US20030013137A1 - Automated methods of detecting receptor activity - Google Patents

Automated methods of detecting receptor activity Download PDF

Info

Publication number
US20030013137A1
US20030013137A1 US10/095,620 US9562002A US2003013137A1 US 20030013137 A1 US20030013137 A1 US 20030013137A1 US 9562002 A US9562002 A US 9562002A US 2003013137 A1 US2003013137 A1 US 2003013137A1
Authority
US
United States
Prior art keywords
intensity
cell
energy emitted
detectable molecules
gpcr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US10/095,620
Other languages
English (en)
Inventor
Larry Barak
Robert Oakley
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Duke University
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Priority to US10/095,620 priority Critical patent/US20030013137A1/en
Priority to JP2002572410A priority patent/JP2004532978A/ja
Priority to AU2002248597A priority patent/AU2002248597B2/en
Priority to PCT/US2002/007434 priority patent/WO2002073199A1/en
Priority to EP02717608A priority patent/EP1386154A4/en
Priority to CA002440683A priority patent/CA2440683A1/en
Assigned to DUKE UNIVERSITY reassignment DUKE UNIVERSITY ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: OAKLEY, ROBERT H., BARAK, LARRY S.
Publication of US20030013137A1 publication Critical patent/US20030013137A1/en
Priority to US10/629,176 priority patent/US20040029190A1/en
Priority to US11/084,928 priority patent/US7455982B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1089Design, preparation, screening or analysis of libraries using computer algorithms
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5076Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving cell organelles, e.g. Golgi complex, endoplasmic reticulum
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/566Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2503/00Use of cells in diagnostics
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/72Assays involving receptors, cell surface antigens or cell surface determinants for hormones
    • G01N2333/726G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/04Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells

