after the primary immunization, spleen cells from immunized animals were restimulated twice in vitro in the presence of the Pol 455 peptide. CTL activity following restimulations was measured using a standard 51 Cr release assay in which the lysis of 51 Cr-labeled HLA-A2.1-transfected Jurkat target cells was measured in the presence (circle symbols) or absence of peptide (square symbols).
- Panels A-C represent a composite of lytic activity from a triplicate set of cultures.
- Panel A splenic DC from ProGP (SD-9427) treated animals pulsed with the HBV Pol 455 peptide.
- Panel B GM-CSF/IL-4 expanded DC pulsed with HBV Pol 455 peptide.
- Panel C mock-pulsed DC from ProGP treated animals. Studies were performed at Epimmune Inc., San Diego, Calif.
- FIG. 2 presents a schematic of a dendritic cell pulsing and testing procedure.
- FIG. 3A shows a flow chart of the preparation of Drug Product.
- FIG. 3B shows multi-epitope CTL induction in HLA-A2.1/K b transgenic mice immunized with the EP-2101 vaccine.
- Mice were immunized with 50 ⁇ g of EP-2101 (10 mg/ml emulsion dose) or co-immunized with 50 ⁇ g of each CTL epitope individually with an equal dose of PADRE® epitope in Montanide® ISA 51 adjuvant (latter responses designated as “Individual”).
- splenocytes from primed animals were stimulated with each CTL peptide in vitro and six days later CTL activity from triplicate cultures were measured with an in situ IFN- ⁇ ELISA.
- splenocytes from na ⁇ ve mice or mice injected with a Montanide® ISA 51 emulsion prepared without peptide were also stimulated with peptide in vitro and CTL activity was measured under identical conditions (responses designated as “Na ⁇ ve control”).
- Data shown for each epitope is the geometric mean CTL response from 6-10 independent experiments.
- CTL responses are expressed in secretory units (SU) with 1 SU defined as the release of 100 pg/well of IFN- ⁇ by 10 6 effector cells.
- SU secretory units
- compositions that can be used to monitor an immune response to a tumor associated antigen or to create a cancer vaccine that stimulates the cellular arm of the immune system, especially when one or more peptides are combined.
- compositions mediate immune responses against tumors in individuals who bear at least one allele of HLA-A2 and/or HLA-A2 supertype. Such compositions will generally be referred to as A2 compositions (or combinations thereof).
- An A2 composition may, for example, act as a vaccine to stimulate the immune system to recognize and kill tumor cells, leading to increased quality of life, and/or disease-free or overall survival rates for patients treated for cancer.
- a composition of the invention such as a vaccine will be administered to HLA-A2 or HLA-A2 supertype positive individuals who have a cancer that expresses at least one of the TAAs from which the epitopes or analogs were selected (e.g., CEA, p53, HER2/neu, MAGE2/3), examples of such cancers being breast, colon, lung, ovarian and gastric cancers and for MAGE 2/3, some melanomas.
- an A2 composition e.g., vaccine, improves the standard of care for patients being treated for breast, colon, lung, ovarian or gastric cancers, or melanoma.
- compositions e.g., vaccines, of the invention comprise peptides bearing A2 motifs or A2 supermotifs (A2 epitopes and/or A2 analogs), as described herein, and/or nucleic acids encoding such peptides.
- Such compositions may also comprise a PADRE® epitope.
- the peptides and corresponding nucleic acids and compositions of the present invention are useful for stimulating an immune response to TAAs by stimulating the production of CTL and optionally HTL responses, e.g. therapeutic prophylaxis, and are also useful for monitoring an immune response, e.g., diagnosis and prognosis.
- the peptides which contain A2 epitopes derived directly or indirectly (i.e. by analoging) from native TAA protein amino acid sequences, are able to bind to HLA molecules and stimulate an immune response to TAAs.
- the complete sequence of the TAAs proteins analyzed described as SEQ ID NOs:11-15 herein can be obtained from GenBank. See Table 2.
- epitopes of the invention have been identified in a number of ways, as will be discussed below. Also discussed in greater detail is an embodiment of the invention in which analogs have been derived wherein the binding activity for HLA molecules or T cell receptor molecules was modulated by modifying specific amino acid residues to create analogs which exhibit altered (e.g. improved) immunogenicity.
- binding data results are often expressed in terms of “IC 50 's.”
- IC 50 is the concentration of peptide in a binding assay at which 50% inhibition of binding of a reference peptide is observed. Given the conditions in which the assays are run (i.e., limiting HLA proteins and labeled peptide concentrations), these values approximate K D values.
- Assays for determining binding are described in detail, e.g., in PCT publications WO 94/20127 and WO 94/03205, and other publications such Sidney et al., Current Protocols in Immunology 18.3.1 (1998); Sidney, et al., J. Immunol. 154:247 (1995); and Sette, et al., Mol.
- IC 50 values can change, often dramatically, if the assay conditions are varied, and depending on the particular reagents used (e.g., HLA preparation, etc.). For example, excessive concentrations of HLA molecules will increase the apparent measured IC 50 of a given ligand.
- binding is expressed relative to a reference peptide.
- the IC 50 's of the peptides tested may change somewhat, the binding relative to the reference peptide will not significantly change.
- the assessment of whether a peptide is a good (i.e. high), intermediate, weak, or negative binder is generally based on its IC 50 , relative to the IC 50 of a standard peptide.
- the Tables included in this application present binding data in a preferred biologically relevant form of IC 50 nM.
- Binding may also be determined using other assay systems including those using: live cells (e.g., Ceppellini et al., Nature 339:392 (1989); Christnick et al., Nature 352:67 (1991); Busch et al., Int. Immunol. 2:443 (1990); Hill et al., J. Immunol. 147:189 (1991); del Guercio et al., J. Immunol. 154:685 (1995)), cell free systems using detergent lysates (e.g., Cerundolo et al., J. Immunol. 21:2069 (1991)), immobilized purified MHC (e.g., Hill et al., J.
- a “computer” or “computer system” generally includes: a processor and related computer programs; at least one information storage/retrieval apparatus such as a hard drive, a disk drive or a tape drive; at least one input apparatus such as a keyboard, a mouse, a touch screen, or a microphone; and display structure, such as a screen or a printer. Additionally, the computer may include a communication channel in communication with a network. Such a computer may include more or less than what is listed above.
- Cross-reactive binding indicates that a peptide is bound by more than one HLA molecule; a synonym is degenerate binding.
- a derived epitope when used to discuss an epitope is a synonym for “prepared.”
- a derived epitope can be isolated from a natural source, or it can be synthesized in accordance with standard protocols in the art.
- Synthetic epitopes can comprise artificial amino acid residues “amino acid mimetics,” such as D isomers of natural occurring L amino acid residues or non-natural amino acid residues such as cyclohexylalanine.
- a derived or prepared epitope can be an analog of a native epitope.
- a “diluent” includes sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred diluent for pharmaceutical compositions. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as diluents, particularly for injectable solutions.
- a “dominant epitope” is an epitope that induces an immune response upon immunization with a whole native antigen (see, e.g., Sercarz, et al., Annu. Rev. Immunol. 11:729-766, 1993). Such a response is cross-reactive in vitro with an isolated peptide epitope.
- an “epitope” is the collective features of a molecule, such as primary, secondary and tertiary peptide structure, and charge, that together form a site recognized by an immunoglobulin, T cell receptor or HLA molecule.
- an epitope can be defined as a set of amino acid residues which is involved in recognition by a particular immunoglobulin, or in the context of T cells, those residues necessary for recognition by T cell receptor proteins and/or Major Histocompatibility Complex (MHC) receptors.
- Epitopes are present in nature, and can be isolated, purified or otherwise prepared or derived by humans. For example, epitopes can be prepared by isolation from a natural source, or they can be synthesized in accordance with standard protocols in the art.
- Synthetic epitopes can comprise artificial amino acid residues, “amino acid mimetics,” such as D isomers of naturally-occurring L amino acid residues or non-naturally-occurring amino acid residues such as cyclohexylalanine. Throughout this disclosure, epitopes may be referred to in some cases as peptides or peptide epitopes.
- the epitopes and analogs of the invention are set forth in Table 3.
- the peptide comprises a fragment of an antigen.
- a “fragment of an antigen” or “antigenic fragment” or simply “fragment” is a portion of an antigen which has 100% identity with a wild type antigen or naturally-occurring variant thereof. The fragment may or may not comprise an epitope of the invention.
- the fragment may be less than or equal to 600 amino acid residues, less than or equal to 500 amino acid residues, less than or equal to 400 amino acid residues, less than or equal to 250 amino acid residues, less than or equal to 100 amino acid residues, less than or equal to 85 amino acid residues, less than or equal to 75 amino acid residues, less than or equal to 65 amino acid residues, or less than or equal to 50 amino acid residues in length.
- a fragment is e.g., less than 101 or less than 51 amino acid residues in length, in any increment down to 5 amino acid residues in length.
- the fragment may be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid residues in length.
- a peptide is 9, 10, or 11 amino acid residues in length.
- a peptide of the invention there is a limitation on the length of a peptide of the invention.
- the embodiment that is length-limited occurs when the protein or peptide comprising an epitope of the invention comprises a region (i.e., a contiguous series of amino acid residues) having 100% identity with a native sequence.
- a region i.e., a contiguous series of amino acid residues
- the region with 100% identity to a native sequence generally has a length of: less than or equal to 600 amino acid residues, often less than or equal to 500 amino acid residues, often less than or equal to 400 amino acid residues, often less than or equal to 250 amino acid residues, often less than or equal to 100 amino acid residues, often less than or equal to 85 amino acid residues, often less than or equal to 75 amino acid residues, often less than or equal to 65 amino acid residues, and often less than or equal to 50 amino acid residues.
- an “epitope” of the invention is comprised by a peptide having a region with less than 51 amino acid residues that has 100% identity to a native peptide sequence, in any increment down to 5 amino acid residues; for example 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid residues.
- peptide or protein sequences longer than 600 amino acid residues are within the scope of the invention, provided that they do not comprise any contiguous sequence of more than 600 amino acid residues that have 100% identity with a native peptide sequence.
- a peptide of the invention e.g., a peptide comprising an epitope of the invention
- peptides of the invention are 9, 10 or 11 amino acid residues in length.
- HLA Human Leukocyte Antigen
- MHC Major Histocompatibility Complex
- HLA supertype or HLA family describes sets of HLA molecules grouped on the basis of shared peptide-binding specificities. HLA class I molecules that share somewhat similar binding affinity for peptides bearing certain amino acid motifs are grouped into such HLA supertypes.
- HLA superfamily, HLA supertype family, HLA family, and HLA xx-like molecules are synonyms. See, e.g., the HLA-A2 motif and super motifs are detailed in Tables 4A, 4B, 4C, and 4D.
- IC 50 is the concentration of peptide in a binding assay at which 50% inhibition of binding of a reference peptide is observed. Given the conditions in which the assays are run (i.e., limiting HLA proteins and labeled peptide concentrations), these values approximate K D values. See “binding data.”
- nucleic or percent “identity,” in the context of two or more peptide sequences or antigen fragments, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using a sequence comparison algorithm or by manual alignment and visual inspection.
- immunogenic peptide or an “immunogenic” epitope or “peptide epitope” is a peptide that comprises an allele-specific motif or supermotif such that the peptide will bind an HLA molecule and induce a CTL and/or HTL response.
- immunogenic peptides of the invention are capable of binding to an appropriate HLA molecule and thereafter inducing a cytotoxic T lymphocyte (CTL) response, or a helper T lymphocyte (HTL) response, to the peptide.
- CTL cytotoxic T lymphocyte
- HTL helper T lymphocyte
- isolated or biologically pure refer to material which is substantially or essentially free from components which normally accompany the material as it is found in its native state.
- isolated peptides in accordance with the invention preferably do not contain materials normally associated with the peptides in their in situ environment.
- An “isolated” epitope refers to an epitope that does not include the whole sequence of the antigen from which the epitope was derived. Typically the “isolated” epitope does not have attached thereto additional amino acid residues that result in a sequence that has 100% identity over the entire length of a native sequence.
- the native sequence can be a sequence such as a tumor-associated antigen from which the epitope is derived.
- isolated means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or peptide present in a living animal is not isolated, but the same polynucleotide or peptide, separated from some or all of the coexisting materials in the natural system, is isolated.
- Such a polynucleotide could be part of a vector, and/or such a polynucleotide or peptide could be part of a composition, and still be “isolated” in that such vector or composition is not part of its natural environment.
- Isolated RNA molecules include in vivo or in vitro RNA transcripts of the DNA molecules of the present invention, and further include such molecules produced synthetically.
- MHC Major Histocompatibility Complex
- HLA human leukocyte antigen
- a “native” or a “wild type” sequence refers to a sequence found in nature. Such a sequence may comprise a longer sequence in nature.
- a “negative binding residue” or “deleterious residue” is an amino acid residue which, if present at certain positions (typically not primary anchor positions) in a peptide epitope, results in decreased binding affinity of the peptide for its corresponding HLA molecule.
- peptide and peptide epitope are used interchangeably with “oligopeptide” in the present specification to designate a series of residues, typically L -amino acid residues, connected one to the other, typically by peptide bonds between the ⁇ -amino and carboxyl groups of adjacent amino acid residues.
- Synthetic peptide refers to a peptide that is obtained from a non-natural source, e.g., is man-made. Such peptides may be produced using such methods as chemical synthesis or recombinant DNA technology. “Synthetic peptides” include “fusion proteins.”
- a “PanDR binding” peptide, a “PanDR binding epitope,” or “PADRE®” peptide is a member of a family of molecules that binds more than one HLA class II DR molecule.
- the pattern that defines the PADRE® family of molecules can be referred to as an HLA Class II supermotif.
- a PADRE® molecule binds to HLA-DR molecules and stimulates in vitro and in vivo human helper T lymphocyte (HTL) responses.
- HTL human helper T lymphocyte
- “Pharmaceutically acceptable” refers to a generally non-toxic, inert, and/or physiologically compatible composition or component of a composition.
- a “pharmaceutical excipient” or “excipient” comprises a material such as an adjuvant, a carrier, pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservatives, and the like.
- a “pharmaceutical excipient” is an excipient which is pharmaceutically acceptable.
- motif refers to a pattern of residues in an amino acid sequence of defined length, preferably a peptide of less than about 15 amino acid residues in length, or less than about 13 amino acid residues in length, usually from about 8 to about 13 amino acid residues (e.g., 8, 9, 10, 11, 12, or 13) for a class I HLA motif and from about 6 to about 25 amino acid residues (e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) for a class II HLA motif, which is recognized by a particular HLA molecule.
- Motifs are typically different for each HLA protein encoded by a given human HLA allele. These motifs often differ in their pattern of the primary and secondary anchor residues.
- an MHC class I motif identifies a peptide of 9, 10, 0r 11 amino acid residues in length.
- a “supermotif” is a peptide binding specificity shared by HLA molecules encoded by two or more HLA alleles.
- a supermotif-bearing peptide is recognized with high or intermediate affinity (as defined herein) by two or more HLA antigens.
- a “primary anchor residue” is an amino acid at a specific position along a peptide sequence which is understood to provide a primary contact point between the immunogenic peptide and the HLA molecule.
- One, two or three, primary anchor residues within a peptide of defined length minimally defines a “motif” for an immunogenic peptide. These residues are understood to fit in close contact with peptide binding grooves of an HLA molecule, with their side chains buried in specific pockets of the binding grooves themselves.
- the primary anchor residues are located at position 2 (from the amino terminal position) and at the carboxyl terminal position of a peptide epitope in accordance with the invention.
- the primary anchor positions for the A2 motif and supermotif of HLA Class I are set forth in Tables 4A, 4B, 4C, and 4D.
- analog peptides can be created by altering the presence or absence of particular residues in these anchor positions. Such analogs are used to modulate the binding affinity of an epitope comprising a particular motif or supermotif.
- a “secondary anchor residue” is an amino acid at a position other than a primary anchor position in a peptide which may influence peptide binding.
- a secondary anchor residue occurs at a significantly higher frequency among HLA-bound peptides than would be expected by random distribution of amino acid residues at a given position.
- a secondary anchor residue can be identified as a residue which is present at a higher frequency among high or intermediate affinity binding peptides, or a residue otherwise associated with high or intermediate affinity binding.
- the secondary anchor residues are said to occur at “secondary anchor positions.”
- analog peptides can be created by altering the presence or absence of particular residues in these secondary anchor positions. Such analogs are used to finely modulate the binding affinity of an epitope comprising a particular motif or supermotif.
- fixed peptide is generally used to refer to an analog peptide that has changes in primary anchor position; not secondary.
- a “cryptic epitope” elicits a response by immunization with an isolated peptide, but the response is not cross-reactive in vitro when intact whole protein, which comprises the epitope, is used as an antigen.
- Promiscuous recognition” by a TCR is where a distinct peptide is recognized by various T cell clones in the context of various HLA molecules. Promiscuous binding by an HLA molecule is synonymous with cross-reactive binding.
- a “protective immune response” or “therapeutic immune response” refers to a CTL and/or an HTL response to an antigen derived from an pathogenic antigen (e.g., an antigen from an infectious agent or a tumor antigen), which in some way prevents or at least partially arrests disease symptoms, side effects or progression.
- the immune response may also include an antibody response which has been facilitated by the stimulation of helper T cells.
- residue refers to an amino acid residue or amino acid mimetic residue incorporated into a peptide or protein by an amide bond or amide bond mimetic.
- a “subdominant epitope” is an epitope which evokes little or no response upon immunization with a whole antigen or a fragment of the whole antigen comprising a subdominant epitope and a dominant epitope, which comprise the epitope, but for which a response can be obtained by immunization with an isolated peptide, and this response (unlike the case of cryptic epitopes) is detected when whole antigen or a fragment of the whole antigen comprising a subdominant epitope and a dominant epitope is used to recall the response in vitro or in vivo.
- a “vaccine” is a composition used for vaccination, e.g. for prophylaxis or therapy, that comprises one or more peptides of the invention.
- vaccines in accordance with the invention, such as by a cocktail of one or more peptides; one or more peptides of the invention comprised by a polyepitopic peptide; or nucleic acids that encode such peptides or polypeptides, e.g., a minigene that encodes a polyepitopic peptide.
- the “one or more peptides” can include any whole unit integer from 1-150, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 or more peptides of the invention.
- HLA class I-binding peptides of the invention can be linked or to otherwise be combined with HLA class II-binding peptides, e.g. a PADRE® universal HTL-binding peptide, to facilitate activation of both cytotoxic T lymphocytes and helper T lymphocytes.
- Vaccines can comprise peptide pulsed antigen presenting cells, e.g., dendritic cells.
- each residue is generally represented by standard three letter or single letter designations.
- the L -form of an amino acid residue is represented by a capital single letter or a capital first letter of a three-letter symbol
- the D -form for those amino acid residues having D -forms is represented by a lower case single letter or a lower case three letter symbol.
- Glycine has no asymmetric carbon atom and is simply referred to as “Gly” or “G”.
- amino acid sequences of peptides set forth herein are generally designated using the standard single letter symbol.
- A Alanine; C, Cysteine; D, Aspartic Acid; E, Glutamic Acid; F, Phenylalanine; G, Glycine; H, Histidine; I, Isoleucine; K, Lysine; L, Leucine; M, Methionine; N, Asparagine; P, Proline; Q, Glutamine; R, Arginine; S, Serine; T, Threonine; V, Valine; W, Tryptophan; and Y, Tyrosine.
- B in the single letter abbreviations used herein designates ⁇ -amino butyric acid.
- ⁇ -amino butyric acid may be interchanged with cysteine.
- the invention is directed to an isolated peptide comprising or consisting of an epitope and/or analog. In some embodiments, the invention is directed to an isolated polynucleotide encoding such a peptide.
- the isolated epitopes and analogs of the invention are all class I binding peptides, i.e., CTL peptides.
- the epitopes and analogs of the invention comprise an A2 motif or supermotif.
- Epitopes and analogs of the invention are those set forth in Table 3 (SEQ ID NOs:1-10).
- A2 epitopes and analogs of the invention may be referred to herein as “epitopes” and “analogs” or referred to by Table or referred to by SEQ ID NO.
- Other epitopes and analogs are referred to herein as CTL epitopes or CTL peptides and HTL epitopes or HTL peptides.
- the invention is directed to an isolated peptide comprising or consisting of an epitope and/or analog, wherein the epitope or analog consists of a sequence selected from those in Table 3 (SEQ ID NOs:1-10).
- the peptide comprises or consists of an epitope or analog consisting of a sequence in Table 3.
- Peptides of the invention may be fusion proteins of epitope(s) and/or analog(s) to CTL epitope(s), and/or HTL epitope(s), and/or linker(s), and/or spacer(s), and/or carrier(s), and/or additional amino acid residue(s), and/or may comprise or consist of homopolymers of an epitope or analog or heteropolymers of epitopes and/or analogs, as is described in detail below.
- Peptides which comprise an epitope and/or analog of the invention may comprise or consist of a fragment of an antigen (“fragment” or “antigenic fragment”), wherein the fragment comprises an epitope and/or analog.
- fragment may be a portion of CEA, HER2/neu MAGE2, MAGE3, and/or p53 (SEQ ID Nos:11, 12, 13, 14, and 15, respectively).
- the epitope of the invention may be within the fragment or may be linked directly or indirectly, or otherwise connected to the fragment.
- the fragment may comprise or consist of a region of a native antigen that contains a high concentration of class I and/or class II epitopes, preferably it contains the greatest number of epitopes per amino acid length.
- Such epitopes can be present in a frame-shifted manner, e.g., a 10 amino acid long peptide could contain two 9 amino acid residue long epitopes and one 10 amino acid residue long epitope.
- the fragment may be less than or equal to 600 amino acid residues, less than or equal to 500 amino acid residues, less than or equal to 400 amino acid residues, less than or equal to 250 amino acid residues, less than or equal to 100 amino acid residues, less than or equal to 85 amino acid residues, less than or equal to 75 amino acid residues, less than or equal to 65 amino acid residues, or less than or equal to 50 amino acid residues in length.
- a fragment is less than 101 amino acid residues in length, in any increment down to 5 amino acid residues in length.
- the fragment may be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 amino acid residues in length.
- fragments are 9, 10, or 11 amino acid residues in length.
- Fragments of the full length CEA antigen may be fragments from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260, 261-280, 281-300, 301-320, 321-340, 341-360, 361-380, 381-400, 401-420, 421-440, 441-460, 461-480, 481-500, 501-520, 521-540, 541-560, 561-580, 581-600, 601-620, 621-640, 641-660, 661-680 or 681 to the C-terminus of the antigen.
- Fragments of the full length HER2/neu antigen may be fragments from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260, 261-280, 281-300, 301-320, 321-340, 341-360, 361-380, 381-400, 401-420, 421-440, 441-460, 461-480, 481-500, 501-520, 521-540, 541-560, 561-580, 581-600, 601-620, 621-640, 641-660, 661-680, 681-700, 701-720, 721-740, 741-760, 761-780, 781-800, 801-820, 821-840, 841-860, 861-880, 881-900, 901-920, 921-940, 941-960, 961-980, 981-1000, 1001-1020, 1021
- Fragments of the full length MAGE-2 antigen may be fragments from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260, 261-280, 281-300 or 301 to the C-terminus of the antigen.
- Fragments of the full length MAGE-3 antigen may be fragments from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260, 261-280, 281-300 or 301 to the C-terminus of the antigen.
- Fragments of the full length p53 antigen may be fragments from about residue 1-20, 21-40, 41-60, 61-80, 81-100, 101-120, 121-140, 141-160, 161-180, 181-200, 201-220, 221-240, 241-260, 261-280, 281-300, 301-320, 321-340, 341-360, 361-380 or 381 to the C-terminus of the antigen.