Definitions

  • the present invention relates to methods of detecting G protein-coupled receptor (GPCR) activity in vitro and in vivo.
  • GPCR G protein-coupled receptor
  • the present invention provides methods for identifying compounds that activate the GPCR regulatory pathway and methods for identifying ligands of GPCRs.
  • G protein-coupled receptors are cell surface proteins that translate hormone or ligand binding into intracellular signals. GPCRs are found in all animals, insects, and plants. GPCR signaling plays a pivotal role in regulating various physiological functions including phototransduction, olfaction, neurotransmission, vascular tone, cardiac output, digestion, pain, and fluid and electrolyte balance. Although they are involved in various physiological functions, GPCRs share a number of common structural features. They contain seven membrane domains bridged by alternating intracellular and extracellular loops and an intracellular carboxyl-terminal tail of variable length.
  • GPCRs The magnitude of the physiological responses controlled by GPCRs is linked to the balance between GPCR signaling and signal termination.
  • the signaling of GPCRs is controlled by a family of intracellular proteins called arresting.
  • Arrestins bind activated GPCRs, including those that have been agonist-activated and especially those that have been phosphorylated by G protein-coupled receptor kinases (GRKs).
  • GRKs G protein-coupled receptor kinases
  • Receptors including GPCRs
  • GPCRs have historically been targets for drug discovery and therapeutic agents because they bind ligands, hormones, and drugs with high specificity.
  • GPCRs Although only several hundred human GPCRs are known, it is estimated that several thousand GPCRs exist in the human genome. Of these known GPCRs, many are orphan receptors that have yet to be associated with a function or ligands.
  • One method of assaying GPCR activity uses a cell expressing a GPCR and a conjugate of an arrestin and a detectable molecule.
  • a method of detecting G protein-coupled receptor (GPCR) pathway activity includes providing at least one cell that expresses a GPCR and a plurality of conjugated proteins. Each of the plurality of conjugated proteins is formed by conjugating an arrestin protein and a detectable molecule. The plurality of conjugated proteins are substantially evenly distributed in the cytoplasm of the at least one cell. A first image of the at least one cell is obtained by detecting an amount of energy emitted from the detectable molecules and storing a value relative to the amount of energy. The at least one cell is treated with a test compound. A second image of the at least one cell is obtained. The first image and the second image are compared to detect the localization of at least some of the plurality of conjugated proteins. The localization may occur at endocytic vesicles and/or endosomes.
  • GPCR G protein-coupled receptor
  • a method of detecting G protein-coupled receptor (GPCR) pathway activity whereby at least one cell that expresses a GPCR and a plurality of conjugated proteins are provided.
  • Each of the plurality of conjugated proteins is formed by conjugating an arrestin protein and a detectable molecule.
  • the plurality of conjugated proteins are substantially evenly distributed in the cytoplasm of the at least one cell.
  • a first digital image of the at least one cell is obtained by detecting and measuring energy emitted from the detectable molecules.
  • the first digital image is formed from an array of a plurality of pixels each having respective intensity values. A respective intensity value is based on the intensity of energy emitted from the detectable molecules associated with a pixel's location in the array.
  • the at least one cell is treated with a test compound.
  • a second digital image of the at least one cell is obtained by detecting and measuring energy emitted from the detectable molecules.
  • the second digital image is formed from an array of a plurality of pixels each having respective intensity values.
  • a respective intensity value is based on the intensity of energy emitted from the detectable molecules associated with a pixel's location in the array.
  • the first digital image and the second digital image are compared to detect the localization of at least some of the plurality of conjugated proteins.
  • the localization may occur at endocytic vesicles and/or endosomes.
  • the localization of at least some of the plurality of conjugated proteins are detected by a change in apparent intensity of energy emitted from detectable molecules resulting in an increase in the value of at least some of the plurality of pixels.
  • a method of detecting G protein-coupled receptor (GPCR) pathway activity is provided.
  • At least one cell that expresses a GPCR and a plurality of conjugated proteins is provided.
  • Each of the plurality of conjugated proteins is formed by conjugating an arrestin protein and a detectable molecule.
  • the plurality of conjugated proteins are substantially evenly distributed in the cytoplasm of the at least one cell.
  • the at least one cell is treated with a test compound.
  • a digital image of the at least one cell is obtained by detecting and measuring energy emitted from the detectable molecules.
  • the digital image is formed from an array of a plurality of pixels each having respective intensity values.
  • a respective intensity value is based on the intensity of energy emitted from the detectable molecules associated with a pixel's location in the array.
  • the localization of at least some of the plurality of conjugated proteins may be detected at endocytic vesicles and/or endosomes.
  • the localization of at least some of the plurality of conjugated proteins is detected by a change in apparent intensity of energy emitted from detectable molecules resulting in a value of at least some of the plurality of pixels above a threshold intensity.
  • FIG. 1 is a flow diagram of a method of detecting receptor activity in accordance with the invention
  • FIG. 2 is a flow diagram of another method of detecting receptor activity in accordance with the invention.
  • FIGS. 3 a and 3 b are confocal microscopic images of ⁇ arr-GFP fluorescence in cells stably expressing ⁇ arr-GFP fusion protein and the V2R (GPCR) of which:
  • FIG. 3 a is before treatment with an agonist (Control)
  • FIG. 3 b is after a 30 min. treatment with agonist at 37° C.
  • FIGS. 4 a and 4 b are identical to FIGS. 3 a and 3 b , respectively, except that they were taken at a reduced detector sensitivity to prevent saturation of the detector;
  • FIGS. 5 a and 5 b show confocal microscope images taken at reduced intensity with the pixels above the threshold intensity (here calculated as those within the >99th percentile) appearing as lightly shaded regions, of which:
  • FIG. 5 a is of the control group
  • FIG. 5 b is of the treated cells
  • FIG. 6 is a histogram of pixel count vs pixel intensity
  • FIG. 7 is a graph of the number of pixels above the threshold intensity for the control and treated cells.
  • the methods offer the advantage of providing a gross comparison of the relative intensities of scans of cells before and after exposure to a test compound for a quick and simple determination of the activity of the test compound.
  • test compounds include potential ligands, potential agonists, potential antagonists, and potential desensitization agents.
  • the methods do not require qualitative analyzes of an image with respect to location of a detectable molecule and the detectable molecule's proximity to any specific cell structure.
  • the method also does not require determinations of area of specific cell structures or any measurements within the cell nucleus. The methods will facilitate the rapid screening of compounds in an automated process.
  • assays with which the methods may be used include, but are not limited to, those as described in U.S. Pat. Nos. 5,891,646 and 6,110,693, and U.S. application Ser. No. 09/993,844, filed Nov. 5, 2001, the disclosures of which are hereby incorporated by reference in their entirety.
  • assays with which the methods may be used include, but are not limited to, assays using Fluorescent Resonance Energy Transfer (FRET) and assays using Bioluminescence Resonance Energy Transfer (BRET) technology as described in Angers, S., Salahpour, A., Joly, E., Hilairet, S., Chelsky, “ ⁇ 2-adrenergic receptor dimerization in living cells using bioluminescence resonance energy transfer (BRET),” Proc. Nat'l. Acad. Sci. USA 97, 7: 3684-3689.
  • FRET Fluorescent Resonance Energy Transfer
  • BRET Bioluminescence Resonance Energy Transfer
  • G protein-coupled receptor kinases phosphorylate intracellular domains of GPCRs, for example, at the carboxyl-terminal tail.
  • the carboxyl-terminal tail of many GPCRs begins shortly after the conserved NPXXY motif that marks the end of the seventh transmembrane domain (i.e. what follows the NPXXY motif is the carboxyl-terminal tail of the GPCR).
  • the carboxyl-terminal tail may be relatively long (approximately tens to hundreds of amino acids), relatively short (approximately tens of amino acids), or virtually non-existent (less than approximately ten amino acids).
  • “carboxyl-terminal tail” shall mean all three variants (whether relatively long, relatively short, or virtually non-existent).
  • an arrestin protein associates with the GRK-phosphorylated receptor and uncouples the receptor from its cognate G protein.
  • the term “arrestin” refers to all types of naturally occurring and engineered variants of arrestin, including, but not limited to, visual arrestin (sometimes referred to as Arrestin 1), ⁇ 3-arrestin 1 (sometimes referred to as Arrestin 2), and ⁇ -arrestin 2 (sometimes referred to as Arrestin 3).
  • the interaction of the arrestin with the phosphorylated GPCR terminates GPCR signaling and produces a non-signaling, desensitized receptor.
  • the arrestin bound to the desensitized GPCR targets the GPCR to clathrin-coated pits for endocytosis.
  • the stability of the interaction of arrestin with the GPCR may dictate the rate of GPCR dephosphorylation, recycling, and resensitization.
  • the GPCR/arrestin complex remains intact and is internalized into endosomes.
  • an in vivo or in vitro environment may be utilized.
  • a conjugate of an arrestin protein and a detectable molecule is utilized.
  • detectable molecule means any molecule capable of detection by spectroscopic, photochemical, biochemical, immunochemical, electrical, radioactive, and optical means, including but not limited to, fluorescence, phosphorescence, and bioluminescence and radioactive decay.
  • Detectable molecules include, but are not limited to, GFP, luciferase, ⁇ 3-galactosidase, rhodamine-conjugated antibody, and the like.
  • Detectable molecules include radioisotopes, epitope tags, affinity labels, enzymes, fluorescent groups, chemiluminescent groups, and the like. Detectable molecules include molecules which are directly or indirectly detected as a function of their interaction with other molecule(s).
  • GFP includes various naturally occurring forms of GFP that may be isolated from natural sources or genetically engineered, as well as artificially modified GFPs.
  • GFPs are well known in the art. See, for example, U.S. Pat. Nos. 5,625,048; 5,777,079; and 6,066,476. It is well understood in the art that GFP is readily interchangeable with other fluorescent proteins, isolated from natural sources or genetically engineered, including, but not limited to, yellow fluorescent proteins (YFP), red fluorescent proteins (RFP), cyan fluorescent proteins (CFP), UV excitable fluorescent proteins, or any wave-length in between.
  • YFP yellow fluorescent proteins
  • RFP red fluorescent proteins
  • CFP cyan fluorescent proteins
  • UV excitable fluorescent proteins or any wave-length in between.
  • the methods are designed to detect changes in the location of the conjugate of an arrestin protein and a detectable molecule after exposure of the cells to test compounds, test solutions, and test conditions.
  • one or more cells that express a GPCR and that contain a conjugate of an arrestin protein and a detectable molecule are provided.
  • Arrestin coupled to a detectable molecule may be detected and monitored.
  • the location of the arrestin may be detected, for example, evenly distributed in the cell cytoplasm, concentrated at a cell membrane, and/or localized in endocytic vesicles.
  • the proximity of arrestin to a GPCR may be monitored, as well as the proximity to any other cell structure.
  • arrestin may be detected in proximity to GPCRs at a cell membrane and/or colocalized with a GPCR in endocytic vesicles.
  • a substrate having deposited thereon one or more GPCRs having arrestin binding sites and agonist binding sites is provided, and a buffered solution comprising one or more conjugates of an arrestin protein and a detectable molecule is provided.
  • the GPCR can be positioned on the substrate such that the arrestin binding sites are exposed to the arrestin and the agonist binding sites are accessible to agonists.
  • the GPCR and arrestin may be obtained from whole cells and used in the in vitro assay after purification.
  • the GPCR has arrestin binding sites and agonist binding sites and may be supported in a multilayer or bilayer lipid vesicle.
  • the vesicle supporting the GPCR is deposited on the substrate, and the GPCR is supported in the lipid vesicle and deposited on the substrate such that the arrestin binding sites are exposed to arrestin and the receptor binding sites are accessible to agonists.
  • the substrate may be any artificial substrate on which the modified GPCR may be deposited, including but not limited to, glass, plastic, diamond, ceramic, semiconductor, silica, fiber optic, biocompatible monomer, biocompatible polymer, polymer beads (including organic and inorganic polymers), and the like.
  • the location of the arrestin may be detected and monitored in the in vitro environment.
  • the redistribution of arrestin may be detected.
  • arrestin in response to agonist stimulation, arrestin may be detected in proximity to GPCRs on the substrate, arrestin may be detected to compartmentalize, and the like.
  • the method may be utilized with any membrane receptor protein in which agonist binding is linked to association of arrestin proteins.
  • An illustrative, non-limiting list of known GPCRs with which the present invention may be used is contained in Table 1.
  • the receptors are grouped according to classical divisions based on structural similarities and ligands.
  • GPCRs that may be used in the present invention include known GPCRs, unknown or orphan GPCRs, and chimeric or modified GPCRs.
  • a GPCR is considered to be an “unknown or orphan GPCR” if its function and/or ligands are unknown.
  • Modified GPCRs include GPCRs that have one or more modifications in the carboxyl-terminal tail, modifications in the intracellular loop(s), and/or in the cytoplasmic end of the transmembrane region, preferably in the carboxyl-terminal tail.
  • GPCRs for known receptors have been identified: Class A receptors, Class B receptors, and receptors with virtually non-existent carboxyl-terminal tails.
  • the receptors are classified accordingly based on their interactions with and affinity for rat ⁇ 3-arrestin-2 in HEK-293 cells and may be predicted based on the amino acid residues in their carboxyl-terminal tail and the length of their carboxyl-terminal tail.