- Peptides which comprise an epitope and/or analog of the invention may be a fusion protein comprising one or more amino acid residues in addition to the epitope, analog, or fragment. Fusion proteins include homopolymers and heteropolymers, as described below.
- the peptide comprises or consists of multiple epitopes and/or analogs, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 epitopes and/or analogs of the invention. In some embodiments, the peptide comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10 epitopes and/or analogs of the invention.
- the peptide may also exclude any one or several epitopes and/or analogs selected from those in Table 3 (SEQ ID NOs:1-10).
- Epitopes/analogs which may preferably be excluded from peptides of the invention are SEQ ID NOs:1-10.
- the peptide may also be a homopolymer of one epitope or analog or the peptide may be a heteropolymer which contains at least two different epitopes and/or analogs.
- Polymers have the advantage of increased probability for immunological reaction and, where different epitopes/analogs are used to make up the polymer, the ability to induce antibodies and/or T cells that react with different antigenic determinants of the antigen(s) targeted for an immune response.
- a homopolymer may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 copies of the same epitope or analog.
- a heteropolymer may comprise one or more copies of an individual epitope or analog and one or more copies of one or more different epitopes and/or analogs of the invention.
- the epitopes and/or analogs that form a heteropolymer may all be from the same antigen, e.g., may be from CEA, p53, MAGE2/3, HER2/neu or other antigens herein or known in the art, or may be from different antigens, preferably TAAs.
- Combinations of epitopes and/or analogs that may form a heteropolymer include those combinations described above.
- Heteropolymers may contain multiple copies of one or more epitopes and/or analogs.
- peptides of the invention such as heteropolymers may comprise a first epitope and/or analog and at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 other (different) epitopes and/or analogs.
- Peptides of the invention may also comprise additional amino acid residues.
- the peptides may also comprise a number of CTL and/or HTL epitopes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 CTL and/or HTL epitopes.
- CTL and/or HTL epitopes e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 CTL and/or HTL epitopes.
- the CTL and/or HTL epitope and the epitope/analog of the invention may be from the same TAA or from different TAAs.
- the CTL peptide and/or analog may also be from CEA.
- the CTL peptide and/or HTL peptide may be from another antigen, preferably a TAA antigen such as p53, MAGE2/3 or HER2/neu.
- the epitope and/or analog is from p53
- the CTL peptide and/or HTL peptide may be from p53 or, alternatively, may be from MAGE2/3, HER2/neu, or CEA.
- the CTL peptide and/or HTL peptide may be from tumor-associated antigens such as but not limited to, melanoma antigens MAGE-1, MAGE-2, MAGE-3, MAGE-11, MAGE-A10, as well as BAGE, GAGE, RAGE, MAGE-C1, LAGE-1, CAG-3, DAM, MUC1, MUC2, MUC18, NY-ESO-1, MUM-1, CDK4, BRCA2, NY-LU-1, NY-LU-7, NY-LU-12, CASP8, RAS, KIAA-2-5, SCCs, p53, p73, CEA, HER2/neu, Melan-A, gp100, tyrosinase, TRP2, gp75/TRP1, kallikrein, prostate-specific membrane antigen (PSM), prostatic acid phosphatase (PAP), prostate-specific antigen (PSA), PT1-1, ⁇ -catenin, PRAME, Telomerase, FAK, cyclin D
- Non-limiting examples of CTL peptides and HTL peptides are disclosed in WO 01/42270, published 14 Jun. 2001; WO 01/41788, published 14 Jun. 2001; WO 01/42270, published 14 Jun. 2001; WO 01/45728, published 28 Jun. 2001; and WO 01/41787, published 14 Jun. 2001.
- the HTL peptide may comprise a synthetic peptide such as a Pan-DR-binding epitope (e.g., a PADRE® peptide, Epimmune Inc., San Diego, Calif., described, for example, in U.S. Pat. No. 5,736,142), for example, having the formula aKXVAAZTLKAAa, where “X” is either cyclohexylalanine, phenylalanine, or tyrosine; “Z” is either tryptophan, tyrosine, histidine or asparagine; and “a” is either D -alanine or L -alanine (SEQ ID NO: 746).
- a synthetic peptide such as a Pan-DR-binding epitope (e.g., a PADRE® peptide, Epimmune Inc., San Diego, Calif., described, for example, in U.S. Pat. No. 5,736,142), for example, having the formula aKXVAAZ
- pan-DR binding epitopes comprise all “L” natural amino acid residues; these molecules can be provided as peptides or in the form of nucleic acids that encode the peptide. See also, U.S. Pat. Nos. 5,679,640 and 6,413,935.
- the peptide may comprise additional amino acid residues.
- additional amino acid residues may be Ala, Arg, Asn, Asp, Cys, Gln, Gly, Glu, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Tyr, Trp, Val, amino acid mimetics, and other unnatural amino acid residues such as those described below.
- Additional amino acid residues may provide for ease of linking peptides one to another, for linking epitopes and/or analogs to one another, for linking epitopes and/or analogs to CTL and/or HTL epitopes, for coupling to a carrier support or larger peptide, for modifying the physical or chemical properties of the peptide or oligopeptide, or the like.
- Amino acid residues such as Ala, Arg, Asn, Asp, Cys, Gln, Gly, Glu, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Tyr, Trp, or Val, or the like, can be introduced at the C- and/or N-terminus of the peptide and/or can be introduced internally.
- the peptide may comprise an amino acid spacer, which may be joined to the epitopes, analogs, CTL epitopes, HTL epitopes, carriers, etc. within a peptide or may be joined to the peptide at the N- and/or C-terminus.
- spacers may be at the N-terminus or C-terminus of peptide, or may be internal such that they link or join epitopes, analogs, CTL epitopes, HTL epitopes, carriers, additional amino acid residues, and/or antigenic fragments one to the other.
- the spacer is typically comprised of one or more relatively small, neutral molecules, such as amino acid residues or amino acid mimetics, which are substantially uncharged under physiological conditions.
- the spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acid residues or neutral polar amino acid residues. It will be understood that the optionally present spacer may be composed of the same residues or may be composed of one or more different residues and thus may be a homo- or hetero-oligomer of spacer residues.
- the spacer may contain more than one Ala residue (poly-alanine) or more than one Gly residue (poly-glycine), or may contain both Ala and Gly residues, e.g., Gly, Gly-Gly-, Ser,Ser-Ser-, Gly-Ser-, Ser-Gly-, etc.
- the spacer will usually be at least one or two residues, more usually three to six residues and sometimes 10 or more residues, e.g., 3, 4, 5, 6, 7, 8, 9, or 10, or even more residues. (Livingston, B. D. et al. Vaccine 19:4652-4660 (2000)).
- Peptides may comprise carriers such as those well known in the art, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, polyamino acid residues such as poly L -lysine, poly L -glutamic acid, influenza virus proteins, hepatitis B virus core protein, and the like.
- carriers such as those well known in the art, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, polyamino acid residues such as poly L -lysine, poly L -glutamic acid, influenza virus proteins, hepatitis B virus core protein, and the like.
- the peptide may be modified by terminal-NH 2 acylation, e.g., by alkanoyl (C 1 -C 20 ) or thioglycolyl acetylation, terminal-carboxyl amidation, e.g., ammonia, methylamine, etc. In some instances these modifications may provide sites for linking to a support or other molecule.
- the peptides in accordance with the invention can contain modifications such as but not limited to glycosylation, side chain oxidation, biotinylation, phosphorylation, addition of a surface active material, e.g. a lipid, or can be chemically modified, e.g., acetylation, etc.
- bonds in the peptide can be other than peptide bonds, e.g., covalent bonds, ester or ether bonds, disulfide bonds, hydrogen bonds, ionic bonds, etc.
- Peptides of the present invention may contain substitutions to modify a physical property (e.g., stability or solubility) of the resulting peptide.
- peptides may be modified by the substitution of a cysteine (C) with ⁇ -amino butyric acid (“B”). Due to its chemical nature, cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce binding capacity. Substituting ⁇ -amino butyric acid for C not only alleviates this problem, but actually improves binding and crossbinding capability in certain instances.
- Substitution of cysteine with ⁇ -amino butyric acid may occur at any residue of a peptide, e.g., at either anchor or non-anchor positions of an epitope or analog within a peptide, or at other positions of a peptide.
- the peptides can comprise amino acid mimetics or unnatural amino acid residues, e.g. D - or L -naphylalanine; D - or L -phenylglycine; D - or L -2-thieneylalanine; D - or L -1, -2, 3-, or 4-pyreneylalanine; D - or L -3 thieneylalanine; D - or L -(2-pyridinyl)-alanine; D - or L -(3-pyridinyl)-alanine; D - or L -(2-pyrazinyl)-alanine; D - or L -(4-isopropyl)-phenylglycine; D -(trifluoromethyl)-phenylglycine; D -(trifluoro-methyl)-phenylalanine; D - ⁇ -fluorophenylalanine; D - or L - ⁇ -biphenyl
- Aromatic rings of a non-natural amino acid include, e.g., thiazolyl, thiophenyl, pyrazolyl, benzimidazolyl, naphthyl, furanyl, pyrrolyl, and pyridyl aromatic rings.
- Modified peptides that have various amino acid mimetics or unnatural amino acid residues are particularly useful, as they tend to manifest increased stability in vivo. Such peptides may also possess improved shelf-life or manufacturing properties.
- Peptide stability can be assayed in a number of ways.
- peptidases and various biological media such as human plasma and serum, have been used to test stability. See, e.g., Verhoef, et al., Eur. J. Drug Metab. Pharmacokinetics 11:291 (1986).
- Half-life of the peptides of the present invention is conveniently determined using a 25% human serum (v/v) assay.
- the protocol is generally as follows: Pooled human serum (Type AB, non-heat inactivated) is dilapidated by centrifugation before use. The serum is then diluted to 25% with RPMI-1640 or another suitable tissue culture medium.
- reaction solution is removed and added to either 6% aqueous trichloroacetic acid (TCA) or ethanol.
- TCA aqueous trichloroacetic acid
- the cloudy reaction sample is cooled (4° C.) for 15 minutes and then spun to pellet the precipitated serum proteins. The presence of the peptides is then determined by reversed-phase HPLC using stability-specific chromatography conditions.
- the peptides in accordance with the invention can be a variety of lengths, and either in their neutral (uncharged) forms or in forms which are salts.
- the peptides in accordance with the invention can contain modifications such as glycosylation, side chain oxidation, or phosphorylation, generally subject to the condition that modifications do not destroy the biological activity of the peptides.
- the peptides of the invention may be lyophylized, or may be in crystal form.
- the epitope be as small as possible while still maintaining substantially all of the immunologic activity of the native protein.
- HLA class I binding epitopes of the invention may be desirable to optimize HLA class I binding epitopes of the invention to a length of about 8 to about 13 amino acid residues, for example, 8, 9, 10, 11, 12 or 13, preferably 9 or 10. It is to be appreciated that one or more epitopes in this size range can be comprised by a longer peptide (see the Definition Section for the term “epitope” for further discussion of peptide length).
- HLA class II binding epitopes are preferably optimized to a length of about 6 to about 30 amino acid residues in length, e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30, preferably to between about 13 and about 20 residues, e.g., 13, 14, 15, 16, 17, 18, 19 or 20.
- the epitopes are commensurate in size with endogenously processed pathogen-derived peptides or tumor cell peptides that are bound to the relevant HLA molecules.
- the identification and preparation of peptides of various lengths can be carried out using the techniques described herein.
- Peptides in accordance with the invention can be prepared synthetically, by recombinant DNA technology or chemical synthesis, or can be isolated from natural sources such as native tumors or pathogenic organisms. Epitopes may be synthesized individually or joined directly or indirectly in a peptide. Although the peptide will preferably be substantially free of other naturally occurring host cell proteins and fragments thereof, in some embodiments the peptides may be synthetically conjugated to be joined to native fragments or particles.
- the peptides of the invention can be prepared in a wide variety of ways. For relatively short sizes, the peptides can be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. (See, for example, Stewart & Young, S OLID P HASE P EPTIDE S YNTHESIS , 2 D. ED ., Pierce Chemical Co., 1984). Further, individual peptides can be joined using chemical ligation to produce larger peptides that are still within the bounds of the invention.
- recombinant DNA technology can be employed wherein a nucleotide sequence which encodes a peptide inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
- a nucleotide sequence which encodes a peptide inserted into an expression vector transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
- These procedures are generally known in the art, as described generally in Sambrook et al., M OLECULAR C LONING, A L ABORATORY M ANUAL , Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989).
- recombinant peptides which comprise or consist of one or more epitopes of the invention, can be used to present the appropriate T cell epitope.
- Polynucleotides encoding each of the peptides above are also part of the invention. As appreciated by one of ordinary skill in the art, various nucleic acids will encode the same peptide due to the redundancy of the genetic code. Each of these nucleic acids falls within the scope of the present invention.
- This embodiment of the invention comprises DNA and RNA, and in certain embodiments a combination of DNA and RNA. It is to be appreciated that any polynucleotide that encodes a peptide in accordance with the invention falls within the scope of this invention.
- polynucleotides encoding peptides contemplated herein can be synthesized by chemical techniques, for example, the phosphotriester method of Matteucci, et al., J. Am. Chem. Soc. 103:3185 (1981). Polynucleotides encoding peptides comprising or consisting of an analog can be made simply by substituting the appropriate and desired nucleic acid base(s) for those that encode the native epitope.
- the polynucleotide e.g. minigene (see below), may be produced by assembling oligonucleotides that encode the plus and minus strands of the polynucleotide, e.g. minigene. Overlapping oligonucleotides (15-100 bases long) may be synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides can be joined, for example, using T4 DNA ligase.
- a polynucleotide, e.g. minigene, encoding the peptide of the invention can be cloned into a desired vector such as an expression vector. The coding sequence can then be provided with appropriate linkers and ligated into expression vectors commonly available in the art, and the vectors used to transform suitable hosts to produce the desired peptide such as a fusion protein.
- Bacterial pQE70, pQE60, pQE-9 (Qiagen), pBS, pD10, phagescript, psiX174, pBluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene); ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); pCR (Invitrogen).
- Eukaryotic pWLNEO, pSV2CAT, pOG44, pXT1, pSG (Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); p75.6 (Valentis); pCEP (Invitrogen); pCEI (Epimmune).
- any other plasmid or vector can be used as long as it is replicable and viable in the host.
- bacterial cells such as E. coli, Bacillus subtilis, Salmonella typhimurium and various species within the genera Pseudomonas, Streptomyces , and Staphylococcus
- fungal cells such as yeast
- insect cells such as Drosophila and Sf9
- animal cells such as COS-7 lines of monkey kidney fibroblasts, described by Gluzman, Cell 23:175 (1981), and other cell lines capable of expressing a compatible vector, for example, the C127, 3T3, CHO, HeLa and BHK cell lines or Bowes melanoma; plant cells, etc.
- the selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein.
- the present invention is also directed to vectors, preferably expression vectors useful for the production of the peptides of the present invention, and to host cells comprising such vectors.
- Host cells are genetically engineered (transduced or transformed or transfected) with the vectors of this invention which can be, for example, a cloning vector or an expression vector.
- the vector can be, for example, in the form of a plasmid, a viral particle, a phage, etc.
- the engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the polynucleotides.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- the coding sequence will be provided with operably linked start and stop codons, promoter and terminator regions and usually a replication system to provide an expression vector for expression in the desired cellular host.
- promoter sequences compatible with bacterial hosts are provided in plasmids containing convenient restriction sites for insertion of the desired coding sequence.
- the resulting expression vectors are transformed into suitable bacterial hosts.
- recombinant expression vectors will include origins of replication and selectable markers permitting transformation of the host cell, e.g., the ampicillin resistance gene of E. coli and S. cerevisiae TRP1 gene, and a promoter derived from a highly-expressed gene to direct transcription of a downstream structural sequence.
- promoters can be derived from operons encoding glycolytic enzymes such as 3-phosphoglycerate kinase (PGK), ⁇ -factor, acid phosphatase, or heat shock proteins, among others.
- the heterologous structural sequence is assembled in appropriate phase with translation initiation and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein into the periplasmic space or extracellular medium.
- the heterologous sequence can encode a fusion protein including an N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product.
- Yeast, insect or mammalian cell hosts may also be used, employing suitable vectors and control sequences.
- mammalian expression systems include the COS-7 lines of monkey kidney fibroblasts, described by Gluzman, Cell 23:175 (1981), and other cell lines capable of expressing a compatible vector, for example, the C127, 3T3, CHO, HeLa and BHK cell lines.
- Mammalian expression vectors will comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation site, splice donor and acceptor sites, transcriptional termination sequences, and 5′ flanking nontranscribed sequences.
- Such promoters may also be derived from viral sources, such as, e.g., human cytomegalovirus (CMV-IE promoter) or herpes simplex virus type-1 (HSV TK promoter). Nucleic acid sequences derived from the SV40 splice, and polyadenylation sites can be used to provide the required nontranscribed genetic elements.
- CMV-IE promoter human cytomegalovirus
- HSV TK promoter herpes simplex virus type-1
- Polynucleotides encoding peptides of the invention may also comprise a ubiquitination signal sequence, and/or a targeting sequence such as an endoplasmic reticulum (ER) signal sequence to facilitate movement of the resulting peptide into the endoplasmic reticulum.
- a targeting sequence such as an endoplasmic reticulum (ER) signal sequence to facilitate movement of the resulting peptide into the endoplasmic reticulum.
- ER endoplasmic reticulum
- Polynucleotides of the invention may be expressed in human cells.
- a human codon usage table can be used to guide the codon choice for each amino acid.
- Such polynucleotides preferably comprise spacer amino acid residues between epitopes and/or analogs, such as those described above, or may comprise naturally-occurring flanking sequences adjacent to the epitopes and/or analogs (and/or CTL and HTL epitopes).
- the peptides of the invention can also be expressed by viral or bacterial vectors.
- expression vectors include attenuated viral hosts, such as vaccinia or fowlpox.
- vaccinia virus is used as a vector to express nucleotide sequences that encode the peptides of the invention.
- Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
- Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described by Stover et al., Nature 351:456-460 (1991).
- a wide variety of other vectors useful for therapeutic administration or immunization of the polypeptides of the invention e.g. adeno and adeno-associated virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the like, will be apparent to those skilled in the art from the description herein.
- a preferred vector is Modified Vaccinia Ankara (VA) (e.g. Bavarian Noridic (MVA-BN)).
- Standard regulatory sequences well known to those of skill in the art are preferably included in the vector to ensure expression in the human target cells.
- Numerous promoters can be used for this purpose, e.g., the human cytomegalovirus (hCMV) promoter. See, e.g., U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.
- a preferred promoter is the CMV-IE promoter.
- Polynucleotides may comprise one or more synthetic or naturally-occurring introns in the transcribed region.
- the inclusion of mRNA stabilization sequences and sequences for replication in mammalian cells may also be considered for increasing polynucleotide, e.g. minigene, expression.
- polynucleotide e.g. minigene
- polynucleotide may comprise immunostimulatory sequences (ISSs or CpGs). These sequences may be included in the vector, outside the polynucleotide (e.g. minigene) coding sequence to enhance immunogenicity.
- ISSs immunostimulatory sequences
- CpGs immunostimulatory sequences
- a bi-cistronic expression vector which allows production of both the polynucleotide- (e.g. minigene-) encoded peptides of the invention and a second protein (e.g., one that modulates immunogenicity) can be used.
- proteins or polypeptides that, if co-expressed with peptides of the invention, can enhance an immune response include cytokines (e.g., IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e.g., LeIF), costimulatory molecules, or pan-DR binding proteins (PADRE® molecules, Epimmune, San Diego, Calif.).
- Helper T cell (HTL) epitopes such as PADRE® molecules can be joined to intracellular targeting signals and expressed separately from expressed peptides of the invention. Specifically decreasing the immune response by co-expression of immunosuppressive molecules (e.g. TGF- ⁇ ) may be beneficial in certain diseases.
- immunosuppressive molecules e.g. TGF- ⁇
- the polynucleotide e.g. minigene
- the polylinker region downstream of the promoter is transformed into an appropriate bacterial strain, and DNA is prepared using standard techniques.
- the orientation and DNA sequence of the polynucleotide, e.g. minigene, as well as all other elements included in the vector, are confirmed using restriction mapping, DNA sequence analysis, and/or PCR analysis.
- Bacterial cells harboring the correct plasmid can be stored as cell banks.
- Therapeutic/prophylactic quantities of DNA can be produced for example, by fermentation in E. coli , followed by purification. Aliquots from the working cell bank are used to inoculate growth medium, and are grown to saturation in shaker flasks or a bioreactor according to well known techniques. Plasmid DNA is purified using standard bioseparation technologies such as solid phase anion-exchange resins available, e.g., from QIAGEN, Inc. (Valencia, Calif.). If required, supercoiled DNA can be isolated from the open circular and linear forms using gel electrophoresis dr other methods.
- Purified polynucleotides can be prepared for injection using a variety of formulations.
- the simplest of these is reconstitution of lyophilized polynucleotide, e.g. DNA, in sterile phosphate-buffer saline (PBS).
- PBS sterile phosphate-buffer saline
- naked DNA is currently being used by others for intramuscular (IM) administration in clinical trials.
- IM intramuscular
- alternative methods of formulating purified plasmid DNA may be used. A variety of such methods have been described, and new techniques may become available.
- Cationic lipids, glycolipids, and fusogenic liposomes can also be used in the formulation (see, e.g., WO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682 (1988); U.S. Pat. No. 5,279,833; WO 91/06309; and Felgner, et al., Proc. Nat'l Acad. Sci. USA 84:7413 (1987).
- peptides and compounds referred to collectively as protective, interactive, non-condensing compounds can also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
- the polynucleotide can be complexed to polyvinylpyrrolidone (PVP), to prolong the localized bioavailability of the polynucleotide, thereby enhancing uptake of the polynucleotide by the organism (see e.g., U.S. Pat. No. 6,040,295; EP 0 465 529; WO 98/17814).
- PVP polyvinylpyrrolidone
- This approach is thought to be more effective than inoculation with merely “naked” DNA.
- PVP is a polyamide that is known to form complexes with a wide variety of substances, and is chemically and physiologically inert.
- Target cell sensitization can be used as a functional assay of the expression and HLA class I presentation of polynucleotide- (e.g. minigene-) encoded peptides.
- polynucleotide- e.g. minigene-
- the polynucleotide e.g. plasmid DNA
- the transfection method used will be dependent on the final formulation. For example, electroporation can be used for “naked” DNA, whereas cationic lipids or PVP-formulated DNA allow direct in vitro transfection.
- a plasmid expressing green fluorescent protein can be co-transfected to allow enrichment of transfected cells using fluorescence activated cell sorting (FACS).
- FACS fluorescence activated cell sorting
- the transfected cells are then chromium-51 ( 51 Cr) labeled and used as targets for epitope-specific CTLs. Cytolysis of the target cells, detected by 51 Cr release, indicates both production and HLA presentation of, polynucleotide-, e.g. minigene-, encoded epitopes and/or analogs of the invention, or peptides comprising them.
- Expression of HTL epitopes may be evaluated in an analogous manner using assays to assess HTL activity.
- In vivo immunogenicity is a second approach for functional testing of polynucleotides, e.g. minigenes.
- Transgenic mice expressing appropriate human HLA proteins are immunized with the polynucleotide, e.g. DNA, product.
- the dose and route of administration are formulation dependent (e.g., IM for polynucleotide (e.g., naked DNA or PVP-formulated DNA) in PBS, intraperitoneal (IP) for lipid-complexed polynucleotide (e.g., DNA)).