  • a Class B receptor is a GPCR that has one or more sites of phosphorylation, preferably clusters of phosphorylation sites, properly positioned in its carboxyl-terminal tail such that it does recruit rat ⁇ -arrestin-2 to endosomes in HEK-293 cells under conditions as described in U.S. Pat. No. 5,891,646 and Oakley, et al. “Differential Affinities of Visual Arrestin, ⁇ Arrestin1, and ⁇ Arrestin2 for G Protein-coupled Receptors Delineate Two Major Classes of Receptors,” Journal of Biological Chemistry, Vol 275, No. 22, pp 17201-17210, Jun. 2, 2000, the contents of which are hereby incorporated by reference in their entirety.
  • a Class A receptor is a GPCR that does not have one or more sites of phosphorylation, preferably clusters of phosphorylation sites, properly positioned in its carboxyl-terminal tail such that it does not recruit rat ⁇ -arrestin-2 to endosomes in HEK-293 cells under conditions as described above for Class B receptors.
  • Receptors with virtually non-existent carboxyl-terminal tails include, for example, olfactory and taste receptors.
  • Table 2 is an illustrative, non-limiting list of known receptors, including the amino acid sequence for their carboxyl terminal tails and appropriate classification.
  • Class B receptor examples the residues that may function as clusters of phosphorylation sites are shown in bolded italics.
  • modified GPCRs are preferred.
  • the modified GPCRs include GPCRs that have been modified to have one or more sites of phosphorylation, preferably clusters of phosphorylation sites, properly positioned in its carboxyl-terminal tail. These clusters of phosphorylation sites are preferably serine and threonine residues located in the carboxyl-terminal tail of the GPCR. These clusters are remarkably conserved in their position within the carboxyl-terminal tail domain and serve as primary sites of agonist-dependent phosphorylation.
  • the clusters of amino acids may occupy two out of two, two out of three, three out of three, three out of four, four out of four, four out of five, five out of five, and the like consecutive amino acid positions. Accordingly, the clusters of amino acids that promote formation of a stable GPCR/arrestin complex are “clusters of phosphorylation sites.”
  • the modified GPCRs containing one or more sites of phosphorylation, preferably clusters of phosphorylation sites, properly positioned in its carboxyl-terminal tail have an increased affinity for arrestin and colocalize with arrestin in endosomes after stimulation with agonist. These modified GPCRs recruit arrestin to endosomes within approximately 30 minutes of agonist stimulation.
  • the one or more sites of phosphorylation, preferably clusters of phosphorylation sites must be optimally positioned within the GPCR tail for the GPCR to have an increased affinity for arrestin.
  • the modified GPCRs may be constructed such that the one or more sites of phosphorylation, preferably clusters of phosphorylation sites, are optimally positioned within the carboxyl-terminal tail.
  • the portions of polypeptides, which are to be fused together to form the modified GPCR are chosen such that the one or more sites of phosphorylation, preferably clusters of phosphorylation sites, are reliably positioned properly within the carboxyl-terminal tail.
  • the location of discrete point mutations to create the modified GPCR may be chosen so that the one or more sites of phosphorylation, preferably clusters of phosphorylation sites, are properly positioned within the carboxyl-terminal tail.
  • Cells useful in the present invention include eukaryotic and prokaryotic cells, including, but not limited to, bacterial cells, yeast cells, fungal cells, insect cells, nematode cells, plant cells, and animal cells.
  • Suitable animal cells include, but are not limited to, HEK cells, HeLa cells, COS cells, U208 cells, and various primary mammalian cells.
  • An animal model expressing a conjugate of an arrestin and a detectable molecule throughout its tissues or within a particular organ or tissue type, may be useful in studying cellular targets of known or unknown GPCR ligands.
  • Cells useful in the present invention include those that express a known GPCR, a variety of known GPCRs, an unknown GPCRs, a variety of unknown GPCRs, a modified GPCR, a variety of modified GPCRs, and combinations thereof.
  • a cell that expresses a GPCR is one that contains the GPCR as a functional receptor in its cell membrane.
  • the cells may naturally express the GPCRs or may be genetically engineered to express the GPCRs. As one skilled in the art readily would understand, the cells may be genetically engineered to express GPCRs by molecular biological techniques standard in the genetic engineering art.
  • a conjugate of an arrestin protein and a detectable molecule is utilized.
  • All forms of arrestin both naturally occurring and engineered variants, including but not limited to, visual arrestin, ⁇ -arrestin 1 and ⁇ -arrestin 2, may be used in the present invention.
  • the GPCRs of the present invention having enhanced affinity motifs in their carboxyl-terminal tails (naturally-occurring and modified) may interact to a detectable level with all forms of arrestin.
  • Detectable molecules that may be used to conjugate with the arrestin include, but are not limited to, molecules that are detectable by spectroscopic, photochemical, radioactivity, biochemical, immunochemical, electrical, and optical means, including but not limited to, bioluminescence, phosphorescence, and fluorescence. These detectable molecules should be biologically compatible molecules and should not compromise the ability of the arrestin to interact with the GPCR system, and the interaction of the arrestin with the GPCR system must not compromise the ability of the detectable molecule to be detected.
  • Preferred detectable molecules are optically detectable molecules, including optically detectable proteins, such that they may be excited chemically, mechanically, electrically, or radioactively to emit fluorescence, phosphorescence, or bioluminescence.
  • Optically detectable molecules include, for example, beta-galactosidase, firefly luciferase, bacterial luciferase, fluorescein, Texas Red, and rhodamine-conjugated antibody. More preferred detectable molecules are inherently fluorescent molecules, such as fluorescent proteins, including, for example, Green Fluorescent Protein (GFP).
  • GFP Green Fluorescent Protein
  • the detectable molecule may be conjugated to the arrestin protein by methods as described in Barak et al. (U.S. Pat. Nos. 5,891,646 and 6,110,693).
  • the detectable molecule may be conjugated to the arrestin at the front-end, at the back-end, or in the middle.
  • the detectable molecules are molecules that are capable of being synthesized in the cell.
  • the cell can be transfected with DNA so that the conjugate of arrestin and a detectable molecule is produced within the cell.
  • cells may be genetically engineered to express the conjugate of arrestin and a detectable molecule by molecular biological techniques standard in the genetic engineering art.
  • the methods of detection can be used to determine the distribution and/or location of the detectable molecules conjugated to the arrestin protein.
  • the methods of detection may vary depending on the detectable molecule or molecules used.
  • the methods of detection may be used to determine the intracellular location of the arrestin protein or interaction of the arrestin protein with a GPCR, for example, the concentration of arrestin at a cell membrane or the colocalization of arrestin protein with GPCR in an endocytic vesicle.
  • GPCR for example, the concentration of arrestin at a cell membrane or the colocalization of arrestin protein with GPCR in an endocytic vesicle.
  • One skilled in the art will readily be able to devise detection methods suitable for the detectable molecule or molecules used.
  • the detectable molecules emit, reflect, and/or absorb energy depending on the detectable molecule used.
  • the term “emit” is used in this specification, but should be interpreted to include “reflect” and “absorb” unless stated otherwise.
  • the detector and method of detection used should be suitable for recognizing and recording the type of energy emitted.
  • the detector utilized may image the cell point by point in series or in parallel, for example, using a single photodetector or a charge-coupled device array. Such configurations of detectors are known to the art.
  • the detection methods may include using a detector for measuring the intensity of the energy emitted from the detectable molecules and may be operatively coupled to a computer controller for controlling the operation of the detector and performing an analysis of the signals received.
  • the controller preferably includes a computer program product for performing analysis of the signals received from the detectors.
  • the computer program product may be written specifically for use with the detection method or may be a commercially available program modified for use with the detection method.
  • any optical method may be used where fluorescence, bioluminescence, or phosphorescence may be measured and recorded.
  • one or more photodetectors for measuring fluorescence may be used and these photodetectors may be operatively coupled to a computer controller.
  • a charge-coupled device array may also be used and may be operatively coupled to a computer controller.
  • arrestin may be conjugated to GFP and the arrestin-GFP conjugate may be viewed by confocal microscopy.
  • FIG. 1 is a flow diagram of a method of detecting receptor activity in accordance with one aspect of the invention.
  • arrestin coupled to a detectable molecule may be detected evenly distributed in the cell cytoplasm.
  • the detectable molecules emit energy, from which a first image may be generated.
  • the cells are scanned according to the detection method utilized, and an image of the cells is generated.
  • the image of the cells before treatment with an agonist will show the detectable molecules to be fairly evenly distributed in the cell cytoplasm.
  • the intensity of energy emitted from the detectable molecules may be measured, converted to a digital format, and represented as pixels.
  • the image may be mapped according to the position and intensity of each pixel.
  • the pixels at a given intensity may be quantified and a mean intensity for the pixels may be calculated.
  • the digitized image may be redisplayed on a video display.
  • the cells are again scanned according to the detection method utilized, and a second image of the cells is generated.
  • the second image of the cells can be converted to a digital image and analyzed as before.
  • the sensitivity of the detector may be reduced in a number of ways, such as by using energy inhibiting filters at the detector or reducing the gain associated with the detector.
  • the detectable molecules may be concentrated in specific, smaller areas instead of evenly distributed over the whole area of the cell cytoplasm. If the test compound is not an agonist, then the distribution of detectable molecules would be substantially unchanged.
  • arrestin may be detected in proximity to GPCRs at a cell membrane and/or colocalized with a GPCR in endocytic vesicles. Since the detectable molecules are concentrated in smaller areas, the energy from the detectable molecules will be concentrated and of a significantly increased intensity. The apparent increase in intensity is due to a redistribution of the detectable molecules into smaller areas, and is not due to an inherent change in the intensity of the energy produced by each detectable molecule.
  • the energy from detectable molecules concentrated in vesicles may be used to readily indicate activation of the GPCR pathway; therefore, positive and ready identification of these concentrations of detectable molecules is desirable.
  • the detectable molecules evenly distributed in the cell cytoplasm give uniform, dilute energy emissions.
  • the detectable molecules concentrated in endocytic vesicles give more intense energy emissions.
  • FIG. 2 is a flow diagram of a method of detecting receptor activity in accordance with another aspect of the invention.
  • a mean intensity can be obtained, and from this mean intensity, a threshold intensity can be set.
  • the threshold intensity can be set such that it excludes energy emissions from detectable molecules evenly distributed in the cell cytoplasm (i.e., background emissions), but not energy emissions from detectable molecules colocalized in, for example, endocytic vesicles (i.e., target emissions).
  • the threshold intensity may be, for example, the mean intensity of all energy emissions in a control cell (i.e., a cell not treated with an agonist) plus a determined number of standard deviations, such as two standard deviations (95th percentile) or three standard deviations (>99th percentile).
  • the method of determining the threshold intensity is not controlling as long as the threshold is set to exclude as much of the background emissions as possible while permitting the detection of as much of the target emissions as possible.
  • the first image may be taken of a control group of cells rather than the group of cells that are treated with the test compound. For example, once it is determined how much conjugated protein a particular cell line expresses, this information can be used to determine the mean intensity for the cell line. The mean intensity for the cell line can be used to set the threshold intensity in subsequent experiments.
  • the energy emissions above the threshold intensity can be identified and quantified.
  • the identified energy emissions may be tagged using a computer memory or the identified energy emissions may be marked in a computer generated image by changing the associated pixels to a unique color, for example, magenta.
  • the computer generated image may be redisplayed on a video display after identifying (for example, by magenta) the portions of the image which have energy emissions at or above the threshold intensity.
  • the pixels corresponding to energy emissions at or above the threshold intensity may be quantified by absolute number (i.e. they may be counted), as a percentage of the total number of pixels, or, preferably, as a weighted sum of pixels above the threshold intensity.
  • the weights may be assigned in a variety of ways. For example, each pixel above the threshold intensity may be weighted according to its respective intensity value.
  • the number of energy emissions above the threshold intensity may be used to determine whether and to what degree GPCRs have been activated. For example, a large number of energy emissions above the threshold may indicate activation.
  • the number of energy emissions above the threshold intensity may also be used to determine whether and to what degree GPCRs have been deactivated. For example, very few energy emissions above the threshold may indicate deactivation.
  • the number of energy emissions above the threshold intensity may be used to indicate activation in a variety of ways. For example, to indicate activation, a number or a percentage of energy emissions above the threshold may be set. If this set number or percentage is exceeded, it may be determined that the GPCR pathway has been activated. Further, the number of energy emissions above the threshold in the control (i.e., untreated) cells and treated cells may be compared and a number by which the treated cells' emissions exceed the control cells' emissions may be set. If this set number is exceeded, it may be determined that the GPCR pathway has been activated.