- splenocytes are harvested and restimulated for one week in the presence of polynucleotides encoding each peptide being tested. Thereafter, for peptides comprising or consisting of epitopes and/or analogs, standard assays are conducted to determine if there is cytolysis of peptide-loaded, 51 Cr-labeled target cells. Once again, lysis of target cells that were exposed to epitopes and/or analogs corresponding to those encoded by the polynucleotide, e.g. minigene, demonstrates polynucleotide, e.g., DNA, vaccine function and induction of CTLs. Immunogenicity of HTL epitopes is evaluated in transgenic mice in an analogous manner.
- the nucleic acids can be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253.
- particles comprised solely of a polynucleotide such as DNA are administered.
- polynucleotides such as DNA can be adhered to particles, such as gold particles.
- a polynucleotide such as a multi-epitope DNA plasmid can be engineered which encodes an epitope derived from multiple regions of a TAA (e.g., p53, HER2/neu, MAGE-2/3, or CEA), a pan-DR binding peptide such as the PADRE® universal helper T cell epitope, and an endoplasmic reticulum-translocating signal sequence.
- a peptide/polynucleotide may also comprise/encode epitopes that are derived from other TAAs.
- the invention includes peptides as described herein, polynucleotides encoding each of said peptides, as well as compositions comprising the peptides and polynucleotides, and includes methods for producing and methods of using the peptides, polynucleotides, and compositions, as further described below.
- compositions are directed to a composition comprising one or more peptides and/or a polynucleotide of the invention and optionally another component(s).
- the composition comprises or consists of multiple peptides, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 peptides of the invention. In some embodiments, the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10 peptides of the invention.
- compositions of the invention may comprise polynucleotides encoding the above peptides and/or combinations of peptides.
- the composition can comprise at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10 peptides and/or polynucleotides selected from those described above or below. At least one of the one or more peptides can be a heteropolymer or a homopolymer. Additionally, the composition can comprise a CTL and/or HTL epitope, which can be derived from a tumor-associated antigen. The additional epitope can also be a PanDR binding molecule, (e.g., a PADRE® universal helper T cell epitope).
- Optional components include excipients, diluents, proteins such as peptides comprising a CTL epitope, and/or an HTL epitope such as a pan-DR binding peptide (e.g., a PADRE® universal helper T cell epitope), and/or a carrier, polynucleotides encoding such proteins, lipids, or liposomes, as well as other components described herein.
- compositions in accordance with the invention such as a cocktail of one or more peptides and/or polynucleotides; one or more peptides and/or analogs and one or more CTL and/or HTL epitopes; and/or nucleic acids that encode such peptides, e.g., minigenes.
- Compositions may comprise one or more peptides (and/or polynucleotides such as minigenes) of the invention, along with one or more other components as described above and herein.
- “One or more” refers to any whole unit integer from 1-150, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 peptides, polynucleotides, or other components.
- compositions of the invention may be, for example, polynucleotides or, polypeptides of the invention combined with or completed to cationic lipid formulations; lipopeptides (e.g., Vitiello, A. et al., J. Clin. Invest. 95:341, 1995), encapsulated e.g., in poly(DL-lactide-co-glycolide) (“PLG”) microspheres (see, e.g., Eldridge, et al., Molec. Immunol.
- lipopeptides e.g., Vitiello, A. et al., J. Clin. Invest. 95:341, 1995
- PLG poly(DL-lactide-co-glycolide)
- particles of viral or synthetic origin e.g., Kofler, N. et al., J. Immunol. Methods. 192:25, 1996; Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993; Falo, L. D., Jr. et al., Nature Med. 7:649, 1995
- adjuvants e.g., incomplete Freund's adjuvant
- Toxin-targeted delivery technologies also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Mass.) or attached to a stress protein, e.g., HSP 96 (Stressgen Biotechnologies Corp., Victoria, BC, Canada) can also be used.
- compositions of the invention comprise polynucleotide-mediated modalities.
- DNA or RNA encoding one or more of the peptides of the invention can be administered to a patient. This approach is described, for instance, in Wolff et. al., Science 247:1465 (1990) as well as U.S. Pat. Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; and, WO 98/04720.
- DNA-based delivery technologies include “naked DNA” (see, e.g., U.S. Pat. No.
- peptides of the invention can be expressed by viral or bacterial vectors.
- expression vectors include attenuated viral hosts, such as Modified Vaccinia Ankara (MVA) (e.g., Bavarian Noridic), vaccinia or fowlpox.
- vaccinia virus is used as a vector to express nucleotide sequences that encode the peptides of the invention. Upon introduction into an acutely or chronically infected host or into a non-infected host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits an immune response.
- Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
- Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al., Nature 351:456-460 (1991).
- adeno and adeno-associated virus vectors e.g. alpha virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the like, are apparent to those skilled in the art from the description herein.
- components that induce T cell responses are combined with components that induce antibody responses to the target antigen of interest.
- a preferred embodiment of such a composition comprises class I and class II epitopes in accordance with the invention.
- a composition comprises a class I and/or class II epitope in accordance with the invention, along with a PADRE® molecule (Epimmune, San Diego, Calif.).
- compositions of the invention can comprise antigen presenting cells, such as dendritic cells.
- Antigen presenting cells e.g., dendritic cells
- the peptide can be bound to an HLA molecule on the antigen-resenting cell, whereby when an HLA-restricted cytotoxic T lymphocyte (CTL) is present, a receptor of the CTL binds to a complex of the HLA molecule and the peptide.
- CTL cytotoxic T lymphocyte
- compositions of the invention may also comprise antiviral drugs such as interferon- ⁇ , or immune adjuvants such as IL-12, GM-CSF, etc.
- antiviral drugs such as interferon- ⁇ , or immune adjuvants such as IL-12, GM-CSF, etc.
- Compositions may comprise an HLA heavy chain, 2-microglobulin, streptavidin, and/or biotin.
- the streptavidin may be fluorescently labeled.
- Compositions may comprise tetramers (see e.g., U.S. Pat. No. 5,635,363; Science 274:94-96 (1996)).
- a tetramer composition comprising an HLA heavy chain, ⁇ 2 -microglobulin, streptavidin, and biotin.
- the streptavidin may be fluorescently labeled.
- Compositions may also comprise dimers.
- a dimer composition comprises as MHC molecule and an Ig molecule (see e.g., Proc. Natl. Acad. Sci., USA, 95:7568-73 (1998)).
- compositions of the invention at least one component which primes cytotoxic T lymphocytes.
- Lipids have been identified as agents capable of priming CTL in vivo against viral antigens.
- palmitic acid residues can be attached to the ⁇ - and ⁇ -amino groups of a lysine residue and then linked, e.g., via one or more linking residues such as Gly, Gly-Gly-, Ser, Ser-Ser, or the like, to an immunogenic peptide.
- the lipidated peptide can then be administered either directly in a micelle or particle, incorporated into a liposome, or emulsified in an adjuvant, e.g., incomplete Freund's adjuvant.
- a preferred composition comprises palmitic acid attached to ⁇ - and ⁇ -amino groups of Lys, which is attached via linkage, e.g., Ser-Ser, to the amino terminus of the peptide.
- E. coli lipoproteins such as tripalmitoyl-S-glycerylcysteinlyseryl-serine P 3 CSS
- P 3 CSS tripalmitoyl-S-glycerylcysteinlyseryl-serine
- Another preferred embodiment is a composition comprising one or more peptides of the invention emulsified in IFA.
- a highly preferred embodiment of the invention comprises peptides comprising SEQ ID NOs:1-10 of the invention emulsified in IFA.
- compositions of the invention may also comprise CTL and/or HTL peptides.
- CTL and HTL peptides can be modified by the addition of amino acid residues to the termini of a peptide to provide for ease of linking peptides one to another, for coupling to a carrier support or larger peptide, for modifying the physical or chemical properties of the peptide or oligopeptide, or the like.
- Amino acid residues such as tyrosine, cysteine, lysine, glutamic or aspartic acid, or naturally or unnaturally occurring amino acid residues, can be introduced at the carboxyl- or amino-terminus of the peptide or oligopeptide, particularly class I peptides.
- modification at the carboxyl terminus of a CTL epitope may, in some cases, alter binding characteristics of the peptide.
- the peptide or oligopeptide sequences can differ from the natural sequence by being modified by terminal-NH 2 acylation, e.g., by alkanoyl (C 1 -C 20 ) or thioglycolyl acetylation, terminal-carboxyl amidation, e.g., ammonia, methylamine, etc. In some instances these modifications may provide sites for linking to a support or other molecule.
- CTL and HTL epitopes may comprise additional amino acid residues, such as those described above including spacers.
- a further embodiment of a composition in accordance with the invention is an antigen presenting cell that comprises one or more peptides in accordance with the invention.
- the antigen presenting cell can be a “professional” antigen presenting cell, such as a dendritic cell.
- the antigen presenting cell can comprise the peptide of the invention by any means known or to be determined in the art. Such means include pulsing of dendritic cells with one or more individual peptides, by nucleic acid administration such as ballistic nucleic acid delivery or by other techniques in the art for administration of nucleic acids, including vector-based, e.g. viral vector, delivery of nucleic acids.
- compositions may comprise carriers.
- Carriers that can be used with compositions of the invention are well known in the art, and include, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, polyamino acid residues such as poly L -lysine, poly L -glutamic acid, influenza virus proteins, hepatitis B virus core protein, and the like.
- compositions can contain a physiologically tolerable diluent such as water, or a saline solution, preferably phosphate buffered saline.
- a physiologically tolerable diluent such as water, or a saline solution, preferably phosphate buffered saline.
- CTL responses can be primed by conjugating peptides of the invention to lipids, such as tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine (P 3 CSS).
- P 3 CSS tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine
- compositions of the invention may be pharmaceutically acceptable compositions.
- Pharmaceutical compositions preferably contain an immunologically effective amount of one or more peptides and/or polynucleotides of the invention, and optionally one or more other components which are pharmaceutically acceptable.
- a preferred composition comprises one or more peptides of the invention and IFA.
- a more preferred composition of the invention comprises one or more peptides of the invention, one or more peptides, and IFA.
- the immune system of the host Upon immunization with a peptide and/or polynucleotide and/or composition in accordance with the invention, via injection (e.g. SC, ID, IM), aerosol, oral, transdermal, transmucosal, intrapleural, intrathecal, or other suitable routes, the immune system of the host responds to the vaccine by an immune response comprising the production of antibodies, CTLs and/or HTLs specific for the desired antigen(s). Consequently, the host becomes at least partially immune to subsequent exposure to the TAA(s), or at least partially resistant to further development of TAA-bearing cells and thereby derives a prophylactic or therapeutic benefit.
- injection e.g. SC, ID, IM
- aerosol e.g. SC, ID, IM
- oral e.g. SC, ID, IM
- transdermal e.g., transdermal
- transmucosal e.g., intrapleural, intrathecal, or other suitable
- the peptides, primers, and epitopes of the invention can be used in any desired immunization or administration regimen; e.g., as part of periodic vaccinations such as annual vaccinations as in the veterinary arts or as in periodic vaccinations as in the human medical arts, or as in a prime-boost regime wherein an inventive vector or recombinant is administered either before or after the administration of the same or of a different epitope of interest or recombinant or vector expressing such as a same or different epitope of interest (including an inventive recombinant or vector expressing such as a same or different epitope of interest), see, e.g., U.S. Pat. Nos.
- An useful viral vector of the present invention is Modified Vaccinia Ankara (MVA) (e.g., Bavarian Noridic (MVA-BN)).
- MVA Modified Vaccinia Ankara
- MVA-BN Bavarian Noridic
- Retroviruses 11:272-381 (1995)). Macaques immunized with a vaccinia recombinant expressing the simian immunodeficiency virus (SIV) envelope glycoprotein and boosted with SIV envelope glycoprotein from a baculovirus recombinant are protected against SIV challenge (Hu et al., AID Res. and Hum. Retroviruses, 3:615-620 (1991); Hu et al., Science 255:456-459 (1992)). In the same fashion, purified HCMVgB protein can be used in prime-boost protocols with NYVAC or ALVAC-gB recombinants.
- SIV simian immunodeficiency virus
- the polynucleotides are complexed in a liposome preparation.
- Liposomal preparations for use in the instant invention include cationic (positively charged), anionic (negatively charged) and neutral preparations.
- cationic liposomes are particularly preferred because a tight charge complex can be formed between the cationic liposome and the polyanionic nucleic acid.
- Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Felgner et al., Proc. Natl. Acad. Sci. USA 84:74137416 (1987), which is herein incorporated by reference); mRNA (Malone et al., Proc. Natl. Acad. Sci.
- Cationic liposomes are readily available.
- N-[12,3-dioleyloxy)-propyl]-N,N,N-triethylammonium (DOTMA) liposomes are particularly useful and are available under the trademark Lipofectin®, from Invitrogen, Carlsbad, Calif. (See, also, Felgner et al., Proc. Natl. Acad. Sci. USA 84:74137416 (1987)).
- Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boehringer).
- cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, e.g. PCT Publication No. WO 90/11092 for a description of the synthesis of DOTAP (1,2-bis(oleoyloxy)-3-(trimethylammonio)propane) liposomes. Preparation of DOTMA liposomes is explained in the literature, see, e.g., P. Felgner et al., Proc. Natl. Acad. Sci. USA 84:74137417. Similar methods can be used to prepare liposomes from other cationic lipid materials.
- anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (Birmingham, Ala.), or can be easily prepared using readily available materials.
- Such materials include phosphatidyl, choline, cholesterol, phosphatidyl ethanolamine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphosphatidyl ethanolamine (DOPE), among others.
- DOPC dioleoylphosphatidyl choline
- DOPG dioleoylphosphatidyl glycerol
- DOPE dioleoylphosphatidyl ethanolamine
- These materials can also be mixed with the DOTMA and DOTAP starting materials in appropriate ratios. Methods for making liposomes using these materials are well known in the art.
- DOPC dioleoylphosphatidyl choline
- DOPG dioleoylphosphatidyl glycerol
- DOPE dioleoylphosphatidyl ethanolamine
- DOPG/DOPC vesicles can be prepared by drying 50 mg each of DOPG and DOPC under a stream of nitrogen gas into a sonication vial. The sample is placed under a vacuum pump overnight and is hydrated the following day with deionized water.
- the sample is then sonicated for 2 hours in a capped vial, using a Heat Systems model 350 sonicator equipped with an inverted cup (bath type) probe at the maximum setting while the bath is circulated at 15° C.
- negatively charged vesicles can be prepared without sonication to produce multilamellar vesicles or by extrusion through nucleopore membranes to produce unilamellar vesicles of discrete size.
- Other methods are known and available to those of skill in the art.
- the liposomes can comprise multilamellar vesicles (MLVs), small unilamellar vesicles (SUVs), or large unilamellar vesicles (LUVs), with SUVs being preferred.
- MLVs multilamellar vesicles
- SUVs large unilamellar vesicles
- the various liposome nucleic acid complexes are prepared using methods well known in the art. See, e.g., Straubinger et al., Methods of Immunology 101:512527 (1983).
- MLVs containing nucleic acid can be prepared by depositing a thin film of phospholipid on the walls of a glass tube and subsequently hydrating with a solution of the material to be encapsulated.
- SUVs are prepared by extended sonication of MLVs to produce a homogeneous population of unilamellar liposomes.
- the material to be entrapped is added to a suspension of preformed MLVs and then sonicated.
- liposomes containing cationic lipids the dried lipid film is resuspended in an appropriate solution such as sterile water or an isotonic buffer solution such as 10 mM Tris/NaCl, sonicated, and then the preformed liposomes are mixed directly with the DNA.
- the liposome and DNA form a very stable complex due to binding of the positively charged liposomes to the cationic DNA.
- SUVs find use with small nucleic acid fragments.
- LUVs are prepared by a number of methods, well known in the art. Commonly used methods include Ca 2+ -EDTA chelation (Papahadjopoulos et al., Biochim. Biophys. Acta 394:483 (1975); Wilson et al., Cell 17:77 (1979)); ether injection (Deamer, D. and Bangham, A., Biochim. Biophys. Acta 443:629 (1976); Ostro et al., Biochem. Biophys. Res. Commun. 76:836 (1977); Fraley et al., Proc. Natl. Acad. Sci. USA 76:3348 (1979)); detergent dialysis (Enoch, H.
- the ratio of DNA to liposomes will be from about 10:1 to about 1:10.
- the ration will be from about 5:1 to about 1:5. More preferably, the ration will be about 3:1 to about 1:3. Still more preferably, the ratio will be about 1:1.
- U.S. Pat. No. 5,676,954 reports on the injection of genetic material, complexed with cationic liposome carriers, into mice.
- WO 94/9469 provide cationic lipids for use in transfecting DNA into cells and mammals.
- WO 94/9469 provide methods for delivering DNA-cationic lipid complexes to mammals.
- the large degree of HLA polymorphism is an important factor to be taken into account with the epitope-based approach to developing therapeutics and diagnostics.
- epitope selection encompassing identification of peptides capable of binding at high or intermediate affinity to multiple HLA molecules is preferably utilized, most preferably these epitopes bind at high or intermediate affinity to two or more allele-specific HLA molecules.
- all epitopes in a given composition bind to the alleles of a single HLA supertype or a single HLA molecule.
- Epitopes and analogs of the invention preferably include those that have an IC 50 or binding affinity value for a class I HLA molecule(s) of 500 nM or better (i.e., the value is ⁇ 500 nM).
- peptides of interest have an IC 50 or binding affinity value for a class I HLA molecule(s) of 200 nM or better.
- peptides of interest have an IC 50 or binding affinity value for a class I HLA molecule(s) of 100 nM or better.
- HTL epitopes are included, they preferably are HTL epitopes that have an IC 50 or binding affinity value for class II HLA molecules of 1000 nM or better, (i.e., the value is ⁇ 1,000 nM).
- peptide binding is assessed by testing the capacity of a candidate peptide to bind to a purified HLA molecule in vitro. Peptides exhibiting high or intermediate affinity are then considered for further analysis. Selected peptides are generally tested on other members of the supertype family. In preferred embodiments, peptides that exhibit cross-reactive binding are then used in cellular screening analyses or vaccines.
- Immunogenicity corresponds to whether an immune response is elicited at all, and to the vigor of any particular response, as well as to the extent of a population in which a response is elicited.
- a peptide might elicit an immune response in a diverse array of the population, yet in no instance produce a vigorous response.
- close to 90% of high binding peptides have been found to elicit a response and thus be “immunogenic,” as contrasted with about 50% of the peptides that bind with intermediate affinity.
- High affinity-binding class I peptides generally have an affinity of less than or equal to 100 nM. Moreover, not only did peptides with higher binding affinity have an enhanced probability of generating an immune response, the generated response tended to be more vigorous than the response seen with weaker binding peptides. As a result, less peptide is required to elicit a similar biological effect if a high affinity binding peptide is used rather than a lower affinity one. Thus, in some preferred embodiments of the invention, high affinity binding epitopes are used.
- binding affinity and immunogenicity was analyzed by the present inventors by two different experimental approaches (see, e.g., Sette, et al., J. Immunol. 153:5586-5592 (1994)).
- the immunogenicity of potential epitopes ranging in HLA binding affinity over a 10,000-fold range was analyzed in HLA-A*0201 transgenic mice.
- the antigenicity of approximately 100 different hepatitis B virus (HBV)-derived potential epitopes, all carrying A*0201 binding motifs was assessed by using PBL from acute hepatitis patients.
- HBV hepatitis B virus
- an affinity threshold value of approximately 500 nM determines the capacity of a peptide epitope to elicit a CTL response.
- HLA class II i.e., HLA DR
- HLA DR HLA class II
- DR restriction was associated with intermediate affinity (binding affinity values in the 100-1000 nM range). In only one of 32 cases was DR restriction associated with an IC 50 of 1000 nM or greater. Thus, 1000 nM is defined as an affinity threshold associated with immunogenicity in the context of DR molecules.
- All 240 peptides were evaluated for binding to five allele-specific HLA molecules that are expressed at high frequency among different ethnic groups. This unbiased set of peptides allowed an evaluation of the predictive values of HLA class I motifs. From the set of 240 peptides, 22 peptides were identified that bound to an allele-specific HLA molecule with high or intermediate affinity. Of these 22 peptides, 20 (i.e. 91%) were motif-bearing. Thus, this study demonstrated the value of motifs for identification of peptide epitopes to be included in a vaccine.
- motif-based identification techniques identifies approximately 90% of all potential epitopes in a target protein sequence. Without the disclosed motif analysis, the ability to practically identify immunogenic peptide(s) for use in diagnostics or therapeutics is seriously impaired.
- Peptides, pharmaceutical compositions and vaccines of the present invention may also comprise epitopes that bind to MHC class II DR molecules.
- This increased heterogeneity of HLA class II peptide ligands is due to the structure of the binding groove of the HLA class II molecule which, unlike its class I counterpart, is less physically constricted at both ends. Crystallographic analysis of HLA class II DRB*0101-peptide complexes to identify the residues associated with major binding energy identified those residues complexed with complementary pockets on the DRBI*0101 molecules.
- P1 may represent the N-terminal residue of a class II binding peptide epitope, but more typically is flanked towards the N-terminus by one or more residues.
- Other studies have also pointed to an important role for the peptide residue in the sixth position towards the C-terminus, relative to P1, for binding to various DR molecules. See, e.g., U.S. Pat. No. 5,736,142, and co-pending applications entitled Alteration Of Immune Responses Using Pan DR Binding Peptides, U.S. Ser. No. 09/709,774, filed Nov. 8, 2000 and 09/707,738, filed Nov. 6, 2000.
- HLA-A2 supermotif which when present in peptide ligands corresponds to the ability to bind several different HLA-A2 and -A28 molecules.
- the HLA-A2 supermotif comprises peptide ligands with L, I, V, M, A, T, or Q as a primary anchor residue at position 2 and L, I, V, M, A, or T as a primary anchor residue at the C-terminal position of the epitope.
- the corresponding family of HLA molecules (i.e., the HLA-A2 supertype that binds these peptides) is comprised of at least: A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207, A*0209, A*0214, A*6802, and A*6901.
- Other allele-specific HLA molecules predicted to be members of the A2 superfamily are shown in Tables 4D and 6.
- binding to each of the individual allele-specific HLA molecules can be modulated by substitutions at the primary anchor and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
- HLA-A2*0201 motif was determined to be characterized by the presence in peptide ligands of L or M as a primary anchor residue in position 2, and L or V as a primary anchor residue at the C-terminal position of a 9-residue peptide (see, e.g., Falk et al., Nature 351:290-296 (1991)) and was further found to comprise an I at position 2 and I or A at the C-terminal position of a nine amino acid peptide (see, e.g., Hunt et al., Science 255:1261-1263, Mar. 6, 1992; Parker et al., J. Immunol.
- the A*0201 allele-specific motif has also been defined by the present inventors to additionally comprise V, A, T, or Q as a primary anchor residue at position 2, and M or T as a primary anchor residue at the C-terminal position of the epitope (see, e.g., Kast et al., J. Immunol. 152:3904-3912, 1994).
- the HLA-A*0201 motif comprises peptide ligands with L, I, V, M, A, T, or Q as primary anchor residues at position 2 and L, I, V, M, A, or T as a primary anchor residue at the C-terminal position of the epitope.
- the preferred and less preferred/tolerated residues that characterize the primary anchor positions of the HLA-A*0201 motif are identical to the residues describing the A2 supermotif.
- HLA class II peptide epitope supermotifs and motifs are summarized in U.S. Pat. Nos. 5,736,142, 5,679,640 and 6,413,935; co-pending applications entitled Alteration Of Immune Responses Using Pan DR Binding Peptides, U.S. Ser. No. 09/709,774, filed Nov. 8, 2000 and 09/707,738, filed Nov. 6, 2000; and PCT publication Nos. WO 95/07707 and WO 97/26784.
- CTL and HTL responses are not directed against all possible epitopes. Rather, they are restricted to a few “immunodominant” determinants (Zinkernagel, et al., Adv. Immunol. 27:5159, 1979; Bennink, et al., J. Exp. Med. 168:19351939, 1988; Rawle, et al., J. Immunol. 146:3977-3984, 1991).
- dominance and subdominance are relevant to immunotherapy of both infectious diseases and malignancies.
- recruitment of subdominant epitopes can be important for successful clearance of the infection, especially if dominant CTL or HTL specificities have been inactivated by functional tolerance, suppression, mutation of viruses and other mechanisms (Franco, et al., Curr. Opin. Immunol. 7:524-531, 1995).
- CTLs recognizing at least some of the highest binding affinity peptides might be functionally inactivated. Lower binding affinity peptides are preferentially recognized at these times, and may therefore be preferred in therapeutic or prophylactic anti-cancer vaccines.
- TAA tumor associated antigens
- TIL tumor infiltrating lymphocytes
- CTL bound in the 50-500 nM range.
- T cells to dominant epitopes may have been clonally deleted, and selecting subdominant epitopes may allow existing T cells to be recruited, which will then lead to a therapeutic or prophylactic response.
- the binding of HLA molecules to subdominant epitopes is often less vigorous than to dominant ones.
- peptides with suitable cross-reactivity among all alleles of a superfamily are identified by the screening procedures described above, cross-reactivity is not always as complete as possible, and in certain cases procedures to increase cross-reactivity of peptides can be useful; moreover, such procedures can also be used to modify other properties of the peptides such as binding affinity or peptide stability. Having established the general rules that govern cross-reactivity of peptides for HLA alleles within a given motif or supermotif, modification (i.e., analoging) of the structure of peptides of particular interest in order to achieve broader (or otherwise modified) HLA binding capacity can be performed.
- peptides that exhibit the broadest cross-reactivity patterns can be produced in accordance with the teachings herein.
- the present concepts related to analog generation are set forth in greater detail in co-pending U.S. Ser. No. 09/226,775 filed 6 Jan. 1999.
- the analoging strategy utilizes the motifs or supermotifs that correlate with binding to certain HLA molecules.
- Analog peptides can be created by substituting amino acid residues at primary anchor, secondary anchor, or at primary and secondary anchor positions.
- analogs are made for peptides that already bear a motif or supermotif.
- preferred primary and secondary anchor residues of supermotifs and motifs for HLA-A2 class I binding peptides are shown in Tables 4A, 4B, and 4C.
- residues are defined which are deleterious to binding to allele-specific HLA molecules or members of HLA supertypes that bind the respective motif or supermotif (Table 4C). Accordingly, removal of such residues that are detrimental to binding can be performed in accordance with the present invention.
- one strategy to improve the cross-reactivity of peptides within a given supermotif is simply to delete one or more of the deleterious residues present within a peptide and substitute a small “neutral” residue such as Ala (that may not influence T cell recognition of the peptide).
- An enhanced likelihood of cross-reactivity is expected if, together with elimination of detrimental residues within a peptide, “preferred” residues associated with high affinity binding to an allele-specific HLA molecule or to multiple HLA molecules within a superfamily are inserted.
- the analog peptide when used as a vaccine, actually elicits a CTL response to the native epitope in vivo (or, in the case of class II epitopes, elicits helper T cells that cross-react with the wild type peptides), the analog peptide may be used to induce T cells in vitro from individuals of the appropriate HLA allele. Thereafter, the immunized cells' capacity to lyse wild type peptide sensitized target cells is evaluated. Alternatively, evaluation of the cells' activity can be evaluated by monitoring IFN release. Each of these cell monitoring strategies evaluate the recognition of the APC by the CTL.
- antigen presenting cells cells that have been either infected, or transfected with the appropriate genes, or, (generally only for class II epitopes, due to the different peptide processing pathway for HLA class II), cells that have been pulsed with whole protein antigens, to establish whether endogenously produced antigen is also recognized by the T cells induced by the analog peptide.
- peptide/protein-pulsed dendritic cells can be used to present whole protein antigens for both HLA class I and class II.
- Another embodiment of the invention is to create analogs of weak binding peptides, to thereby ensure adequate numbers of cellular binders.
- Class I binding peptides exhibiting binding affinities of 500-5000 nM, and carrying an acceptable but suboptimal primary anchor residue at one or both positions can be “fixed” by substituting preferred anchor residues in accordance with the respective supertype. The analog peptides can then be tested for binding and/or cross-binding capacity.
- Another embodiment of the invention is to create analogs of peptides that are already cross-reactive binders and are vaccine candidates, but which bind weakly to one or more alleles of a supertype. If the cross-reactive binder carries a suboptimal residue (less preferred or deleterious) at a primary or secondary anchor position, the peptide can be analoged by substituting out a deleterious residue and replacing it with a preferred or less preferred one, or by substituting out a less preferred reside and replacing it with a preferred one. The analog peptide can then be tested for cross-binding capacity.
- Another embodiment for generating effective peptide analogs involves the substitution of residues that have an adverse impact on peptide stability or solubility in, e.g., a liquid environment. This substitution may occur at any position of the peptide epitope.
- a cysteine (C) can be substituted in favor of ⁇ -amino butyric acid. Due to its chemical nature, cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce binding capacity.
- tumor associated antigen peptide epitopes and analogs thereof that were found to bind HLA-A2 allele-specific molecules and to bind members of the HLA-A2 supertype have been identified.
- amino acid residues can be added to the termini of a peptide to provide for ease of linking peptides one to another, for coupling to a carrier support or larger peptide, for modifying the physical or chemical properties of the peptide or oligopeptide, or the like.
- Amino acid residues such as tyrosine, cysteine, lysine, glutamic or aspartic acid, or any naturally occurring or any non-naturally occurring amino acid residues, can be introduced at the C- and/or N-terminus of the peptide or oligopeptide, particularly class I peptides. It is to be noted that modification at the carboxyl terminus of a CTL epitope may, in some cases, alter binding characteristics of the peptide.
- the peptide or oligopeptide sequences can differ from the natural sequence by being modified by terminal-NH 2 acylation, e.g., by alkanoyl (C 1 -C 20 ) or thioglycolyl acetylation, terminal-carboxyl amidation, e.g., ammonia, methylamine, etc. In some instances these modifications may provide sites for linking to a support or other molecule.
- HLA binding peptides Once HLA binding peptides are identified, they can be tested for the ability to elicit a T-cell response.
- the preparation and evaluation of motif-bearing peptides are described, e.g., in PCT publications WO 94/20127 and WO 94/03205. Briefly, peptides comprising epitopes from a particular antigen are synthesized and tested for their ability to bind to relevant HLA proteins. These assays may involve evaluation of peptide binding to purified HLA class I molecules in relation to the binding of a radioiodinated reference peptide. Alternatively, cells expressing empty class I molecules (i.e.
- cell surface HLA molecules that lack any bound peptide may be evaluated for peptide binding by immunofluorescent staining and flow microfluorimetry.
- Other assays that may be used to evaluate peptide binding include peptide-dependent class I assembly assays and/or the inhibition of CTL recognition by peptide competition.
- Those peptides that bind to an HLA class I molecule typically with an affinity of 500 nM or less, are further evaluated for their ability to serve as targets for CTLs derived from infected or immunized individuals, as well as for their capacity to induce primary in vitro or in vivo CTL responses that can give rise to CTL populations capable of reacting with selected target cells associated with pathology.
- HLA class II binding peptides are used for evaluation of HLA class II binding peptides.
- HLA class II motif-bearing peptides that are shown to bind are further evaluated for the ability to stimulate HTL responses.
- T cell responses include proliferation assays, lymphokine secretion assays, direct cytotoxicity assays, and limiting dilution assays.
- antigen-presenting cells that have been incubated with a peptide can be assayed for the ability to induce CTL responses in responder cell populations.
- Antigen-presenting cells can be normal cells such as peripheral blood mononuclear cells or dendritic cells.
- mutant, non-human mammalian cell lines that have been transfected with a human class I MHC gene, and that are deficient in their ability to load class I molecules with internally processed peptides, are used to evaluate the capacity of the peptide to induce in vitro primary CTL responses.
- PBMCs Peripheral blood mononuclear cells
- Antigen presenting cells are incubated with peptide, after which the peptide-loaded antigen-presenting cells are then incubated with the responder cell population under optimized culture conditions.
- Positive CTL activation can be determined by assaying the culture for the presence of CTLs that lyse radio-labeled target cells, either specific peptide-pulsed targets or target cells that express endogenously processed antigen from which the specific peptide was derived.
- the presence of epitope-specific CTLs can be determined by IFN ⁇ in situ ELISA.
- a method which allows direct quantification of antigen-specific T cells by staining with fluorescein-labelled HLA tetrameric complexes (Altman, J. D. et al., Proc. Natl. Acad. Sci. USA 90:10330, 1993; Altman, J. D. et al., Science 274:94, 1996).
- Other options include staining for intracellular lymphokines, and interferon release assays or ELISPOT assays. Tetramer staining, intracellular lymphokine staining and ELISPOT assays all appear to be at least 10-fold more sensitive than more conventional assays (Lalvani, A.
- DimerX technology can be used as a means of quantitation (see, e.g., Science 274:94-99 (1996) and Proc. Natl. Acad. Sci. 95:7568-73 (1998)).
- HTL activation may also be assessed using techniques known to those in the art, such as T cell proliferation or lymphokine secretion (see, e.g. Alexander et al., Immunity 1:751-761, 1994).
- HLA transgenic mice can be used to determine immunogenicity of peptide epitopes.
- transgenic mouse strains e.g., mice with human A2.1, A11 (which can additionally be used to analyze HLA-A3 epitopes), and B7 alleles have been characterized.
- Other transgenic mice strains e.g., transgenic mice for HLA-A1 and A24
- HLA-DR1 and HLA-DR3 mouse models have been developed. In accordance with principles in the art, additional transgenic mouse models with other HLA alleles are generated as necessary.
- mice can be immunized with peptides emulsified in Incomplete Freund's Adjuvant; thereafter any resulting T cells can be tested for their capacity to recognize target cells that have been peptide-pulsed or transfected with genes encoding the peptide of interest.
- CTL responses can be analyzed using cytotoxicity assays described above.
- HTL responses can be analyzed using, e.g. T cell proliferation or lymphokine secretion assays.
- Nucleic acids encoding multiple epitopes are a useful embodiment of the invention; discrete peptide epitopes or polyepitopic peptides can be encoded.
- the epitopes to be included in a minigene are preferably selected according to the guidelines set forth in the previous section. Examples of amino acid sequences that can be included in a minigene include: HLA class I epitopes, HLA class II epitopes, a ubiquitination signal sequence, and/or a targeting sequence such as an endoplasmic reticulum (ER) signal sequence to facilitate movement of the resulting peptide into the endoplasmic reticulum.
- ER endoplasmic reticulum
- multi-epitope minigenes are also described in, e.g., co-pending applications U.S. Ser. No. 09/311,784, 09/894,018, 60/419,973, 60/415,463; Ishioka et al., J. Immunol. 162:3915-3925, 1999; An, L. and Whitton, J. L., J. Virol. 71:2292, 1997; Thomson, S. A. et al., J. Immunol. 157:822, 1996; Whitton, J. L. et al., J. Virol. 67:348, 1993; Hanke, R. et al., Vaccine 16:426, 1998.
- a multi-epitope DNA plasmid encoding nine dominant HLA-A*0201- and A11-restricted CTL epitopes derived from the polymerase, envelope, and core proteins of HBV and human immunodeficiency virus (HIV), a PADRE® universal helper T cell (HTL) epitope, and an endoplasmic reticulum-translocating signal sequence has been engineered.
- Immunization of HLA transgenic mice with this plasmid construct resulted in strong CTL induction responses against the nine CTL epitopes tested. This CTL response was similar to that observed with a lipopeptide of known immunogenicity in humans, and significantly greater than immunization using peptides in oil-based adjuvants.
- the amino acid sequences of the epitopes may be reverse translated.
- a human codon usage table can be used to guide the codon choice for each amino acid.
- These epitope-encoding DNA sequences may be directly adjoined, so that when translated, a continuous peptide sequence is created.
- additional elements can be incorporated into the minigene design such as spacer amino acid residues between epitopes.
- HLA presentation of CTL and HTL epitopes may be improved by including synthetic (e.g.
- spacer amino acid residues between one or more CTL and/or HTL epitopes are designed so as to minimize junctional epitopes that may result from the juxtaposition of 2 CTL and/or HTL epitopes.
- the minigene sequence may be converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) may be synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides can be joined, for example, using T4 DNA ligase. This synthetic minigene, encoding the epitope peptide, can then be cloned into a desired expression vector.
- Standard regulatory sequences well known to those of skill in the art are preferably included in the vector to ensure expression in the target cells.
- a promoter with a downstream cloning site for minigene insertion a polyadenylation signal for efficient transcription termination; an E. coli origin of replication; and an E. coli selectable marker (e.g. ampicillin or kanamycin resistance).
- Numerous promoters can be used for this purpose, e.g. the human cytomegalovirus (hCMV) CMV-IE promoter. See, e.g., U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.
- Optimized peptide expression and immunogenicity can be achieved by certain modifications to a minigene construct.
- introns facilitate efficient gene expression, thus one or more synthetic or naturally-occurring introns can be incorporated into the transcribed region of the minigene.
- the inclusion of mRNA stabilization sequences and sequences for replication in mammalian cells may also be considered for increasing minigene expression.
- the minigene is cloned into the polylinker region downstream of the promoter.
- This plasmid is transformed into an appropriate bacterial strain, and DNA is prepared using standard techniques. The orientation and DNA sequence of the minigene, as well as all other elements included in the vector, are confirmed using restriction mapping, PCR and/or DNA sequence analysis. Bacterial cells harboring the correct plasmid can be stored as cell banks.
- immunostimulatory sequences appear to play a role in the immunogenicity of DNA vaccines. These sequences may be included in the vector, outside the minigene coding sequence to enhance immunogenicity.
- a bi-cistronic expression vector which allows production of both the minigene-encoded epitopes and a second protein (e.g., one that modulates immunogenicity) can be used.
- proteins or polypeptides that, if co-expressed with epitopes, can enhance an immune response include cytokines (e.g., IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e.g., LeIF), costimulatory molecules, or pan-DR binding proteins (PADRE®, Epimmune, San Diego, Calif.).
- Helper T cell (HTL) epitopes such as PADRE® molecules can be joined to intracellular targeting signals and expressed separately from expressed CTL epitopes.
- HTL epitopes This can be done in order to direct HTL epitopes to a cell compartment different than that of the CTL epitopes, one that provides for more efficient entry of HTL epitopes into the HLA class II pathway, thereby improving HTL induction.
- immunosuppressive molecules e.g. TGF- ⁇
- TGF- ⁇ immunosuppressive molecules
- Therapeutic quantities of plasmid DNA can be produced for example, by fermentation in E. coli , followed by purification. Aliquots from the working cell bank are used to inoculate growth medium, and are grown to saturation in shaker flasks or a bioreactor according to well known techniques. Plasmid DNA is purified using standard bioseparation technologies such as solid phase anion-exchange resins available, e.g., from QIAGEN, Inc. (Valencia, Calif.). If required, supercoiled DNA can be isolated from the open circular and linear forms using gel electrophoresis or other methods.
- Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). This approach, known as “naked DNA,” is currently being used for intramuscular (IM) administration in clinical trials. To maximize the immunotherapeutic effects of minigene vaccines, alternative methods of formulating purified plasmid DNA may be used. A variety of such methods have been described, and new techniques may become available.
- Cationic lipids, glycolipids, and fusogenic liposomes can also be used in the formulation (see, e.g., WO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682 (1988); U.S. Pat. No. 5,279,833; WO 91/06309; and Felgner, et al., Proc. Nat'l Acad. Sci. USA 84:7413 (1987).
- peptides and compounds referred to collectively as protective, interactive, non-condensing compounds can also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
- the polynucleotide can be complexed to polyvinylpyrrolidone (PVP), to prolong the localized bioavailability of the polynucleotide, thereby enhancing uptake of the polynucleotide by the organism (see e.g., U.S. Pat. No. 6,040,295; EP 0 465 529; WO 98/17814).
- PVP polyvinylpyrrolidone
- PVP is a polyamide that is known to form complexes with a wide variety of substances, and is chemically and physiologically inert.
- Target cell sensitization can be used as a functional assay of the expression and HLA class I presentation of minigene-encoded epitopes.
- the plasmid DNA is introduced into a mammalian cell line that is a suitable target for standard CTL chromium release assays.
- the transfection method used will be dependent on the final formulation, electroporation can be used for “naked” DNA, whereas cationic lipids or DNA:PVP compositions allow direct in vitro transfection.
- a plasmid expressing green fluorescent protein (GFP) can be co-transfected to allow enrichment of transfected cells using fluorescence activated cell sorting (FACS).
- FACS fluorescence activated cell sorting
- the transfected cells are then chromium-51 ( 51 Cr) labeled and used as targets for epitope-specific CTLs. Cytolysis of the target cells, detected by 51 Cr release, indicates both the production and HLA presentation of, minigene-encoded CTL epitopes. Expression of HTL epitopes may be evaluated in an analogous manner using assays to assess HTL activity.
- 51 Cr chromium-51
- In vivo immunogenicity is a second approach for functional testing of minigene DNA formulations.
- Transgenic mice expressing appropriate human HLA proteins are immunized with the DNA product.
- the dose and route of administration are formulation dependent (e.g., IM for DNA in PBS, intraperitoneal (IP) for lipid-complexed DNA).
- IP intraperitoneal
- splenocytes are harvested and restimulated for one week in the presence of peptides encoding each epitope being tested.
- standard assays are conducted to determine if there is cytolysis of peptide-loaded, 51 Cr-labeled target cells.
- lysis of target cells that were exposed to epitopes corresponding to those in the minigene demonstrates DNA vaccine function and induction of CTLs. Immunogenicity of HTL epitopes is evaluated in transgenic mice in an analogous manner.
- the nucleic acids can be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Using this technique, particles comprised solely of DNA are administered. In a further alternative embodiment for ballistic delivery, DNA can be adhered to particles, such as gold particles.
- Vaccines that contain an immunologically effective amount of one or more peptides or polynucleotides of the invention are a further embodiment of the invention.
- the peptides can be delivered by various means or formulations, all collectively referred to as “vaccine” compositions.
- Such vaccine compositions, and/or modes of administration can include, for example, naked DNA, DNA formulated with PVP, DNA in cationic lipid formulations; lipopeptides (e.g., Vitiello, A. et al., J. Clin. Invest.
- DNA or peptides encapsulated e.g., in poly(DL-lactide-co-glycolide) (“PLG”) microspheres (see, e.g., Eldridge, et al., Molec. Immunol. 28:287-294, 1991: Alonso et al., Vaccine 12:299-306, 1994; Jones et al., Vaccine 13:675-681, 1995); peptide compositions contained in immune stimulating complexes (ISCOMS) (see, e.g., Takahashi et al., Nature 344:873-875, 1990; Hu et al., Clin Exp Immunol.
- ISCOMS immune stimulating complexes
- MAPs multiple antigen peptide systems
- MAPs multiple antigen peptide systems
- viral, bacterial, or, fungal delivery vectors Perkus, M. E. et al., In: Concepts in vaccine development, Kaufmann, S. H. E., ed., p. 379, 1996; Chakrabarti, S. et al., Nature 320:535, 1986; Hu, S. L.
- adjuvants e.g., incomplete freund's adjuvant
- adjuvants e.g., incomplete freund's adjuvant
- liposomes Reddy, R. et al., J. Immunol. 148:1585, 1992; Rock, K. L., Immunol. Today 17:131, 1996
- particle-absorbed DNA Ulmer, J. B. et al., Science 259:1745, 1993; Robinson, H. L., Hunt, L. A., and Webster, R.
- Toxin-targeted delivery technologies also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Mass.) or attached to a stress protein, e.g. HSP 96 (Stressgen Biotechnologies Corp., Victoria, BC, Canada) can also be used.
- Vaccines of the invention comprise nucleic acid mediated modalities.
- DNA or RNA encoding one or more of the peptides of the invention can be administered to a patient. This approach is described, for instance, in Wolff et. al., Science 247:1465 (1990) as well as U.S. Pat. Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; and, WO 98/04720.
- DNA-based delivery technologies include “naked DNA”, facilitated ((i.e., non-“naked DNA”) e.g., facilitated by combination with bupivicaine, polymers (e.g., PVP), peptide-mediated) delivery, cationic lipid complexes, and particle-mediated (“gene gun”) or pressure-mediated delivery (see, e.g., U.S. Pat. No. 5,922,687).
- peptide vaccines of the invention can be expressed by viral or bacterial vectors.
- expression vectors include attenuated viral hosts, such as vaccinia or fowlpox.
- vaccinia virus is used as a vector to express nucleotide sequences that encode the peptides of the invention (e.g., MVA).
- the recombinant vaccinia virus Upon introduction into an acutely or chronically infected host or into a non-infected host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits an immune response.
- Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
- Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al., Nature 351:456-460 (1991).
- adeno and adeno-associated virus vectors e.g. alpha virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the like, are apparent to those skilled in the art from the description herein.
- vaccines in accordance with the invention can comprise one or more peptides of the invention.
- a peptide can be present in a vaccine individually; alternatively, the peptide can exist as a homopolymer comprising multiple copies of the same peptide, or as a heteropolymer of various peptides.
- Polymers have the advantage of increased probability for immunological reaction and, where different peptide epitopes are used to make up the polymer, the ability to induce antibodies and/or T cells that react with different antigenic determinants of the antigen targeted for an immune response.
- the composition may be a naturally occurring region of an antigen or can be prepared, e.g., recombinantly or by chemical synthesis.
- Carriers that can be used with vaccines of the invention are well known in the art, and include, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, polyamino acid residues such as poly L -lysine, poly L -glutamic acid, influenza virus proteins, hepatitis B virus core protein, and the like.
- the vaccines can contain a physiologically tolerable diluent such as water, or a saline solution, preferably phosphate buffered saline.
- the vaccines also include an adjuvant.
- Adjuvants such as incomplete Freund's adjuvant, aluminum phosphate, aluminum hydroxide, or alum are examples of materials well known in the art. Additionally, as disclosed herein, CTL responses can be primed by conjugating peptides of the invention to lipids, such as tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine (P 3 CSS).
- P 3 CSS tripalmitoyl-S-glyceryl-cysteinyl-seryl-serine
- a peptide composition in accordance with the invention Upon immunization with a peptide composition in accordance with the invention, via injection (e.g., SC, ID, M), aerosol, oral, transdermal, transmucosal, intrapleural, intrathecal, or other suitable routes, the immune system of the host responds to the vaccine by producing antibodies, CTLs and/or HTLs specific for the desired antigen. Consequently, the host becomes at least partially immune to subsequent exposure to the TAA, or at least partially resistant to further development of TAA-bearing cells and thereby derives a prophylactic or therapeutic benefit.
- injection e.g., SC, ID, M
- aerosol e.g., oral, transdermal, transmucosal, intrapleural, intrathecal, or other suitable routes
- the immune system of the host responds to the vaccine by producing antibodies, CTLs and/or HTLs specific for the desired antigen. Consequently, the host becomes at least partially immune to subsequent exposure to the TAA,
- components that induce T cell responses are combined with components that induce antibody responses to the target antigen of interest.
- a preferred embodiment of such a composition comprises class I and class II epitopes in accordance with the invention.
- a composition comprises a class I and/or class II epitope in accordance with the invention, along with a PADRE® molecule (Epimmune, San Diego, Calif.).
- Vaccines of the invention can comprise antigen presenting cells, such as dendritic cells, as a vehicle to present peptides of the invention.
- dendritic cells are transfected, e.g., with a minigene construct in accordance with the invention, in order to elicit immune responses. Minigenes are discussed in greater detail in a following section.