  • one or more cells that express a GPCR and that contain a conjugate of an arrestin protein and a detectable molecule are provided.
  • the cells are scanned according to the method of detection to generate an image of the cells based on the relative intensity of energy emissions from the detectable molecules.
  • the image may be digitized and the relative intensity of energy emissions may be converted to pixel intensity values.
  • activation or deactivation of the GPCR pathway may be detected. For example, a considerable amount of energy above a calculated threshold intensity may indicate activation of the GPCR pathway. Likewise, a significant decrease in the amount of energy above a calculated threshold intensity may indicate deactivation of the GPCR pathway.
  • a mean intensity of the first image can be calculated, either directly from the first image or by analyzing the first array of pixels.
  • a threshold intensity may be set to exclude energy emissions from detectable molecules evenly distributed in the cell cytoplasm but not energy emissions from detectable molecules in endocytic vesicles, for example, at two or three standard deviations above the mean intensity of the energy emissions in the first image (before exposure to the test compound or solution).
  • the energy emissions above this threshold intensity may be identified and quantified.
  • the associated pixels may be tagged using a computer memory or the pixels may be changed in a computer generated image to a unique color, for example, magenta.
  • the image may be redisplayed on a video display after identifying (for example, by magenta) those pixels which are above the threshold intensity.
  • the pixels above the threshold intensity may be quantified as a weighted sum.
  • a comparison of the number of pixels above the threshold before and after exposure to the test compound or solution may be used to determine if the test compound or solution is or contains an agonist. If, for example, the test compound or solution is or contains an agonist, the number of pixels above the threshold after exposure to the agonist may dramatically increase.
  • the automated methods of the present invention may also be used to screen test compounds and test solutions for GPCR antagonist activity.
  • One or more cells that express a GPCR and that contain a conjugate of an arrestin protein and a detectable molecule are provided.
  • the cells are scanned according to the method of detection to generate a first image of the cells.
  • the cells are exposed to a test compound or test solution and then to a known agonist.
  • the cells are scanned again according to the method of detection to generate a second image of the cells.
  • the first and second images may be captured as or converted to first and second sets of pixels.
  • the intensity of the first and second sets of pixels may be measured. As discussed above, the intensity of the first and second sets of pixels can be used to determine whether the GPCR pathway has been activated. For example, if the test compound is an antagonist, activation of the GPCR pathway would be blocked.
  • a comparison of the number of signals above the threshold before and after exposure to the test compound or solution and the agonist may be used to determine if the test compound or solution is or contains an antagonist. If, for example, the test compound or solution is or contains an antagonist, then the number of energy emissions above the threshold before and after exposure to the agonist and test compound or solution may remain fairly constant instead of increasing as expected due to the agonist.
  • Agonist mediated translocation of the ⁇ arr-GFP chimera from cell cytosol to endocytic vesicles was studied using a double stable cell line (stable for the ⁇ arr-GFP and the V2R), for example, HEK-293 cells or COS cells. These cells were transfected with plasmids containing cDNA for the V2R receptor and for the ⁇ arr-GFP conjugate.
  • ⁇ arr-GFP was detected evenly distributed throughout the cytoplasm of cells expressing the V2R as indicated by the homogeneous ⁇ arr-GFP fluorescence in FIG. 3 a .
  • Addition of arginine vasopressin (AVP, obtained from Sigma Chemicals, St. Louis, Mo.) promoted rapid redistribution of ⁇ arr-GFP from the cytoplasm to the receptor at the plasma membrane.
  • a more prolonged exposure to the agonist i.e., after 30 min.
  • ⁇ arr-GFP redistributed to endocytic vesicles (FIG. 3 b ).
  • FIGS. 3 a and 3 b were taken at standard sensitivity and the intense energy emitted from detectable molecules localized in endocytic vesicles saturated the detector (i.e., when attempting to plot the intensities of the emissions captured as pixels, the intensities were off the scale).
  • FIGS. 4 a and 4 b are identical to FIGS. 3 a and 3 b , respectively, except that they were taken at a reduced sensitivity to prevent saturation of the detector by ⁇ arr-GFP colocalized in endocytic vesicles.
  • FIGS. 4 a and 4 b demonstrate that concentration of ⁇ arr-GFP in endocytic vesicles produces spots of fluorescent intensity much greater than the fluorescent intensity observed in the cytoplasm of the control cells.
  • the threshold intensity was calculated as the mean cell intensity plus three standard deviations (>99th percentile). Pixels with intensities above the threshold were indicated in a magenta color in both the control and treated images (FIGS. 5A and 5 b , respectively).
  • the control cells had very few magenta-colored pixels.
  • the cells treated with agonist had many magenta-colored pixels.
  • the magenta-colored pixels in the treated cells of FIG. 5 b closely correspond to the ⁇ arr-GFP containing endocytic vesicles in FIG. 4 b.
  • FIG. 6 graphs the pixels in both the control cells and treated cells that are above the threshold.
  • the first curve labeled Control Cell
  • the second curve labeled Vesicles
  • the threshold was set at the mean cell intensity of the control cells plus three standard deviations (>99th percentile).
  • FIG. 7 is a graph of the number of pixels above the threshold intensity for the control and treated cells.
  • the number of pixels above the threshold in the treated cells is approximately 120 times that of the control cells. This data readily may be used to indicate that an agonist was added and the ⁇ arr-GFP translocated to endocytic vesicles.
  • alpha-2B-adrenergic receptor human.
  • ACCESSION A37223 npviytifnqdfrrafrrilcrpwtqtaw
  • alpha-2C-adrenergic receptor human.
  • beta-1-adrenergic receptor Homo sapiens.
  • dopamine receptor D1 [Homo sapiens]. ACCESSION NP — 000785 npiiyafnadfrkafstllgcyrlcpatnnaietvsinnngaamfsshheprgsiskecnlvyliphavgssedlkkeeaagiarple klspalsvildydtdvslekiqpitqngqhpt
  • muscarinic acetylcholine receptor M2 [Homo sapiens]. ACCESSION NP — 000730 npacyalcnaffkkffkhllmchyknigatr
  • muscarinic acetylcholine receptor M4 [Homo sapiens]. ACCESSION NP — 000732 npacyalcnaffkkffrhlllcqyrnigtar
  • angiotensin receptor 1 [Homo sapiens].
  • cx3c chemokine receptor 1 (cx3cr1) (fractalkine receptor) ACCESSION P49238 npliyafagekfrrylyhlygkclavlcgrsvhvdfsssesqrsrhgsvlssnftyhtsdgdallil
  • SUBSTANCE-P RECEPTOR SPR
  • NK-1 RECEPTOR NK-1 RECEPTOR
  • vasopressin receptor type 2 [Homo sapiens].
  • thyrotropin-releasing hormone receptor human. ACCESSION JN0708 npviynlmsqkfraafrklcnckqkptekpanysvalnysvikesdhfsteldditvtdtylsatkvsfddtclasevsfsqs
  • neuromedin U receptor 1 [Homo sapiens]. ACCESSION AAG24793 npvlyslmssrfretfqealclgacchrlrprhsshslsrmttgstlcdvgslgswvhplagndgpeaqqetdps
  • VPR vasopressive intestinal peptide receptor