- Vaccine compositions can be created in vitro, following dendritic cell mobilization and harvesting, whereby loading of dendritic cells occurs in vitro.
- the vaccine compositions of the invention may also be used in combination with antiviral drugs such as interferon- ⁇ , or immune adjuvants such as IL-12, GM-CSF, etc.
- antiviral drugs such as interferon- ⁇ , or immune adjuvants such as IL-12, GM-CSF, etc.
- the following principles are utilized when selecting epitope(s) and/or analogs for inclusion in a vaccine, either peptide-based or nucleic acid-based formulations.
- Exemplary epitopes and analogs that may be utilized in a vaccine to treat or prevent TAA-associated disease are set out in Table 3.
- Each of the following principles can be balanced in order to make the selection.
- the epitopes may be, but need not be, contiguous in sequence in the native antigen from which the epitopes are derived.
- Such multiple epitopes can refer to the order of epitopes within a peptide, or to the selection of epitopes that come from the same region, for use in either individual peptides or in a multi-epitopic peptide.
- Epitopes and/or analogs are selected which, upon administration, mimic immune responses that have been observed to be correlated with prevention or clearance of TAA-expressing tumors.
- this generally includes 3-4 epitopes and/or analogs from at least one TAA.
- Epitopes and/or analogs are selected that have the requisite binding affinity established to be correlated with immunogenicity: for HLA Class I an IC 50 of 500 nM or less, or for Class II an IC 50 of 1000 nM or less.
- HLA Class I it is presently preferred to select a peptide having an IC 50 of 200 nM or less, as this is believed to better correlate not only to induction of an immune response, but to in vitro tumor cell killing as well.
- HLA A1 and A24 it is especially preferred to select a peptide having an IC 50 of 100 nM or less.
- Supermotif bearing-epitopes and/or analogs, or a sufficient array of allele-specific motif-bearing epitopes and/or analogs, are selected to give broad population coverage. In general, it is preferable to have at least 80% population coverage.
- a Monte Carlo analysis a statistical evaluation known in the art, can be employed to assess the breadth of population coverage.
- Nested epitopes occur where at least two epitopes overlap in a given peptide sequence.
- a nested epitope can be a fragment of an antigen from a region that contains multiple epitopes that are overleaping, or one epitope that is completely encompassed by another, e.g., A2 peptides MAGE3.159 and MAGE3.160 are nested.
- a peptide comprising “transcendent nested epitopes” is a peptide that has both HLA class I and HLA class II epitopes in it.
- a sequence that has the greatest number of epitopes per provided sequence Preferably, one avoids providing a peptide that is any longer than the amino terminus of the amino terminal epitope and the carboxyl terminus of the carboxyl terminal epitope in the peptide.
- an objective is to generate the smallest peptide that encompasses the epitopes of interest. This principle is similar, if not the same as that employed when selecting a peptide comprising nested epitopes. However, with an artificial peptide comprising multiple epitopes, the size minimization objective is balanced against the need to integrate any spacer sequences between epitopes in the polyepitopic protein.
- junctional epitopes an epitope recognized by the immune system, not present in the target antigen, and only created by the man-made juxtaposition of epitopes
- Junctional epitopes are generally to be avoided because the recipient may generate an immune response to that non-native epitope. Of particular concern is a junctional epitope that is a “dominant epitope.” A dominant epitope may lead to such a zealous response that immune responses to other epitopes are diminished or suppressed.
- junctional epitopes applies to the sequences surrounding the epitope.
- compositions of the invention at least one component which primes cytotoxic T lymphocytes.
- Lipids have been identified as agents capable of facilitating the priming in vitro-CTL response against viral antigens.
- palmitic acid residues can be attached to the ⁇ - and ⁇ -amino groups of a lysine residue and then linked to an immunogenic peptide.
- One or more linking moieties can be used such as Gly, Gly-Gly-, Ser, Ser-Ser, or the like.
- the lipidated peptide can then be administered directly in a micelle or particle, incorporated into a liposome, or emulsified in an adjuvant, e.g., incomplete Freund's adjuvant.
- a preferred immunogenic composition comprises palmitic acid attached to ⁇ - and ⁇ -amino groups of Lys via a linking moiety, e.g., Ser-Ser, added to the amino terminus of an immunogenic peptide.
- E. coli lipoproteins such as tripalmitoyl-5-glyceryl-cysteinyl-seryl-serine (P 3 CSS) can be used to prime CTL when covalently attached to an appropriate peptide.
- P 3 CSS tripalmitoyl-5-glyceryl-cysteinyl-seryl-serine
- peptides of the invention can be coupled to P 3 CSS, and the lipopeptide administered to an individual to specifically prime a CTL response to the target antigen.
- two such compositions can be combined to elicit both humoral and cell-mediated responses.
- An embodiment of a vaccine composition in accordance with the invention comprises ex vivo administration of a cocktail of epitope-bearing peptides to PBMC, or isolated DC therefrom, from the patient's blood.
- a pharmaceutical to facilitate harvesting of DC can be used, such as ProgenipoietinTM (Monsanto, St. Louis, Mo.) or GM-CSF/IL-4. After pulsing the DC with peptides and prior to reinfusion into patients, the DC are washed to remove unbound peptides.
- a vaccine comprises peptide-pulsed DCs which present the pulsed peptide epitopes in HLA molecules on their surfaces.
- the DC can be pulsed ex vivo with a cocktail of peptides, some of which stimulate CTL responses to one or more antigens of interest, e.g., tumor associated antigens (TAA) such as HER2/neu, p53, MAGE 2, MAGE3, and/or carcinoembryonic antigen (CEA).
- TAA tumor associated antigens
- CEA carcinoembryonic antigen
- TAA helper T cell
- PADRE® helper T cell
- a vaccine in accordance with the invention comprising epitopes from HER2/neu, p53, MAGE 2, MAGE3, and carcinoembryonic antigen (CEA) is used to treat minimal or residual disease in patients with malignancies such as breast, colon, lung or ovarian cancer; any malignancies that bear any of these TAAs can also be treated with the vaccine.
- a TAA vaccine can be used following debulking procedures such as surgery, radiation therapy or chemotherapy, whereupon the vaccine provides the benefit of increasing disease free survival and overall survival in the recipients.
- a vaccine of the invention is a product that treats a majority of patients across a number of different tumor types.
- a vaccine comprising a plurality of epitopes, preferably supermotif-bearing epitopes, offers such an advantage.
- HLA class I and class II binding peptides can be used as reagents to evaluate an immune response.
- the following principles are utilized when selecting an epitope(s) and/or analog(s) for diagnostic, prognostic and similar uses. Potential principles include having the binding affinities described earlier, and/or matching the HLA-motif/supermotif of a peptide with the HLA-type of a patient.
- the evaluated immune response can be induced by any immunogen.
- the immunogen may result in the production of antigen-specific CTLs or HTLs that recognize the peptide epitope(s) employed as the reagent.
- a peptide of the invention may or may not be used as the immunogen.
- Assay systems that can be used for such analyses include tetramer-based protocols (e.g., DimerX technology (see, e.g., Science 274:94-99 (1996) and Proc. Natl. Acad. Sci. 95:7568-73 (1998)), staining for intracellular lymphokines, interferon release assays, or ELISPOT assays.
- a peptide of the invention can be used in a tetramer staining assay to assess peripheral blood mononuclear cells for the presence of any antigen-specific CTLs.
- the HLA-tetrameric complex is used to directly visualize antigen-specific CTLs and thereby determine the frequency of such antigen-specific CTLs in a sample of peripheral blood mononuclear cells (see, e.g., Ogg et al., Science 279:2103-2106, 1998; and Altman et al., Science 174:94-96, 1996).
- a tetramer reagent comprising a peptide of the invention is generated as follows: A peptide that binds to an HLA molecule is refolded in the presence of the corresponding HLA heavy chain and ⁇ 2 -microglobulin to generate a trimolecular complex. The complex is biotinylated at the carboxyl terminal end of the HLA heavy chain, at a site that was previously engineered into the protein. Tetramer formation is then induced by adding streptavidin. When fluorescently labeled streptavidin is used, the tetrameric complex is used to stain antigen-specific cells. The labeled cells are then readily identified, e.g., by flow cytometry. Such procedures are used for diagnostic or prognostic purposes; the cells identified by the procedure can be used for therapeutic purposes.
- Peptides of the invention are also used as reagents to evaluate immune recall responses.
- a PBMC sample from an individual expressing a disease-associated antigen e.g. a tumor-associated antigen such as CEA, p53, MAGE2/3, HER2neu, or an organism associated with neoplasia such as HPV or HSV
- a blood sample containing mononuclear cells may be evaluated by cultivating the PBMCs and stimulating the cells with a peptide of the invention. After an appropriate cultivation period, the expanded cell population may be analyzed, for example, for CTL or for HTL activity.
- the peptides can be used to evaluate the efficacy of a vaccine.
- PBMCs obtained from a patient vaccinated with an immunogen may be analyzed by methods such as those described herein.
- the patient is HLA typed, and peptide epitopes that are bound by the HLA molecule(s) present in that patient are selected for analysis.
- the immunogenicity of the vaccine is indicated by the presence of CTLs and/or HTLs directed to epitopes present in the vaccine.
- the peptides of the invention may also be used to make antibodies, using techniques well known in the art (see, e.g. CURRENT PROTOCOLS IN IMMUNOLOGY , Wiley/Greene, NY; and Antibodies A Laboratory Manual Harlow , Harlow and Lane, Cold Spring Harbor Laboratory Press, 1989). Such antibodies are useful as reagents to determine the presence of disease-associated antigens. Antibodies in this category include those that recognize a peptide when bound by an HLA molecule, i.e., antibodies that bind to a peptide-MHC complex.
- peptides and polynucleotides of the present invention are useful for administration to mammals, particularly humans, to treat and/or prevent disease.
- peptides, polynucleotides, or vaccine compositions (peptide or nucleic acid) of the invention are administered to a patient who has a malignancy associated with expression of one or more TAAs, or to an individual susceptible to, or otherwise at risk for developing TAA-related disease.
- an immune response is elicited against the TAAs, thereby enhancing the patient's own immune response capabilities.
- peptide and/or nucleic acid compositions are administered to a patient in an amount sufficient to elicit an effective immune response to the TAA-expressing cells and to thereby cure, arrest or slow symptoms and/or complications.
- An amount adequate to accomplish this is defined as “therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the particular composition administered, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician.
- a method of treating cancer is provided.
- the treatment of cancer may include the treatment of solid tumors or the treatment of metastasis.
- Metastasis is the form of cancer wherein the transformed or malignant cells are traveling and spreading the cancer from one site to another.
- the cancer can be of the colon, non-small cell lung cancer (“NSCLC”), the breast, the ovary, the kidney, the rectum, head and neck (including but not limited to the nasal and oral cavities), the prostate, the pancreas, small cell lung cancer, the uterus, the bladder, the thyroid, the skin (including, but not limited to, malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Karposi's sarcoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, keloids, psoriasis, and metastatic melanoma), breast, brain, cervical carcinomas, testicular carcinomas, etc.
- NSCLC non-small cell lung cancer
- cancers may include, but are not limited to the following organs or systems: cardiac, lung, gastrointestinal, genitourinary tract, liver, bone, nervous system, gynecological, hematologic, skin, and adrenal glands. More particularly, the methods herein can be used for treating gliomas (Schwannoma, glioblastoma, astrocytoma), neuroblastoma, pheochromocytoma, paraganlioma, meningioma, adrenalcortical carcinoma, kidney cancer, vascular cancer of various types, osteoblastic osteocarcinoma, prostate cancer, ovarian cancer, uterine leiomyomas, salivary gland cancer, choroid plexus carcinoma, mammary cancer, pancreatic cancer, colon cancer, and megakaryoblastic leukemia.
- gliomas Rosta, glioblastoma, astrocytoma
- neuroblastoma pheochromocytoma
- the cancer to be treated by the present invention is colorectal cancer, non-small cell lung cancer (“NSCLC”), breast cancer, ovarian cancer, renal cancer, prostate cancer, cervical cancer, head and/or neck cancer, endometrial cancer, pancreatic cancer, and/or esophageal cancer.
- NSCLC non-small cell lung cancer
- the cancer to be treated by the present invention is colorectal cancer, non-small cell lung cancer (“NSCLC”), breast cancer, and/or ovarian cancer.
- the cancer is a cancer of the head and/or neck.
- the present invention may also be used to treat diseases associated with increased cell survival, or the inhibition of apoptosis, including cancers (such as follicular lymphomas, carcinomas with p53 mutations, and hormone-dependent tumors, including, but not limited to colon cancer, cardiac tumors, pancreatic cancer, melanoma, retinoblastoma, glioblastoma, lung cancer, intestinal cancer, testicular cancer, stomach cancer, neuroblastoma, myxoma, myoma, lymphoma, endothelioma, osteoblastoma, osteoclastoma, osteosarcoma, chondrosarcoma, adenoma, breast cancer, prostate cancer, Kaposi's sarcoma and ovarian cancer); autoimmune disorders (such as, multiple sclerosis, Sjogren's syndrome, Hashimoto's thyroiditis, biliary cirrhosis, Behcet's disease, Crohn's disease, polymyo
- cancers
- the invention is used to treat additional diseases or conditions associated with increased cell survival including, but not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, lipo
- the vaccine compositions of the invention can be used purely as prophylactic agents.
- the dosage for an initial prophylactic immunization generally occurs in a unit dosage range where the lower value is about 1, 5, 50, 500, or 1000 ⁇ g of peptide and the higher value is about 10,000; 20,000; 30,000; or 50,000 ⁇ g of peptide.
- Dosage values for a human typically range from about 500 ⁇ g to about 50,000 ⁇ g of peptide per 70 kilogram patient. This is followed by boosting dosages of between about 1.0 ⁇ g to about 50,000 ⁇ g of peptide, administered at defined intervals from about four weeks to six months after the initial administration of vaccine.
- the immunogenicity of the vaccine may be assessed by measuring the specific activity of CTL and HTL obtained from a sample of the patient's blood.
- peptides comprising CTL and/or HTL epitopes of the invention induce immune responses when presented by HLA molecules and contacted with a CTL or HTL specific for an epitope comprised by the peptide.
- the manner in which the peptide is contacted with the CTL or HTL is not critical to the invention.
- the peptide can be contacted with the CTL or HTL either in vitro or in vivo.
- peptide can be administered directly, or in other forms/vehicles, e.g., DNA vectors encoding one or more peptides, viral vectors encoding the peptide(s), liposomes, antigen presenting cells such as dendritic cells, and the like.
- compositions of the invention in the form of peptides or polypeptides can be administered directly.
- the peptide/polypeptides can be administered indirectly presented on APCs, or as DNA encoding them.
- the peptides or DNA encoding them can be administered individually or as fusions of one or more peptide sequences.
- administration should generally begin at the first diagnosis of TAA-related disease. This is followed by boosting doses at least until symptoms are substantially abated and for a period thereafter. In chronic disease states, loading doses followed by boosting doses may be required.
- the dosage for an initial therapeutic immunization generally occurs in a unit dosage range where the lower value is about 1, 5, 50, 500, or 1,000 ⁇ g of peptide and the higher value is about 10,000; 20,000; 30,000; or 50,000 ⁇ g of peptide.
- Dosage values for a human typically range from about 500 ⁇ g to about 50,000 ⁇ g of peptide per 70 kilogram patient.
- Boosting dosages of between about 1.0 ⁇ g to about 50,000 ⁇ g of peptide, administered pursuant to a boosting regimen over weeks to months, can be administered depending upon the patient's response and condition. Patient response can be determined by measuring the specific activity of CTL and HTL obtained from the patient's blood.
- peptides and compositions of the present invention are used in serious disease states. In such cases, as a result of the minimal amounts of extraneous substances and the relative nontoxic nature of the peptides, it is possible and may be desirable to administer substantial excesses of these peptide compositions relative to these stated dosage amounts.
- a representative dose is in the range disclosed above, namely where the lower value is about 1, 5, 50, 500, or 1,000 ⁇ g of peptide and the higher value is about 10,000; 20,000; 30,000; or 50,000 ⁇ g of peptide, preferably from about 500 ⁇ g to about 50,000 ⁇ g of peptide per 70 kilogram patient.
- administration should continue until at least clinical symptoms or laboratory tests indicate that the disease has been eliminated or substantially abated, and for a follow-up period thereafter.
- the dosages, routes of administration, and dose schedules are adjusted in accordance with methodologies known in the art.
- compositions for therapeutic treatment are intended for parenteral, topical, oral, intrathecal, or local administration.
- the pharmaceutical compositions are administered parentally, e.g. intravenously, subcutaneously, intradermally, or intramuscularly.
- compositions for parenteral administration which comprise a solution of the immunogenic peptides dissolved or suspended in an acceptable carrier, preferably an aqueous carrier.
- an acceptable carrier preferably an aqueous carrier.
- aqueous carriers may be used, e.g., water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like.
- These compositions may be sterilized by conventional, well known sterilization techniques, or may be sterile filtered.
- the resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
- compositions may contain pharmaceutically acceptable auxiliary substances or pharmaceutical excipients as may be required to approximate physiological conditions, such as pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservatives, and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
- pharmaceutically acceptable auxiliary substances or pharmaceutical excipients as may be required to approximate physiological conditions, such as pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservatives, and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
- concentration of peptides of the invention in the pharmaceutical formulations can vary widely, i.e., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected primarily by fluid volumes, viscosities, etc., in accordance with the particular mode of administration selected.
- a human unit dose form of the peptide composition is typically included in a pharmaceutical composition that also comprises a human unit dose of an acceptable carrier, preferably an aqueous carrier, and is administered in a volume of fluid that is known by those of skill in the art to be used for administration of such compositions to humans (see, e.g., Remington's Pharmaceutical Sciences, 17 th Edition, A. Gennaro, Editor, Mack Publishing Co., Easton, Pa., 1985).
- the peptides of the invention can also be administered via liposomes, which serve to target the peptides to a particular tissue, such as lymphoid tissue, or to target selectively to infected cells, as well as to increase the half-life of the peptide composition.
- Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like.
- the peptide to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to a receptor prevalent among lymphoid cells (such as monoclonal antibodies which bind to the CD45 antigen) or with other therapeutic or immunogenic compositions.
- liposomes either filled or decorated with a desired peptide of the invention can be directed to the site of lymphoid cells, where the liposomes then deliver the peptide compositions.
- Liposomes for use in accordance with the invention are formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid liability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka, et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), and U.S. Pat. Nos. 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
- a ligand can be incorporated into the liposome, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells.
- a liposome suspension containing a peptide may be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.
- nontoxic solid carriers include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like.
- a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, one or more peptides of the invention, often at a concentration of 25%-75%.
- the immunogenic peptides are preferably supplied in finely divided form, along with a surfactant and propellant. Typical percentages of peptides are 0.01%-20% by weight, often 1%-10%.
- the surfactant must, of course, be pharmaceutically acceptable, and preferably soluble in the propellant.
- Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride.
- the surfactant may constitute 0.1%-20% by weight of the composition, preferably 0.25-5%.
- the balance of the composition is ordinarily propellant, although an atomizer may be used in which no propellant is necessary and other percentages are adjusted accordingly.
- a carrier can also be included, e.g. lecithin for intranasal delivery.
- Antigenic peptides of the invention have been used to elicit a CTL and/or HTL response ex vivo, as well.
- the resulting CTLs or HTLs can be used to treat chronic infections, or tumors in patients that do not respond to other conventional forms of therapy, or who do not respond to a therapeutic peptide or nucleic acid vaccine in accordance with the invention.
- Ex vivo CTL or HTL responses to a particular antigen are induced by incubating in tissue culture the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of antigen-presenting cells (APC), such as dendritic cells, and the appropriate immunogenic peptide.
- APC antigen-presenting cells
- the cells After an appropriate incubation time (typically about 7-28 days), in which the precursor cells are activated and expanded into effector cells, the cells are infused back into the patient, where they will destroy (CTL) or facilitate destruction (HTL) of their specific target cell (an infected cell or a tumor cell).
- CTL destroy
- HTL facilitate destruction
- kits can be provided in kit form together with instructions for vaccine administration.
- the kit would include desired composition(s) of the invention in a container, preferably in unit dosage form and instructions for administration.
- a kit would include an APC, such as a dendritic cell, previously exposed to and now presenting peptides of the invention in a container, preferably in unit dosage form together with instructions for administration.
- An alternative kit would include a minigene construct with desired nucleic acids of the invention in a container, preferably in unit dosage form together with instructions for administration. Lymphokines such as IL-2 or IL-12 may also be included in the kit.
- kit components that may also be desirable include, for example, a sterile syringe, booster dosages, and other desired excipients.
- Peptides were evaluated based upon MHC binding motifs, on the capacity to bind MHC molecules, and the ability to activate tumor-reactive CTL in vitro using lymphocyte cultures from normal individuals. This approach has several advantages. First, it does not require the isolation of patient-derived cells such as CTL or tumor cells. Secondly, the identification of epitopes that stimulate CTL in normal individuals permits the identification of a broad range of epitopes, including subdominant as well as dominant epitopes.
- a vaccine comprises epitopes (as one or more peptides or as nucleic acids encoding them) from among these four, or any other, TAAs. Accordingly, this vaccine induces CTL responses against several major cancer types.
- Carcinoembryonic antigen is a 180 kD mw cell surface and secreted glycoprotein overexpressed on most human adenocarcinomas. These include colon, rectal, pancreatic and gastric (Muraro, 1985) as well as 50% of breast (Steward, 1974) and 70% of non-small cell lung carcinomas (Vincent, 1978). This antigen is also expressed on normal epithelium and in some fetal tissue (Thompson, 1991).
- the HER2/neu antigen (185 kDa) is a transmembrane glycoprotein with tyrosine kinase activity whose structure is similar to the epidermal growth factor receptor (Coussens, 1985; Bargmann, 1986; Yamamoto, 1986).
- Amplification of the HER2/neu gene and/or overexpression of the associated protein have been reported in many human adenocarcinomas of the breast (Slamon, 1987 and 1989; Borg, 1990), ovary (Slamon, 1989), uterus (Berchuck, 1991; Lukes, 1994), prostate (Kuhn, 1993; Sadasivan, 1993), stomach (Yonemura, 1991; Kameda, 1990; Houldsworth, 1990), esophagus (Houldsworth, 1990), pancreas (Yamanaka, 1993), kidney (Weidner, 1990) and lung (Kern, 1990; Rachwal, 1995).
- the MAGE, melanoma antigen genes are a family of related proteins that were first described in 1991. Van der Bruggen and co-workers were able to identify the MAGE gene after isolating CTLs from a patient who demonstrated spontaneous tumor regression. These CTLs recognized melanoma cell lines as well as tumor lines from other patients all expressing the same HLA-A1 restricted gene (van der Bruggen, 1991; De Plaen, 1994).
- the MAGE genes are expressed in metastatic melanomas (Brasseur, 1995), non-small lung (Weynants, 1994), gastric (Inoue, 1995), hepatocellular (Chen, 1999), renal (Yamanaka, 1998) colorectal (Mori, 1996), and esophageal (Quillien, 1997) carcinomas as wells as tumors of the head and neck (Lee, 1996), ovaries (Gillespie, 1998; Yamada, 1995), bladder (Chaux, 1998) and bone (Sudo, 1997). They are also expressed on normal tissue, specifically placenta and male germ cells (De Plaen, 1994). However, these normal cells do not express MHC Class I molecules and therefore do not present MAGE peptides on their surface.
- MAGE-2 and MAGE-3 were considered a single TAA, based on the expression patterns and predicted primary amino acid sequences of the two genes. These two members of the MAGE family appear to be coordinately regulated (Zakut, 1993), resulting in a distribution in cancers that appears to be very similar, if not identical. Therefore, immune responses directed at either antigen should provide coverage for treatment of the cancers expected to express these TAA.
- the MAGE-2 and MAGE-3 proteins are 84% identical at the primary amino acid level. As a result, some epitopes are identical in the two antigens, while others are unique to one or the other.
- MAGE-2 MAGE-2a subtype
- C. Dahlberg personal communication, NB 1056, p. 16; Van der Bruggen, 1991; Zakut, 1993 MAGE-2a subtype
- the fourth TAA selected for use in the vaccine is p53.
- the p53 gene induces a cell cycle arrest which allows DNA to be checked for irregularities and maintains DNA integrity (Kuerbitz, 1992). Mutations in the gene abolish its suppressor function and allow escape of transformed cells from the restriction of controlled growth. At the same time, these mutations lead to overexpression of both wildtype and mutated p53 (Levine, 1991) making it more likely that epitopes within the protein may be recognized by the immune system.
- Table 5 below delineates the tumor antigen expression in breast, colon and lung.
- Table 6 shows the incidence, 5-year survival rates, and the estimated number of deaths per year for these tumors in the U.S. for each type of cancer in Table 5. In terms of estimated new cases, estimated deaths and 5 year survival rates each of these tumor types has a large unmet need. Globally, the incidence of these tumors is significantly greater.
- PADRE® Molecule as a Helper Epitope for Enhancement of CTL Induction
- a preferred embodiment of a vaccine includes a molecule from the PADRE® family of universal T helper cell epitopes (HTL) that target most DR molecules in a manner designed to stimulate helper T cells.
- HTL universal T helper cell epitopes
- PADRE® molecules are the peptides, aKFVAAWTLKAAa, aKYVAAWTLKAAa, aKFVAAYTLKAAa, aKXVAAYTLKAAa, aKYVAAYTLKAAa, aKFVAAHTLKAAa, aKXVAAHTLKAAa, aKYVAAHTLKAAa, aKFVAANTLKAAa, aKXVAANTLKAAa, aKYVAANTLKAAa, AKXVAAWTLKAAA (SEQ ID NO:30), AKFVAAWTLKAAA (SEQ ID NO:31), AKYVAAWTLKAAA (SEQ ID NO:32), AKFVAAYTLKAAA (SEQ ID NO:33), AKXVAAYTLKAAA (SEQ ID NO:34), AKYVAAYTLKAAA (SEQ ID NO:35), AKFVAAHTLKAAA (SEQ ID NO:36), AKXVAAHTLKAAA (SEQ ID
- the PADRE® peptide is amidated.
- a particularly preferred amidated embodiment of a PADRE® molecule is conventionally written aKXVAAWTLKAAa-NH 2 .
- PADRE® peptide component(s) of the vaccine bind with broad specificity to multiple allelic forms of HLA-DR molecules. Moreover, PADRE® peptide component(s) bind with high affinity (IC 50 ⁇ 1000 nM), i.e., at a level of affinity correlated with being immunogenic for HLA Class II restricted T cells. The in vivo administration of PADRE® peptide(s) stimulates the proliferation of HTL in normal humans as well as patient populations.
- One or more PADRE® peptide(s) may be included in a composition, e.g., a vaccine, comprising one or more peptides, either as an individual peptide(s), fused to one or more CTL peptides (epitope and/or analog), or both.
- a composition e.g., a vaccine, comprising one or more peptides, either as an individual peptide(s), fused to one or more CTL peptides (epitope and/or analog), or both.
- a vaccine in accordance with the invention comprises epitope-bearing peptides of the invention delivered via dendritic cells (DC). Accordingly, DC were evaluated in both in vitro and in vivo immune function assays. These assays include the stimulation of CTL hybridomas and CTL cell lines, and the in vivo activation of CTL.
- DC dendritic cells
- ProGP-mobilized DC were purified from peripheral blood (PB) and spleens of ProGP-treated C57B1/6 mice to evaluate their ability to present antigen and to elicit cellular immune responses.
- DC peripheral blood
- spleens were purified from total WBC and spleen using a positive selection strategy employing magnetic beads coated with a CD11c specific antibody (Miltenyi Biotec, Auburn Calif.).
- ex vivo expanded DC were generated by culturing bone marrow cells from untreated C57B1/6 mice with the standard cocktail of GM-CSF and IL-4 (R&D Systems, Minneapolis, Minn.) for a period of 7-8 days (Mayordomo et al., Nature Med. 1:1297-1302 (1995)). Recent studies have revealed that this ex vivo expanded DC population contains effective antigen presenting cells, with the capacity to stimulate anti-tumor immune responses (Celluzzi et al., J. Exp. Med. 83:283-287 (1996)).
- ProGP generated DC to stimulate a CTL cell line was demonstrated in vitro using a viral-derived epitope and a corresponding epitope responsive CTL cell line.
- Transgenic mice expressing human HLA-A2.1 were treated with ProGP.
- Splenic DC isolated from these mice were pulsed with a peptide epitope derived from hepatitis B virus (HBV Pol 455) and then incubated with a CTL cell line that responds to the HBV Pol 455 epitope/HLA-A2.1 complex by producing IFN ⁇ .
- HBV Pol 455 a peptide epitope derived from hepatitis B virus
- ProGP-derived splenic DC The capacity of ProGP-derived splenic DC to present the HBV Pol 455 epitope was greater than that of two positive control populations: GM-CSF and IL-4 expanded DC cultures, or purified splenic B cells ( FIG. 3B ).
- the left shift in the response curve for ProGP-derived spleen cells versus the other antigen presenting cells reveal that these ProGP-derived cells require less epitope to stimulate maximal IFN ⁇ release by the responder cell line.
- ex vivo peptide-pulsed DC to stimulate CTL responses in vivo was also evaluated using the HLA-A2.1 transgenic mouse model.
- DC derived from ProGP-treated animals or control DC derived from bone marrow cells after expansion with GM-CSF and IL-4 were pulsed ex vivo with the HBV Pol 455 CTL epitope, washed and injected (IV) into such mice.
- spleens were removed and splenocytes containing DC and CTL were restimulated twice in vitro in the presence of the HBV Pol 455 peptide.
- the CTL activity of three independent cultures of restimulated spleen cell cultures was assessed by measuring the ability of the CTL to lyse 51 Cr-labeled target cells pulsed with or without peptide. Vigorous CTL responses were generated in animals immunized with the epitope-pulsed ProGP derived DC as well as epitope-pulsed GM-CSF/IL-4 DC ( FIG. 4 ). In contrast, animals that were immunized with mock-pulsed ProGP-generated DC (no peptide) exhibited no evidence of CTL induction. These data confirm that DC derived from ProGP treated mice can be pulsed ex vivo with epitope and used to induce specific CTL responses in vivo. Thus, these data support the principle that ProGP-derived DC promote CTL responses in a model that manifests human MHC Class I molecules.
- a presently preferred procedure for vaccination is set forth herein.
- patients are treated with ProGP to expand and mobilize DC into the circulation.
- proGP to expand and mobilize DC into the circulation.
- patients undergo leukapheresis (approximately 15 L process, possibly repeated once if required to collect sufficient mononuclear cells).
- leukapheresis approximately 15 L process, possibly repeated once if required to collect sufficient mononuclear cells.
- the mononuclear cell product is admixed with peptides of the invention by injection through micropore filters (this admixing protocol is not needed if sterile peptides are used).
- the cell product vaccine embodiment is resuspended in cryopreservative solution (final 10% DMSO) and, for those protocols involving multiple vaccination boosts, divided into aliquots.
- cryopreservative solution final 10% DMSO
- the pulsed mononuclear cell product(s) are frozen and stored according to accepted procedures for hematopoietic stem cells.
- FIG. 5 provides a flow chart of ex vivo pulsing of DC with peptides, washing of DC, DC testing, and cryopreservation. A more detailed description of the process is provided in the following Examples.
- Patients are treated with ProGP daily by subcutaneous injection (dose and schedule determined in accordance with standard medical procedures). On the evening before leukapheresis, patients are assessed by an apheresis physician or nurse/technologist for adequacy of intravenous access for large-bore apheresis catheters. If peripheral venous access is deemed inadequate to maintain rapid blood flow for apheresis, then central venous catheters (inguinal, subclavian or internal jugular sites) can be inserted by appropriate medical/surgical personnel.
- leukapheresis On the day of predicted peak DC mobilization, leukapheresis (approximately 3 blood volumes or 15 L) is performed, for example, on a Cobe Spectra or Fenwal CS3000 (flow rate ⁇ 35 mL/min) to obtain mononuclear cells.
- the number of DC in the leukapheresis product is estimated by flow cytometric counting of mononuclear cells possessing the immunophenotypes lin ⁇ /HLA-DR+/CD11c+ and lin ⁇ /HLA-DR+/CD123+ in a 1 mL sample aseptically withdrawn from the apheresis product.
- CBC/differential The numbers of granulocytes and lymphocytes in the leukapheresis product are counted by automated cytometry (CBC/differential). CBC/differential is performed immediately after the leukapheresis procedure and every other day for ten days to monitor resolution of the hematologic effects of the hematopoietin treatment and apheresis.
- Plasma is removed from the leukapheresis product by centrifugation and expression of supernatant.
- the cells from the centrifugation pellet are resuspended in OptiMEM medium with 1% Human Serum Albumin (HSA) at a cell density of 10 7 .
- HSA Human Serum Albumin
- the peptide(s) of the invention are administered directly into the DC culture bag through an injection port, using aseptic technique. After mixing, e.g., by repeated squeezing and inversion, the cell suspension is incubated for four hours at ambient temperature. Cryopreservative solution is prepared by dissolving 50 mL pharmaceutical grade dimethylsulfoxide (DMSO) in 200 mL Plasmalyte®. After the pulsing period, the cell suspension is washed by centrifugation and resuspension in an equal volume of phosphate buffered saline solution. The washing procedure is repeated a defined number of times, e.g., until studies validate that peptides have been removed.
- DMSO dimethylsulfoxide
- cryopreservative solution final 10% DMSO
- the cell suspension in cryopreservative is then divided into six equal aliquots, transferred to 50 ml freezing bags (Fenwal) and frozen at controlled rate of 1° C./min for storage in liquid nitrogen until needed for vaccination procedure.
- Antigen presenting cells long-term stimulated T cells corresponding to peptides of the invention, or T cell hybridomas, are used to determine the optimal procedure for incubating the peptide reagents of a vaccine with human cells.
- Pulsing studies are done using one or more of the following cell sources: purified DC from ProGP treated LA-A2.1 transgenic mice; human tumor cell lines that express HLA-A2; peripheral blood mononuclear cells from normal human volunteers; peripheral blood mononuclear cells from ProGP treated patients; and/or DC obtained from normal human HLA-A2 volunteers following the ex vivo culture of their peripheral blood mononuclear cells with GM-CSF and IL-4.
- Evaluated conditions include, e.g.:
- a vaccine of the invention Following pulsing with the peptide reagents, DC from the patient are washed several times to remove excess peptides prior to infusing the cells back into the patient. In this embodiment of a vaccine of the invention, the washing procedure removes unbound peptides. Accordingly, there is no, or negligible, systemic exposure of the patient to the peptides.
- Alternative vaccines of the invention involve direct administration of peptides of the invention to a patient, administration of a multiepitopic polypeptide comprising one or more peptides of the invention, administration of the peptides in a form of nucleic acids which encode them, e.g. by use of minigene constructs, or by viral vectors.
- the cells are washed with multiple volumes of wash buffer. An aliquot of the last wash is placed onto a nonpolar solid-phase extraction cartridge and washed to reduce the salt content of the sample. Any peptides contained in the buffer will be eluted from the extraction cartridge and evaporated to dryness.
- the sample is then reconstituted in High Performance Liquid Chromatography (HPLC) mobile phase, injected onto a polymer based reverse-phase HPLC column, and eluted using reverse-phase gradient elution chromatography. Residual peptides are detected using a mass spectrometer set-up to monitor the protonated molecular ions of each peptide as they elute from the HPLC column. The peptides are quantified by comparing the area response ratio of analyte and internal standard to that obtained for standards in a calibration curve.
- peptide reagents may be formulated using 0.1% trifluoroacetic acid (TFA).
- TFA trifluoroacetic acid
- the number of DC in the leukapheresis product is estimated by flow cytometric counting of mononuclear cells possessing the immunophenotypes lin ⁇ /HLA-DR + /CD11c + and lin ⁇ /HLA-DR + /CD123 + in a 1 ml sample aseptically withdrawn from the apheresis product.
- Lin ⁇ cells excludes monocytes, T-lymphocytes, B-lymphocytes, and granulocytes, by using a cocktail of antibodies to lineage markers CD3, CD14, DC16, CD19, CD20, CD56.
- Viability of mononuclear cells is assessed after pulsing and washing, prior to suspension in cryopreservative, by trypan blue dye exclusion. In general, if the cell product contains more than 50% trypan blue-positive cells, the product is not administered to a patient.
- the cell suspension in cryopreservative is examined for microbial contamination by gram stain and routine clinical bacterial and fungal culture/sensitivity. If tests are positive for bacterial or fungal contamination, implicit evidence of significant contamination, the product is not infused. If, e.g. a gram stain is negative, the product may be infused for the first vaccination while awaiting results of culture/sensitivity. Antibiotic therapy based on culture results is instituted at the discretion of the treating physician if the patient shows appropriate signs of infection that could be clinically attributable to the infused contaminant.
- an aliquot of frozen pulsed dendritic cell product is removed from a liquid nitrogen freezer and kept frozen in an insulated vessel containing liquid nitrogen during transport to the infusion site.
- the product is thawed by immersion with gentle agitation in a water bath at 37° C.
- the cell suspension is infused through intravenous line by gravity or by syringe pump.
- the vaccine is administered by injection, e.g., subcutaneously, intradermally, or intramuscularly.
- the patient's vital signs are monitored before infusion/injection and at 5 minute intervals during an infusion, then at 15 minute intervals for 1 hour after infusion/injection.
- CTL epitopes derived from well-characterized tumor antigens were selected for the current vaccine using a 3-step process: 1) computer motif analysis of the primary protein sequence to identify motif-containing peptides that will thus have a high likelihood of binding HLA-A2 supertype molecules; 2) direct measurement of MHC binding affinity of the motif-containing peptides to A2 supertype alleles; and 3) immunogenicity testing of high-affinity MHC-binding peptides for CTL induction.
- modified epitope analogs were designed to provide enhanced immunogenicity. Analogs were generated by substituting key amino acid residues that enhance either MHC binding affinity or T Cell Receptor (TCR) interaction.
- the final vaccine product is a pool of the nine tumor-associated CTL epitopes (natural and analog sequences) and a PADRE® universal epitope, administered to cancer patients as an emulsion in Montanide® ISA 51 adjuvant.
- the vaccine is similar to synthetic peptide vaccines (containing one or more peptides) that have been tested by other investigators in cancer patients where CTL induction, positive clinical responses, and vaccine safety have been described (Cormier, J. N., et al., Cancer J Sci. Am. 3:37-44 (1997); Salgaller, M. L., et al., Cancer Res. 56:4749-4757 (1996); Wang, F., et al., Clin. Cancer Res.
- EP-2101 epitopes are immunogenic, using peripheral blood mononuclear cells (PBMC) from HLA-A2.1 positive subjects and an in vitro primary induction assay, in inducing CTLs that respond to the peptide and to tumor cell lines that express the TAA and present the wild-type epitope (Keogh, E., et al., J Immunol. 167:787-796 (2001); Kawashima, I., et al., Hum.
- PBMC peripheral blood mononuclear cells
- the assay is an in vitro primary CTL induction system where CD8 + PBMC from normal subjects are stimulated in vitro, initially with peptide-loaded dendritic cells (DCs) (adherent PBMC expanded in GM-CSF and IL-4), followed by two weekly cycles of restimulation with peptide (Keogh, E., et al., J Immunol. 167:787-796 (2001); Kawashima, I., et al., Hum. Immunol. 59:1-14 (1998)).
- DCs peptide-loaded dendritic cells
- CTL activity is determined in the presence of HLA-A2.1 positive target cells and wild-type peptide, using cytotoxicity ( 51 Cr-release assay) or interferon-gamma (IFN- ⁇ ) production (ELISA) as the read-out.
- Immunogenic peptides that induced CTL were further tested for responses against the naturally processed epitope expressed on tumor cell lines. Epitopes that induced tumor-reactive CTL were considered as vaccine candidates.
- tumor-associated peptides with low MHC binding activity were modified to enhance their binding by substituting suboptimal MHC-interacting anchor residues with optimal, motif-associated residues Kawashima, I., et al., Hum. Immunol. 59:1-14 (1998); Parkhurst, M. R., et al., J Immunol. 157:2539-2548 (1996)).
- This strategy of “fixing” anchor residues has been described for a number of tumor and infectious disease epitopes and these analogs have demonstrated enhanced in vivo immunogenicity compared to the wild-type epitope (Kawashima, I., et al., Hum. Immunol.
- the T cell response stimulated by heteroclitic analogs compared to the wild-type epitope is manifested both as an increase in the response magnitude as well as an enhancement in TCR avidity (Zugel, U., R. et al., J Immunol. 161:1705-1709 (1998); Rivoltini, L., P., et al., Cancer Res. 59:301-306 (1999); Slansky, J. E., et al., Immunity. 13:529-538 (2000); Tangri, S., et al., J Exp. Med. 194:833-846 (2001)), with the latter thought to be a potential mechanism for heteroclicity (Slansky, J. E., et al., Immunity. 13:529-538 (2000)).
- Heteroclitic analogs are potentially important in cancer vaccines not only for their ability to induce strong T cell responses, but also for their ability to break T cell tolerance. These properties have been demonstrated in animal as well as human trials (Zugel, U., R. et al., J Immunol. 161:1705-1709 (1998); Slansky, J. E., et al., Immunity. 13:529-538 (2000); Fong, L., et al., Proc. Natl. Acad. Sci. U.S.A. 98:8809-8814 (2001)).
- epitopes were selected for the vaccine product. These epitopes, shown in Tables 3 and 7, were chosen on the basis of demonstrating 1) broad tumor antigen coverage with a mix of CTL native sequence epitopes, fixed-anchor analogs and heteroclitic analogs; 2) high cross-reactive binding affinity for HLA-A2 supertype alleles; 3) immunogenicity in the in vitro human primary CTL induction assay, particularly in generating CTL that respond to wild-type, epitope-expressing tumor cells; and, 4) wherever available, published reports in the literature showing primary or post-vaccination CTL responses in normal subjects or cancer patients.
- two epitopes are represented from each of three TAAs (HER-2/neu, p53, and MAGE-2/3) and three epitopes from CEA, a more widely expressed TAA on lung- and colon-associated tumors.
- TAAs HER-2/neu, p53, and MAGE-2/3
- CEA a more widely expressed TAA on lung- and colon-associated tumors.
- the extent of cross-reactive binding against multiple HLA-A2 supertype alleles should enable the vaccine to cover a broad and non-ethnically biased population among individuals expressing HLA-A2 supertype alleles.
- fixed-anchor analogs that were modified for improved MHC binding.
- One fixed-anchor analog was derived from the well-characterized HER-2/neu.369 epitope, which has been shown to induce strong recall and post-vaccination CTL responses in cancer patients (Zaks, T. Z. and Rosenberg, S. A., Cancer Res. 58:4902-4908 (1998); Knutson, K. L., et al., J Clin. Invest 107:477-484 (2001)).
- the V2V9 analog of HER-2/neu.369 is expected to demonstrate even broader immunogenicity in HLA-A2 supertype individuals.
- the remaining fixed-anchor analogs (CEA.24V9, p53.139L2B3, and p53.149M2) were designed from epitopes identified in the selection process and they have not been tested previously in the clinic.
- the p53.139L2B3 analog contains an additional ⁇ -aminoisobutyric acid substitution at position 3 (a non-anchor position) to circumvent potential stability issues with the cysteine residue found in the wild-type epitope.
- all of the fixed-anchor analogs induce CTL, that cross-react with the wild-type epitope presented by tumor cell lines (Table 7) (Keogh, E., et al., J Immunol. 167:787-796 (2001)).
- Another class of analogs represented in the current vaccine are those with heteroclitic activity resulting from substitution of TCR contact residues (Zaremba, S., et al., Cancer Res. 57:4570-4577 (1997); Zugel, U., R. et al., J Immunol. 161:1705-1709 (1998); Rivoltini, L., P., et al., Cancer Res. 59:301-306 (1999); Slansly, J. E., et al., Immunity. 13:529-538 (2000)).
- the immunogenicity of the vaccine epitopes has been corroborated, particularly in human systems, by additional reports.
- the HER-2/neu.369 and p53.149 epitopes wild-type versions of analogs used in EP-2101
- HER-2/neu.689 have induced specific CTL responses using PBMC obtained from healthy donors through primary in vitro induction (zum Buschenfelde, C. M., et al., J Immunol. 165:4133-4140 (2000); Chikamatsu, K., et al., Clin. Cancer Res. 5:1281-1288 (1999)) as well as recall responses using PBMC from cancer patients (Knutson, K. L., et al., J Clin.
- the final epitope included in the vaccine is a universal PADRE® epitope (Alexander, J., et al., Immunity. 1:751-761 (1994)).
- the PADRE® epitope was designed to bind in a cross-reactive manner to the majority of the DR supertype alleles (Alexander, J., et al., Immunity. 1:751-761 (1994)) such that >90% of the general population is predicted to respond against this epitope.
- the PADRE® epitope is included to enhance CTL induction by the pool of CTL epitopes.
- a number of published studies have demonstrated the ability of HTL responses to augment and support the maintenance of CTL responses in vivo (Knutson, K.
- CTL epitopes representing a combination of fixed anchor native sequences and heteroclitic analogs, and one PADRE® universal HTL epitope, have been selected for inclusion of EP-2101.
- This set of epitopes constitutes a unique combination of vaccine constituents intended to provide broad antigen and population coverage among HLA-A2 individuals.
- the CTL epitopes selected for the current vaccine are capable of inducing CTL from na ⁇ ve precursors in PBMC from normal subjects and in cancer patients. This observation strongly suggests the absence of complete tolerance against these tumor-associated epitopes and supports their utility for inducing beneficial CTL responses in cancer patients.
- HLA-A2.1/K b transgenic mice which express the human HLA-A2.1 molecule (see also Examples 15-17). These mice have been used to assess the immunogenicity of HLA-A2.1-restricted epitopes following in vivo immunization (Wentworth, P. A., et al., Eur. J Immunol. 26:97-101 (1996); Vitiello, A., et al., J Exp. Med. 173:1007-1015 (1991)) and while useful for in vivo evaluation, they have several limitations.
- HLA transgenic mice will respond to approximately 80% of the HLA-A2.1-restricted epitopes to which humans respond Wentworth, P. A., et al., Eur. J Immunol. 26:97-101 (1996); Wentworth, P. A., et al., Int Immunol. 8:651-659 (1996)).
- the magnitude of the response detected for a given epitope can vary widely from experiment-to-experiment, especially for responses that are lower in magnitude.
- the relative magnitude of the response detected in HLA transgenic mice will not necessarily indicate the relative magnitude that will be induced in humans.
- EP-2101 prepared by an emulsification protocol (see Example 17) similar to that proposed for drug manufacture
- CTL responses against all of the epitopes in the vaccine were measured and compared to CTL responses induced by co-immunizing mice with each CTL epitope alone plus the PADRE® epitope, in Montanide® ISA 51 adjuvant.
- CTL responses were determined by measuring IFN- ⁇ production by CTLs using an in situ ELISA (McKinney, D. M., et al., J Immunol.
- EP-2101 can induce HTL responses against the PADRE® epitope in HLA-A2.1/K b transgenic mice, which are restricted by the mouse H-2 I-A b allele (Alexander, J., et al., Immunity. 1:751-761 (1994)).