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Biotechnology (AREA)
  • Hematology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Genetics & Genomics (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Organic Chemistry (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Toxicology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
US10/095,620 2001-03-13 2002-03-12 Automated methods of detecting receptor activity Abandoned US20030013137A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
US10/095,620 US20030013137A1 (en) 2001-03-13 2002-03-12 Automated methods of detecting receptor activity
JP2002572410A JP2004532978A (ja) 2001-03-13 2002-03-13 受容体活性を検出する自動化された方法
AU2002248597A AU2002248597B2 (en) 2001-03-13 2002-03-13 Automated methods of detecting receptor activity
PCT/US2002/007434 WO2002073199A1 (en) 2001-03-13 2002-03-13 Automated methods of detecting receptor activity
EP02717608A EP1386154A4 (en) 2001-03-13 2002-03-13 Automated methods of detecting receptor activity
CA002440683A CA2440683A1 (en) 2001-03-13 2002-03-13 Automated methods of detecting receptor activity
US10/629,176 US20040029190A1 (en) 2001-03-13 2003-07-29 Automated methods of detecting receptor activity
US11/084,928 US7455982B2 (en) 2001-03-13 2005-03-21 Automated methods of detecting receptor activity

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US27533901P 2001-03-13 2001-03-13
US10/095,620 US20030013137A1 (en) 2001-03-13 2002-03-12 Automated methods of detecting receptor activity