- EP-2101 is an immunotherapeutic vaccine designed to induce CTL responses against nine peptide epitopes derived from four TAAs which are widely expressed on colon and lung cancer cells (CEA, p53, HER-2/neu, and MAGE-2/3). Because TAAs represent self-proteins which are over-expressed in tumor cells, induction of a therapeutic response by EP-2101 may require the breaking of CTL tolerance against self-epitopes and induction of a limited but effective CTL response, one that specifically eliminates tumor cells without eliciting severe immunopathology against any normal tissue that may express low levels of the same TAAs.
- the immunogenicity of the EP-2101 vaccine against multiple epitopes and multiple self tumor proteins raised the possibility that immunopathological responses directed against normal tissue expressing low levels of TAAs may be induced in cancer patients after vaccination, although studies in murine models (Mizobata, S., K., et al., Cancer Immunol. Immunother. 49:285-295 (2000); Morgan, D. J., et al., J. Immunol. 160:643-651 (1998)) and previous clinical trials (Cormier, J. N., et al., Cancer J Sci. Am. 3:37-44 (1997); Salgaller, M. L., et al., Cancer Res.
- HLA-A2.1/K b transgenic mice To address this important concern, a pre-clinical immunopharmacology study was undertaken in HLA-A2.1/K b transgenic mice to determine whether autoimmune pathological responses occur following in vivo immunization with EP-2101. Although not a validated animal model for toxicological testing, this transgenic mouse system offered the opportunity to assess this important safety issue in a pre-clinical setting since the HLA-A2.1/K b transgene allowed for induction of murine CTL responses against the human CTL epitopes in the vaccine (Wentworth, P. A., et al., Eur. J Immunol. 26:97-101 (1996); Vitiello, A., et al., J Exp. Med. 173:1007-1015 (1991)).
- HLA-A2.1/K b transgenic mice received a total of six treatments with EP-2101 or a placebo emulsion control at three week intervals.
- Mice were injected at the tail base with EP-2101 at a 150-fold excess dose on a mg/kg basis compared to the dose planned for cancer patients in the clinical trial.
- Histopathology was performed on injected animals at three time points; at week two following a single treatment, at week 9 after three treatments, and at week 18 after six treatments, on tissue from seven major organs (heart, lung, kidney, stomach, intestine, brain and liver) from each animal, as well as on skin isolated from the injection site.
- animals were monitored at regular intervals for adverse events and body weight. Concurrent to histopathology analysis at the 3 time points and adverse event monitoring, the CTL responses in the spleen of vaccinated and placebo-treated mice were also measured to correlate any immunopathology with presence of CTL responses against epitopes in the vaccine.
- This transitory adverse event was not associated with necrosis or bleeding at the injection site skin, and such injuries were not observed in any animal throughout the duration of the entire study.
- EP-2101 is a therapeutic, peptide vaccine for use as an adjuvant therapy in patients with cancer.
- the vaccine is designed for administration to patients for the induction of cytotoxic T lymphocytes (CTL) directed against carcinoembryonic antigen (CEA), p53, human epidermal receptor-2/neurological (HER-2/neu) and melanoma antigen 2 and 3 (MAGE-2/3), tumor associated antigens (TAAs) that are frequently over-expressed in colon and non-small cell lung cancer (NSCLC).
- CTL cytotoxic T lymphocytes
- CEA carcinoembryonic antigen
- HER-2/neu human epidermal receptor-2/neurological
- MAGE-2/3 melanoma antigen 2 and 3
- TAAs tumor associated antigens
- NSCLC non-small cell lung cancer
- EP-2101 is composed of ten synthetic peptides, each composed of 9-13 amino acid residues, formulated as a stable water-in-oil emulsion in Montanide® ISA 51 adjuvant.
- Nine of the peptides represent CTL epitopes.
- Each CTL epitope is restricted by HLA-A2.1 and at least one other member of the HLA-A2 superfamily of MHC class I molecules, providing coverage of approximately 45% of the general population.
- the CTL epitopes included represent a combination of wild-type, fixed-anchor analog and heteroclitic analog epitopes.
- the tenth synthetic peptide is a pan-DR epitope (PADRE®), a rationally-designed helper T lymphocyte (HTL) epitope included to augment the magnitude and duration of CTL responses.
- PADRE® pan-DR epitope
- HTL helper T lymphocyte
- EP-2101 is an immunotherapeutic vaccine consisting of nine peptide epitopes derived from four TAAs which stimulate CTL responses and the PADRE® universal helper T cell epitope.
- the 10 peptides are formulated in an emulsion with Montanide® ISA 51 adjuvant which will be administered to NSCLC and colon cancer patients to assess safety and immunogenicity of the vaccine.
- Guidance as to the appropriate vaccine dosage for treating patients was provided by reports of previous clinical trials where CTL and clinical responses as well as vaccine safety were reported following administration of a peptide/Montanide® ISA 51 vaccine (Weber, J. S., et al., J Immunother. 22:431-440 (1999); Lee, P., et al., J Clin. Oncol.
- the dose of peptide administered to patients in these trials has been as high as 10 mg of total peptide per treatment, with most being in the range of 1-2 mg total peptide, and the treatment schedule was similar to that being proposed for the EP-2101 clinical trial (i.e. 4-6 subcutaneous injections at 3-4 week intervals).
- the most common toxicities reported were local injection site reactions (pain, tenderness, and granuloma formation) that were almost always scored grade 1 or 2 in severity (Wang, F., et al., Clin. Cancer Res. 5:2756-2765 (1999); Muderspach, L., et al., Clin. Cancer Res. 6:3406-3416 (2000); Ressing, M. E., et al., J Immunother.
- a stable emulsion was generated at a 5 mg/ml total peptide dose (0.5 mg/ml per peptide epitope).
- cancer patients in the EP-2101 clinical trial will receive a dosage corresponding to 5 mg of total peptide (0.5 mg per epitope) in an injection volume of 1 ml.
- Patients will receive six total subcutaneous injections at three week intervals in an injection volume of 1 ml.
- EP-2101 is a sterile, preservative-free emulsion of 10 peptide epitopes at a concentration of 0.5 mg/ml each, formulated in Montanide® ISA 51 adjuvant at a ratio of 1:1 (w:w) and filled into rubber stoppered glass vials.
- the peptides are synthesized using standard Boc or Fmoc chemistry for solid phase peptide synthesis starting with the appropriate resin, and purified by standard methods.
- the adjuvant is a mineral oil adjuvant, similar to Incomplete Freund's Adjuvant, manufactured and supplied by Seppic, Inc., Fairfield, N.J.
- EP-2101 is manufactured under aseptic conditions. Peptides are dissolved in three different solvents, sterile filtered, pooled and then emulsified in adjuvant via homogenization under controlled conditions.
- EP-2101 is designed for subcutaneous injection.
- the vaccine will be administered as a 1 ml injection every three weeks for a total of six injections.
- the total peptide dose for each injection will be 5.0 mg (0.5 mg of each peptide).
- Peptides are prepared using solid phase synthesis methodology. Briefly, fluorenylmethoxycarbonyl (Fmoc) and/or tert-butyloxycarbonyl (Boc) groups are used as the protecting groups for the amino acid residues in the synthesis. The peptide is built upon the appropriate resin.
- Fmoc fluorenylmethoxycarbonyl
- Boc tert-butyloxycarbonyl
- Amino acid derivatives are added to the resin-based amino acid using three equivalents each of DIC and HOBt as the coupling reagents.
- the Fmoc or Boc protecting group is removed from the terminal amino acid of the resin-based peptide using 20% piperidine in DMF or 65% TFA in dichloromethane, respectively.
- the remaining Fmoc-N- or Boc-N-protected amino acid residues are added to the resin-based peptide in sequential coupling cycles using DIC and HOBt as the coupling reagents and 20% piperidine in DMF or 65% TFA in dichloromethane to remove Fmoc and Boc protecting groups, respectively.
- Some side-chain protecting groups are removed using appropriate organic mixtures prior to peptide cleavage from the resin. Both removal of additional protecting groups and cleavage from the resin are achieved by treatment of the peptide-resin with a mixture of hydrogen fluoride/methoxybenzene or TFA/water. The peptide is extracted from the resin with acetic acid and, in some cases, extraction with trifluoroacetic acid. The resin is washed with ether. The peptide is isolated by lyophilization from the HOAc/TFA solution.
- the peptide is purified by preparative Reverse Phase High Performance Liquid Chromatography (RP-HPLC) on a C18 derivatized silica stationary phase.
- RP-HPLC Reverse Phase High Performance Liquid Chromatography
- the column is eluted and the fractions containing pure peptide are pooled and the peptide is isolated by lyophilization.
- RP-HPLC is followed by ion exchange purification/deslating using HOAc-buffered solvents.
- the resulting fractions are isolated by lyophilization.
- Table 9 describes the specifications for the Drug Substance.
- the bulk drug product is prepared as shown in FIG. 5 .
- the bulk drug product is formulated into three solutions (see Tables 8 and 12) based on the solubility of individual peptides in each of the three solvents and the solubility of the peptides when pooled. Briefly, to allow for aseptic processing, the 10 peptides are dissolved into either an acidic solution (0.1875 M acetic acid), a basic solution (0.1 M sodium hydroxide) or the organic solvent DMSO. These three peptide-containing pools are sterilized by filtration. Under aseptic conditions, these three peptide pools are combined, buffered, pH adjusted and then homogenized with Montanide® ISA 51 adjuvant under temperature-controlled conditions to form the drug product. The drug product, a stable 1:1 (w:w) emulsion, is then filled into 2 ml glass vials and stored at 2-8° C.
- Tables 13 and 14 describe the specifications for EP-2101 bulk drug product and drug product, respectively.
- Concentration of all peptide components in the EP-2101 Drug Product is assayed by RP-HPLC (conditions illustrated in Table 15).
- a specified quantity of the emulsion is mixed with a solution of 0.1% TFA in DMSO to form a two-layered mixture.
- Attempts to produce a clear, homogeneous solution for HPLC analysis by using solvents other than DMSO were unsuccessful.
- Sampling of the aforementioned two-phase mixture takes place by inserting a syringe or pipette through the top mineral oil layer and into the bottom, DMSO layer.
- the only sample taken for HPLC analysis is taken from the DMSO layer, in which all peptides are soluble.
- HPLC chromatography affords a distinct chromatographic peak for each peptide, which upon integration and comparison to a calibration curve yields the individual peptide concentration in the EP-2101 Drug Product.
- the biphasic nature of the sample introduces variability in the estimation of the full sample volume as well as the transfer of the sample. Subsequently, because of the complexity of sample preparation and handling, unusually large errors in determining the peptide concentration (as high as 30%) were observed. The large variability was not accompanied by major degradation product formation or other unusual physical changes of the sample, and is inferred to be a result of sample preparation and handling. For this reason the specification of ⁇ 50% of the intended concentration was set as a release and stability criterion. Attempts to improve the sample handling and, simplify the biphasic mineral oil-DMSO mixture are currently underway with a primary aim of narrowing the release and stability specifications.
- EP-2101 is composed of synthetic CTL and HTL peptide epitopes. Peptide content and integrity can be determined accurately by physical/chemical characterization using the analytical methods described above (e.g. HPLC, viscosity, and particle size analysis). In addition, a method for evaluating the overall potency of the drug product has been developed.
- HLA-A2.1/K b transgenic mouse assay has limitations in quantifying CTL responses, specifically: 1) only about 80% of the HLA-A2.1-restricted epitopes that are immunogenic in humans also induce CTL responses in transgenic mice (Wentworth, P. A., et al., Eur. J. Immunol.
- HLA-A2.1/K b transgenic mice are injected with EP-2101 and 14 days later splenocytes from immunized animals are stimulated in vitro with representative EP-2101 CTL epitopes, CEA.691H5 (1352.02) and HER-2/neu.369V2V9 (1334.10), to expand in vivo-primed CTL.
- representative EP-2101 CTL epitopes CEA.691H5 (1352.02) and HER-2/neu.369V2V9 (1334.10)
- in vivo-primed CTL responses also referred to as effector cells
- CTL activity measured by ELISA is expressed as secretory units (SU), which represent the number of effector cells needed to secrete 100 pg of IFN- ⁇ in response to peptide (McKinney, D. M., et al., J. Immunol. Methods 237:105-117 (2000)).
- SU secretory units
- the SU value is a reflection of the level of CTL induced by EP-2101 in HLA-A2.1/K b transgenic mice and is a measurement of vaccine potency.
- a final consideration in epitope selection for the potency assay was variability of CTL induction associated with individual mice. Since the protocol for the EP-2101 potency assay specifies measurement of CTL responses in a pooled splenocyte population derived from 6 immunized mice, a potential source of variability in the assay could be the frequency of CTL induction in individual animals. This consideration is not trivial since sporadic CTL responses behaving in an all-or-none fashion have been observed in individual mice injected with different types of highly immunogenic vaccine constructs (e.g. lipopeptide, DNA) (unpublished results).
- highly immunogenic vaccine constructs e.g. lipopeptide, DNA
- CEA.691H5 and HER-2/neu.369V2V9 induced the most robust and reproducible CTL response in all animals, followed by the MAGE-3.112I5 epitope (geometric mean SU response in 15 mice against the CEA, HER-2/neu, and MAGE-3 epitopes was 252 ⁇ / ⁇ 1.4, 169 ⁇ / ⁇ 1.7, and 48 ⁇ / ⁇ 1.7, respectively and these responses were within the range observed with pooled splenocytes from EP-2101-immunized animals).
- CEA.691H5 and HER-2/neu.369V2V9 epitopes were selected as the potency assay epitopes, and the MAGE-3.112I5 epitope was designated as a back-up based on 1) the strength of CTL responses measured in EP-2101 immunized animals using the in situ ELISA and ex vivo ELISPOT assays, 2) the equivalent magnitude of CTL responses generated against the epitopes with EP-2101 vaccine formulated at varying peptide emulsion doses, 3) the inter- and intra-experiment variability of these CTL responses, 4) the baseline responses in negative control animals, and 5) the consistency of CTL induction in individual animals.
- a potency assay specification was established to determine the upper and lower limits of CTL responses against the two potency epitopes induced by EP-2101.
- the data-base generated in na ⁇ ve or emulsion control (placebo) mice over six experiments (18 data-points) was analyzed and the SU values of all cultures from negative control mice were compiled.
- the lower limit specification was established by first calculating the geometric mean SU response and SD from all of the negative control cultures and then calculating a 3 SD cutoff value.
- geometric mean SU value of CTL activity from EP-2101-primed splenocytes for both epitopes must equal or exceed its respective lower limit specification.
- Each potency experiment will also include system suitability controls which will determine the validity of the EP-2101 potency measurements, obtained in the experiment.
- system suitability controls will determine the validity of the EP-2101 potency measurements, obtained in the experiment.
- mice will be co-immunized with each CTL epitope alone and the PADRE® epitope in a Montanide® ISA 51 emulsion and CTL responses in this group will be monitored using the same specifications established for the EP-2101 vaccine product.
- splenocytes from na ⁇ ve (non-vaccinated) mice will be stimulated in vitro with each CTL epitope under identical conditions as splenocytes harvested from EP-2101-immunized mice and as a criteria for a valid potency assay, CTL responses in this control group should not exceed the lower specification limit for each epitope.
- HLA-A2.1/K b transgenic mice were generated as described previously (Vitiello A., et al., J. Exp. Med. 173:1007-15 (1991)) as an F1 generation of a cross between an HLA-A2.1/K b transgenic strain generated on the C57/BL6 background and BALB/c mice.
- RPMI-1640 medium with HEPES (Life Technologies, Grand Island, N.Y.) supplemented with 10% FBS, 4 mM L-glutamine, 5 ⁇ 10 ⁇ 5 M 2-ME, 0.5 mM sodium pyruvate, 1 ⁇ non-essential amino acid residues, 100 ⁇ g/ml streptomycin and 100 U/ml penicillin (hereafter designated RPMI-10 medium).
- the individual peptides in the EP-2101 vaccine were solubilized from a lyophilized powder in the appropriate aqueous or DMSO solution and at the appropriate concentrations to yield 10, 5, or 2.5 mg/ml total peptide in the final adjuvant emulsion.
- the different solutions, the respective peptides formulated in them, and the method of formulation are described below.
- Solution 1 Peptides CEA.694H5, p53.149M2, MAGE3.112I5, and PADRE were solubilized in 0.1875M acetic acid.
- the CEA.691H5 peptide was solubilized first by 2 minutes of vortexing at high speed, followed by 5-10 minutes of sonication (35-40° C.). The other peptides were added one at a time and solubilized by vortexing for 1-2 minutes.
- Solution 2 (Basic Pool): Peptides CEA.24V9, CEA.605D6, HER2.689, MAGE2.157, and p53.139L2B3 were solubilized in 0.1M NaOH. Peptides were readily solubilized with brief vortexing (1-2 minutes).
- Solution 3 (DMSO): Peptide HER2.369V2V9 was solubilized in DMSO with vortexing (2 minutes) and heating (35-40° C.).
- the final Pool 4 solution was then combined 1:1 v:v with Montanide® ISA 51 (Seppic Inc.) and emulsified by homogenization using a Silverson L4RT homogenizer fitted with a 3 ⁇ 8 inch mini-micro tubular probe.
- a 10 mg/ml research emulsion was prepared in a total volume of 1.5 ⁇ 5 ml, with the tube kept cool on ice during preparation.
- the probe was carefully inserted into the oil layer near the water/oil interface and the oil layer was mixed at a low speed before the probe was transferred to the bottom of the tube and the speed adjusted to 8,000 rpm. Homogenization was performed for a total of 30 minutes and an even emulsion was produced by repeatedly raising and lowering the tube during this interval.
- the final EP-2101 emulsified product was kept at 4° C., prior to injection of animals.
- Emulsions at a 2.5 mg/ml and 5 mg/ml total peptide dose were prepared at a scale of approximately 25 ml, 500 ml, or 1 liter using probes and mixing screens of appropriate diameter and pore size.
- Placebo emulsion (emulsion control) was prepared as described above, except Solutions 1, 2, and 3 did not contain peptides.
- HLA-A2.1/K b transgenic mice were immunized with EP-2101 or placebo emulsion subcutaneously at the tail base in an injection volume of 50-100 ⁇ l/animal. Eleven to fourteen days after immunization, animals from each experimental group were sacrificed and a single cell suspension was prepared from a pool of mouse spleens. Individual cultures of splenocytes (20-25 ⁇ 10 6 cells per culture) were then stimulated in vitro in upright 25 cm 2 flasks with individual CTL epitopes represented in EP-2101 (1 ⁇ g/ml final peptide concentration in 10 ml of RPMI-10 medium; duplicate or triplicate cultures established per epitope).
- LPS blasts were prepared by stimulating spleen cells from untreated HLA-A2.1/K b mice in vitro with 6.25 ⁇ g/ml LPS (Sigma Chemical Co., St. Louis, Mo.) and 7 ⁇ g/ml dextran sulfate (500,000 M.W., 17% sulfur, Pharmacia Bioprocess Technology, Uppsala, Sweden) for 3 days at 37° C.
- Splenocyte cultures stimulated with EP-2101 peptide were incubated for 6 days at 37° C. in 5% CO 2 before each culture was measured for CTL activity using the IFN- ⁇ in situ ELISA, as described below.
- CTL activity from individual cultures was measured by the IFN- ⁇ in situ ELISA as previously described (McKinney, D. M, et al., J Immunol Methods 237:105 (2000)). Briefly, CTL effector cells (4 ⁇ 10 5 ) cells were added to 4 or 6 wells in a 96-well plate (flat-bottom, precoated with a capture anti-IFN- ⁇ monoclonal antibody). Cells were then serially diluted 4-fold in RPMI-10 medium until a final concentration of 391 cells/well was achieved. Jurkat-A2.1/K b tumor cells (10 5 /well) were then added to each well.
- ELISPOT assays to measure CTL or HTL responses induced by EP-2101 were performed according to previously published protocols (Lewis J J, et al., Int J Cancer 87:391 (1998)). Briefly, flat bottom 96-well nitrocellulose plates (IP, Millipore) were coated with IFN- ⁇ mAb (10 ⁇ g/ml, clone R4-6A2, PharMingen) and incubated overnight at 4° C. After washing with PBS, plates were blocked with RPMI-10 medium for 1 h at 37° C.
- CD8 + cells or CD4 + cells isolated with Miltenyi isolation system from EP-2101-immunized splenocytes
- 5 ⁇ 10 4 Jurkat-A2.1/K b cells for CD8 + cells
- 10 5 ⁇ -irradiated na ⁇ ve spleen cells for CD4 + cells, treated with erythrocyte lysis buffer
- Wells also received 10 ⁇ g/ml of CTL or HTL peptide to test for induction of responses against EP-2101 epitopes or an identical concentration of an irrelevant peptide.
- the irrelevant peptide for the CD8 ELISPOT assay was the HCV core.132 peptide (DLMGYIPLV (SEQ ID NO:______) and the HCV NS3.1253 peptide (GYKVLVLNPSVAATL (SEQ ID NO:_______) for the CD4 ELISPOT assay. After incubation, the plates were washed thoroughly with PBS/0.05% Tween 20 and biotinylated IFN- ⁇ mAb (2 ⁇ g/ml, clone XMG1.2, PharMingen) was added to each well and incubated for 2-4 h at 37° C.
- Vectastain ABC peroxidase Vectastain Elite kit; Vector laboratories, Inc., Burlingame, Calif., USA
- Vectastain Elite kit Vector laboratories, Inc., Burlingame, Calif., USA
- PBS/0.05% Tween 20 Vectastain Elite kit; Vector laboratories, Inc., Burlingame, Calif., USA
- One hundred ⁇ l of AEC solution was added to develop the spots.
- the reaction was stopped after 4-6 minutes under running tap water.
- the spots were counted by computer-assisted image analysis (Zeiss KS ELISPOT Reader, Jena, Germany).
- the net number of spots/10 6 CD8 + cells or CD4 + cells was calculated as (number of spots against relevant peptide) ⁇ (number of spots with irrelevant control peptide) ⁇ 2.5.
- CTL cytotoxic T-Cell immune response multiple response
- Terminus (Primary 2 (Primary Anchor) 3 (Primary Anchor) Anchor) SUPERMOTIFS A1 T , I , L , V , M , S F , W , Y A2 L , I , V , M , A , T , Q I , V , M , A , T , L A3 V , S , M , A , T , L , I R , K A24 Y , F , W , I , V , L , M , T F , I , Y , W , L , M B7 P V , I , L , F , M , W , Y , A B27 R , H , K F , Y , L , W , M , I , V , A B44 E , D F , W , L , I , M , V , A
- TAA Tumor Associated Antigen
- HLA- Allelle-specific HLA-supertype members supertype Verified a Predicted b A1 A*0101, A*2501, A*2601, A*2602, A*0102, A*2604, A*3601, A*4301, A*3201, A*2902 A*8001 A2 A*0201, A*0202, A*0203, A*0204, A*0208, A*0210, A*0211, A*0212, A*0205, A*0206, A*0207, A*0209, A*0213 A*0214, A*6802, A*6901 A3 A*0301, A*1101, A*3101, A*3301, A*6801 A*0302, A*1102, A*2603, A*3302, A*3303, A*3401, A*3402, A*6601, A*6602, A*7401 A24 A*2301, A*2402, A*3001 A*2403, A*2404, A*3002, A*3003 B7 B*0702
- TAA Tumor Associated Antigen
- TABLE 10 Tumor Associated Antigens and Genes TAA ANTIGEN REFERENCE MAGE 1 (Traversari C., Boon T, J. Ex. Med 176: 1453, 1992) MAGE 2 (De Smet C., Boon T, Immunogenetics, 39(2)121-9, 1994) MAGE 3 (Gaugler B., Boon T, J. Ex. Med 179: 921, 1994) MAGE-11 (Jurk M., Winnacker L, Int. J. Cancer 75, 762-766, 1998) MAGE-A10 (Huang L., Van Pel A, J.
- TAA Tumor-associated antigen sequences CEA SEQ ID NO: 11 MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKE VLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREI IYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSIS SNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTL TLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYR SGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQ NTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECG
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Mycology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US10/553,703 US20080274129A1 (en) | 2003-04-18 | 2004-04-16 | Hla-A2 Tumor Associated Antigen Peptides and Compositions |
| US12/710,836 US8007810B2 (en) | 2003-04-18 | 2010-02-23 | HLA-A2 tumor associated antigen peptides and compositions |
| US13/212,847 US20120183598A1 (en) | 2003-04-18 | 2011-08-18 | Hla-a2 tumor associated antigen peptides and compositions |
| US14/081,086 US9394350B2 (en) | 2003-04-18 | 2013-11-15 | HLA-A2 tumor associated antigen peptides and compositions |
| US15/195,936 US9913884B2 (en) | 2003-04-18 | 2016-06-28 | HLA-A2 tumor associated antigen peptides and compositions |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US46372403P | 2003-04-18 | 2003-04-18 | |
| US10/553,703 US20080274129A1 (en) | 2003-04-18 | 2004-04-16 | Hla-A2 Tumor Associated Antigen Peptides and Compositions |
| PCT/US2004/011895 WO2004094454A2 (en) | 2003-04-18 | 2004-04-16 | Hla-a2 tumor associated antigen peptides and compositions |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/011895 A-371-Of-International WO2004094454A2 (en) | 2003-04-18 | 2004-04-16 | Hla-a2 tumor associated antigen peptides and compositions |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/710,836 Continuation US8007810B2 (en) | 2003-04-18 | 2010-02-23 | HLA-A2 tumor associated antigen peptides and compositions |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20080274129A1 true US20080274129A1 (en) | 2008-11-06 |
Family
ID=33310811
Family Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/553,703 Abandoned US20080274129A1 (en) | 2003-04-18 | 2004-04-16 | Hla-A2 Tumor Associated Antigen Peptides and Compositions |
| US12/710,836 Expired - Lifetime US8007810B2 (en) | 2003-04-18 | 2010-02-23 | HLA-A2 tumor associated antigen peptides and compositions |
| US13/212,847 Abandoned US20120183598A1 (en) | 2003-04-18 | 2011-08-18 | Hla-a2 tumor associated antigen peptides and compositions |
| US14/081,086 Expired - Fee Related US9394350B2 (en) | 2003-04-18 | 2013-11-15 | HLA-A2 tumor associated antigen peptides and compositions |
| US15/195,936 Expired - Fee Related US9913884B2 (en) | 2003-04-18 | 2016-06-28 | HLA-A2 tumor associated antigen peptides and compositions |
Family Applications After (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/710,836 Expired - Lifetime US8007810B2 (en) | 2003-04-18 | 2010-02-23 | HLA-A2 tumor associated antigen peptides and compositions |
| US13/212,847 Abandoned US20120183598A1 (en) | 2003-04-18 | 2011-08-18 | Hla-a2 tumor associated antigen peptides and compositions |
| US14/081,086 Expired - Fee Related US9394350B2 (en) | 2003-04-18 | 2013-11-15 | HLA-A2 tumor associated antigen peptides and compositions |
| US15/195,936 Expired - Fee Related US9913884B2 (en) | 2003-04-18 | 2016-06-28 | HLA-A2 tumor associated antigen peptides and compositions |
Country Status (12)
| Country | Link |
|---|---|
| US (5) | US20080274129A1 (https=) |
| EP (1) | EP1620456B1 (https=) |
| JP (1) | JP5156882B2 (https=) |
| AU (2) | AU2004232971A1 (https=) |
| CA (1) | CA2522812C (https=) |
| CY (1) | CY1115311T1 (https=) |
| DK (1) | DK1620456T3 (https=) |
| ES (1) | ES2456666T3 (https=) |
| PL (1) | PL1620456T3 (https=) |
| PT (1) | PT1620456E (https=) |
| SI (1) | SI1620456T1 (https=) |
| WO (1) | WO2004094454A2 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080260762A1 (en) * | 1992-08-07 | 2008-10-23 | Grey Howard M | HLA binding motifs and peptides and their uses |
| US20080279924A1 (en) * | 1999-12-13 | 2008-11-13 | Fikes John D | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
| US9585948B2 (en) | 2010-12-02 | 2017-03-07 | Oncotherapy Science, Inc. | TOMM34 peptides and vaccines including the same |
| CN110129284A (zh) * | 2013-07-16 | 2019-08-16 | 迪特桑有限公司 | 遗传稳定的溶瘤性rna病毒、其制备方法及用途 |
| US11191820B2 (en) * | 2015-06-29 | 2021-12-07 | Ose Immunotherapeutics | Method for inducing early T memory response with short peptides anti-tumor vaccine |
Families Citing this family (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2292642A1 (en) * | 2003-06-10 | 2011-03-09 | Opal Therapeutics Pty Ltd | Immunomodulating compositions, uses therefor and processes for their production |
| US7612162B2 (en) | 2004-09-21 | 2009-11-03 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Peptide analogs capable of enhancing stimulation of a glioma-specific CTL response |
| CA2523032A1 (en) | 2005-10-07 | 2007-04-07 | Immunovaccine Technologies Inc. | Vaccines for cancer therapy |
| CN101687022B (zh) * | 2007-03-26 | 2016-09-07 | 莱顿大学医学中心附属莱顿教学医院 | Prame衍生的肽以及包括该肽的免疫原组合物 |
| CN106310293A (zh) | 2007-09-27 | 2017-01-11 | 免疫疫苗技术有限公司 | 在包括连续疏水相的载体中的脂质体在体内输送多核苷酸中的应用 |
| JP2011502484A (ja) | 2007-11-01 | 2011-01-27 | メイヨ・ファウンデーション・フォー・メディカル・エデュケーション・アンド・リサーチ | Hla−dr結合性ペプチドおよびそれらの使用 |
| WO2009146523A1 (en) | 2008-06-05 | 2009-12-10 | Immunovaccine Technologies Inc. | Compositions comprising liposomes, an antigen, a polynucleotide and a carrier comprising a continuous phase of a hydrophobic substance |
| EP2391635B1 (en) | 2009-01-28 | 2017-04-26 | Epimmune Inc. | Pan-dr binding polypeptides and uses thereof |
| EP2569633B1 (en) * | 2010-05-14 | 2016-02-10 | The General Hospital Corporation | Compositions and methods of identifying tumor specific neoantigens |
| CA2809362C (en) * | 2010-08-24 | 2020-03-10 | University Of Pittsburgh - Of The Commonwealth System Of Higher Educatn | Interleukin-13 receptor alpha 2 peptide-based brain cancer vaccines |
| CN113876945A (zh) | 2011-10-06 | 2022-01-04 | 免疫疫苗技术有限公司 | 包括激活或增加tlr2活性的佐剂的脂质体组合物及其应用 |
| US20150359864A1 (en) * | 2012-03-09 | 2015-12-17 | Oncotherapy Science, Inc. | Pharmaceutical composition containing peptides |
| WO2015077717A1 (en) | 2013-11-25 | 2015-05-28 | The Broad Institute Inc. | Compositions and methods for diagnosing, evaluating and treating cancer by means of the dna methylation status |
| WO2015085147A1 (en) | 2013-12-05 | 2015-06-11 | The Broad Institute Inc. | Polymorphic gene typing and somatic change detection using sequencing data |
| KR20230076867A (ko) | 2013-12-20 | 2023-05-31 | 더 브로드 인스티튜트, 인코퍼레이티드 | 신생항원 백신과의 병용 요법 |
| JP6474893B2 (ja) * | 2014-11-06 | 2019-02-27 | オーエスイー・イミュノセラピューティクス | 脳転移の処置のための治療用マルチペプチドt特異的免疫療法 |
| US10975442B2 (en) | 2014-12-19 | 2021-04-13 | Massachusetts Institute Of Technology | Molecular biomarkers for cancer immunotherapy |
| EP3234130B1 (en) | 2014-12-19 | 2020-11-25 | The Broad Institute, Inc. | Methods for profiling the t-cell- receptor repertoire |
| IL294183B2 (en) | 2015-05-20 | 2023-10-01 | Dana Farber Cancer Inst Inc | shared neoantigens |
| PT3359183T (pt) * | 2015-10-06 | 2020-08-13 | Invectys | Construções de poliepítopo para utilização em imunoterapia |
| US11549149B2 (en) | 2017-01-24 | 2023-01-10 | The Broad Institute, Inc. | Compositions and methods for detecting a mutant variant of a polynucleotide |
| PL4029494T3 (pl) * | 2017-01-25 | 2026-03-23 | Ose Immunotherapeutics | Sposób wytwarzania stabilnej emulsji do dostarczania peptydów |
| NZ765655A (en) | 2017-11-27 | 2026-01-30 | Ose Immunotherapeutics | Improved treatment of cancer |
| US20200179500A1 (en) | 2018-12-05 | 2020-06-11 | Wayne State University | Methods and immunogenic compositions relating to her2 with selective sequence modifications |
| AU2020340983A1 (en) | 2019-09-04 | 2022-03-10 | The Board Of Trustees Of The Leland Stanford Junior University | Cross-reactive epitope for multiple sclerosis |
| US11421015B2 (en) | 2020-12-07 | 2022-08-23 | Think Therapeutics, Inc. | Method of compact peptide vaccines using residue optimization |
| CN116710115A (zh) | 2020-11-20 | 2023-09-05 | 思维疗法股份有限公司 | 用于优化的肽疫苗的组合物和方法 |
| US11058751B1 (en) | 2020-11-20 | 2021-07-13 | Think Therapeutics, Inc. | Compositions for optimized RAS peptide vaccines |
| US11464842B1 (en) | 2021-04-28 | 2022-10-11 | Think Therapeutics, Inc. | Compositions and method for optimized peptide vaccines using residue optimization |
| CN115772227A (zh) * | 2021-09-08 | 2023-03-10 | 珠海市丽珠单抗生物技术有限公司 | 新型冠状病毒SARS-CoV-2的Delta变异株疫苗与应用 |
| WO2025093541A1 (en) | 2023-10-31 | 2025-05-08 | Ose Immunotherapeutics | Combination of interleukin 7 and tumour associated antigen vaccine |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5686068A (en) * | 1994-03-24 | 1997-11-11 | Ludwig Institute For Cancer Research | Isolated peptides derived from MAGE-2, cytolytic T cells specific to complexes of peptide and HLA-A2 molecules, and uses thereof |
| US5846827A (en) * | 1993-08-06 | 1998-12-08 | Cytel Corporation | Methods for ex vivo therapy using peptide-loaded antigen presenting cells for the activation of CTL |
| US6063900A (en) * | 1994-03-24 | 2000-05-16 | Ludwig Institute For Cancer Research | Isolated tumor rejection antigen precursor MAGE-2 derived peptides, and uses thereof |
| US6075122A (en) * | 1993-03-17 | 2000-06-13 | University Of Washington | Immune reactivity to HER-2/neu protein for diagnosis and treatment of malignancies in which the HER-2/neu oncogene is associated |
| US6432707B1 (en) * | 1997-12-24 | 2002-08-13 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of breast cancer |
| US20020119127A1 (en) * | 1999-12-28 | 2002-08-29 | Alessandro Sette | Method and system for optimizing minigenes and peptides encoded thereby |
| US6602510B1 (en) * | 2000-04-05 | 2003-08-05 | Epimmune Inc. | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
| US20030224036A1 (en) * | 1999-12-13 | 2003-12-04 | Fikes John D | Hla class I a2 tumor associated antigen peptides and vaccine compositions |
| US20070098776A1 (en) * | 1999-12-13 | 2007-05-03 | Fikes John D | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
Family Cites Families (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US6267965B1 (en) | 1981-12-24 | 2001-07-31 | Virogenetics Corporation | Recombinant poxvirus—cytomegalovirus compositions and uses |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| US5270202A (en) * | 1989-11-03 | 1993-12-14 | Syamal Raychaudhuri | Anti-idiotypic antibodies to human melanoma-associated proteoglycan antigen |
| US5679640A (en) | 1991-02-12 | 1997-10-21 | Cytel Corporation | Immunosuppressant peptides |
| US5997878A (en) | 1991-03-07 | 1999-12-07 | Connaught Laboratories | Recombinant poxvirus-cytomegalovirus, compositions and uses |
| WO1994003205A1 (en) | 1992-08-07 | 1994-02-17 | Cytel Corporation | Hla binding peptides and their uses |
| BR9406652A (pt) | 1993-03-05 | 1996-09-10 | Cytel Corp | Composição |
| DE69435171D1 (de) | 1993-09-14 | 2009-01-08 | Pharmexa Inc | Pan dr-bindeproteinen zur erhöhung der immunantwort |
| US6413935B1 (en) | 1993-09-14 | 2002-07-02 | Epimmune Inc. | Induction of immune response against desired determinants |
| US6660276B1 (en) | 1994-02-16 | 2003-12-09 | The University Of Virginia Patent Foundation | Peptides recognized by melanoma-specific cytotoxic lymphocytes, and uses therefor |
| WO1996018409A1 (en) | 1994-12-14 | 1996-06-20 | The Scripps Research Institute | In vivo activation of tumor-specific cytotoxic t cells |
| US5635363A (en) | 1995-02-28 | 1997-06-03 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for the detection, quantitation and purification of antigen-specific T cells |
| PT876398E (pt) | 1996-01-24 | 2002-12-31 | Epimmune Inc | Inducao de respostas imunitarias contra determinantes desejados |
| US5951975A (en) * | 1996-06-28 | 1999-09-14 | University Of Pittsburgh | Induction of CTLs specific for natural antigens by cross priming immunization |
| US6180398B1 (en) | 1996-07-12 | 2001-01-30 | Virogeneitics Corporation | Two-step immunization procedure against the pyramyxoviridae family of viruses using recombinant virus and subunit protein preparation |
| CA2278189A1 (en) | 1997-01-31 | 1998-08-06 | Epimmune, Inc. | Peptides and peptide-loaded antigen presenting cells for the activation of ctl |
| US5990091A (en) | 1997-03-12 | 1999-11-23 | Virogenetics Corporation | Vectors having enhanced expression, and methods of making and uses thereof |
| US6348450B1 (en) | 1997-08-13 | 2002-02-19 | The Uab Research Foundation | Noninvasive genetic immunization, expression products therefrom and uses thereof |
| FR2788449B1 (fr) | 1999-01-14 | 2001-02-16 | Oreal | Nanoemulsion a base de citrates d'alkylether, et ses utilisations dans les domaines cosmetique, dermatologique, pharmaceutique et/ou ophtalmologique |
| ATE512666T1 (de) * | 1999-06-29 | 2011-07-15 | Epimmune Inc | Hla-bindende peptide und ihre verwendungen |
| EP1235848A4 (en) | 1999-12-10 | 2005-02-09 | Epimmune Inc | INDUCING CELLULAR IMMUNE RESPONSES TO CARCINOEMBRYONIC ANTIGEN USING PEPTIDE AND NUCLEIC ACID-CONTAINING COMPOSITIONS |
| CA2393662A1 (en) | 1999-12-10 | 2001-06-14 | Epimmune Inc. | Inducing cellular immune responses to p53 using peptide and nucleic acid compositions |
| EP1239866A4 (en) | 1999-12-10 | 2005-02-09 | Epimmune Inc | INDUCTION OF HER2 / NEU CELLULAR IMMUNE RESPONSES USING PEPTIDE AND NUCLEIC ACID-CONTAINING COMPOSITIONS |
| JP2003516344A (ja) * | 1999-12-13 | 2003-05-13 | エピミューン, インコーポレイテッド | Hlaクラスia2腫瘍関連抗原ペプチドおよびワクチン組成物 |
| JP2003521245A (ja) | 1999-12-21 | 2003-07-15 | エピミューン, インコーポレイテッド | ペプチドおよび核酸組成物を使用する、前立腺癌抗原に対する細胞性免疫応答の誘導 |
| EP1305414A2 (en) * | 2000-07-31 | 2003-05-02 | Aventis Pasteur Limited | Modified cea and uses thereof |
-
2004
- 2004-04-16 PT PT47599626T patent/PT1620456E/pt unknown
- 2004-04-16 DK DK04759962.6T patent/DK1620456T3/da active
- 2004-04-16 ES ES04759962.6T patent/ES2456666T3/es not_active Expired - Lifetime
- 2004-04-16 AU AU2004232971A patent/AU2004232971A1/en not_active Abandoned
- 2004-04-16 CA CA2522812A patent/CA2522812C/en not_active Expired - Lifetime
- 2004-04-16 PL PL04759962T patent/PL1620456T3/pl unknown
- 2004-04-16 EP EP04759962.6A patent/EP1620456B1/en not_active Expired - Lifetime
- 2004-04-16 JP JP2006513093A patent/JP5156882B2/ja not_active Expired - Fee Related
- 2004-04-16 WO PCT/US2004/011895 patent/WO2004094454A2/en not_active Ceased
- 2004-04-16 SI SI200432140T patent/SI1620456T1/sl unknown
- 2004-04-16 US US10/553,703 patent/US20080274129A1/en not_active Abandoned
-
2010
- 2010-02-23 US US12/710,836 patent/US8007810B2/en not_active Expired - Lifetime
- 2010-08-27 AU AU2010214701A patent/AU2010214701B2/en not_active Ceased
-
2011
- 2011-08-18 US US13/212,847 patent/US20120183598A1/en not_active Abandoned
-
2013
- 2013-11-15 US US14/081,086 patent/US9394350B2/en not_active Expired - Fee Related
-
2014
- 2014-04-03 CY CY20141100255T patent/CY1115311T1/el unknown
-
2016
- 2016-06-28 US US15/195,936 patent/US9913884B2/en not_active Expired - Fee Related
Patent Citations (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6075122A (en) * | 1993-03-17 | 2000-06-13 | University Of Washington | Immune reactivity to HER-2/neu protein for diagnosis and treatment of malignancies in which the HER-2/neu oncogene is associated |
| US5846827A (en) * | 1993-08-06 | 1998-12-08 | Cytel Corporation | Methods for ex vivo therapy using peptide-loaded antigen presenting cells for the activation of CTL |
| US5686068A (en) * | 1994-03-24 | 1997-11-11 | Ludwig Institute For Cancer Research | Isolated peptides derived from MAGE-2, cytolytic T cells specific to complexes of peptide and HLA-A2 molecules, and uses thereof |
| US6063900A (en) * | 1994-03-24 | 2000-05-16 | Ludwig Institute For Cancer Research | Isolated tumor rejection antigen precursor MAGE-2 derived peptides, and uses thereof |
| US6432707B1 (en) * | 1997-12-24 | 2002-08-13 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of breast cancer |
| US20030224036A1 (en) * | 1999-12-13 | 2003-12-04 | Fikes John D | Hla class I a2 tumor associated antigen peptides and vaccine compositions |
| US20070098776A1 (en) * | 1999-12-13 | 2007-05-03 | Fikes John D | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
| US20080279924A1 (en) * | 1999-12-13 | 2008-11-13 | Fikes John D | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
| US20020119127A1 (en) * | 1999-12-28 | 2002-08-29 | Alessandro Sette | Method and system for optimizing minigenes and peptides encoded thereby |
| US6602510B1 (en) * | 2000-04-05 | 2003-08-05 | Epimmune Inc. | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080260762A1 (en) * | 1992-08-07 | 2008-10-23 | Grey Howard M | HLA binding motifs and peptides and their uses |
| US20080279924A1 (en) * | 1999-12-13 | 2008-11-13 | Fikes John D | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
| US9585948B2 (en) | 2010-12-02 | 2017-03-07 | Oncotherapy Science, Inc. | TOMM34 peptides and vaccines including the same |
| EP2646546B1 (en) * | 2010-12-02 | 2018-05-16 | Oncotherapy Science, Inc. | Tomm34 peptides and vaccines including the same |
| CN110129284A (zh) * | 2013-07-16 | 2019-08-16 | 迪特桑有限公司 | 遗传稳定的溶瘤性rna病毒、其制备方法及用途 |
| US11191820B2 (en) * | 2015-06-29 | 2021-12-07 | Ose Immunotherapeutics | Method for inducing early T memory response with short peptides anti-tumor vaccine |
Also Published As
| Publication number | Publication date |
|---|---|
| SI1620456T1 (sl) | 2014-05-30 |
| JP5156882B2 (ja) | 2013-03-06 |
| WO2004094454A2 (en) | 2004-11-04 |
| CY1115311T1 (el) | 2017-01-04 |
| ES2456666T3 (es) | 2014-04-23 |
| DK1620456T3 (da) | 2014-04-22 |
| US8007810B2 (en) | 2011-08-30 |
| EP1620456A2 (en) | 2006-02-01 |
| EP1620456A4 (en) | 2009-06-03 |
| PL1620456T3 (pl) | 2014-06-30 |
| PT1620456E (pt) | 2014-04-15 |
| US20120183598A1 (en) | 2012-07-19 |
| AU2010214701A1 (en) | 2010-09-23 |
| EP1620456B1 (en) | 2014-02-26 |
| US20170028041A1 (en) | 2017-02-02 |
| CA2522812C (en) | 2012-08-21 |
| WO2004094454A8 (en) | 2005-07-21 |
| AU2004232971A1 (en) | 2004-11-04 |
| US9913884B2 (en) | 2018-03-13 |
| AU2010214701B2 (en) | 2012-02-02 |
| CA2522812A1 (en) | 2004-11-04 |
| US20140141064A1 (en) | 2014-05-22 |
| WO2004094454A3 (en) | 2006-11-09 |
| US9394350B2 (en) | 2016-07-19 |
| US20100209493A1 (en) | 2010-08-19 |
| JP2006526628A (ja) | 2006-11-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9913884B2 (en) | HLA-A2 tumor associated antigen peptides and compositions | |
| US20060094649A1 (en) | Hla-a1,-a2,-a3,-a24,-b7, and-b44 tumor associated antigen peptides and compositions | |
| US6602510B1 (en) | HLA class I A2 tumor associated antigen peptides and vaccine compositions | |
| US20110318408A1 (en) | Hla class i a2 tumor associated antigen peptides and vaccine compositions | |
| US8741576B2 (en) | Heteroclitic analogs and related methods | |
| EP1242049A1 (en) | Hla class i a2 tumor associated antigen peptides and vaccine compositions | |
| US20120141579A1 (en) | Cytotoxic T Lymphocyte Inducing Immunogens for Prevention Treatment and Diagnosis of Cancer | |
| MXPA04009554A (es) | Construcciones epitopes que comrpenden antigeno presentando mecanismos de marcacion celular. | |
| US20060018915A1 (en) | Heteroclitic analogs and related methods | |
| US20030224036A1 (en) | Hla class I a2 tumor associated antigen peptides and vaccine compositions | |
| US20140147490A1 (en) | Hla class i a2 tumor associated antigen peptides and vaccine compositions | |
| EP1903056A2 (en) | HLA-A1, -A2 -A3, -A24, -B7, and -B44 tumor associated antigen peptides and compositions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: IDM PHARMA, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FIKES, JOHN D.;ISHIOKA, GLENN;SETTE, ALESSANDRO;AND OTHERS;REEL/FRAME:019314/0522;SIGNING DATES FROM 20060610 TO 20060718 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
| AS | Assignment |
Owner name: BIOTECH SYNERGY, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:IDM PHARMA, INC.;REEL/FRAME:026765/0185 Effective date: 20110331 |
|
| AS | Assignment |
Owner name: BIOTECH SYNERGY, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:IDM PHARMA, INC.;REEL/FRAME:033453/0170 Effective date: 20110331 Owner name: OSE PHARMA INTERNATIONAL SA, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:BIOTECH SYNERGY, INC.;REEL/FRAME:033453/0211 Effective date: 20140620 |