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US10/629,176 Division US20040029190A1 (en) 2001-03-13 2003-07-29 Automated methods of detecting receptor activity

Publications (1)

Publication Number Publication Date
US20030013137A1 true US20030013137A1 (en) 2003-01-16

Family

ID=26790404

Family Applications (3)

Application Number Title Priority Date Filing Date
US10/095,620 Abandoned US20030013137A1 (en) 2001-03-13 2002-03-12 Automated methods of detecting receptor activity
US10/629,176 Abandoned US20040029190A1 (en) 2001-03-13 2003-07-29 Automated methods of detecting receptor activity
US11/084,928 Expired - Fee Related US7455982B2 (en) 2001-03-13 2005-03-21 Automated methods of detecting receptor activity

Family Applications After (2)

Application Number Title Priority Date Filing Date
US10/629,176 Abandoned US20040029190A1 (en) 2001-03-13 2003-07-29 Automated methods of detecting receptor activity
US11/084,928 Expired - Fee Related US7455982B2 (en) 2001-03-13 2005-03-21 Automated methods of detecting receptor activity

Country Status (6)

Country Link
US (3) US20030013137A1 (https=)
EP (1) EP1386154A4 (https=)
JP (1) JP2004532978A (https=)
AU (1) AU2002248597B2 (https=)
CA (1) CA2440683A1 (https=)
WO (1) WO2002073199A1 (https=)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030040080A1 (en) * 2001-08-16 2003-02-27 Gero Miesenbock Bio-synthetic photostimulators and methods of use
US20040091946A1 (en) * 2000-11-03 2004-05-13 Oakley Robert H. Methods of screening compositions for G protein -coupled receptor desensitization inhibitory activity
US20050009111A1 (en) * 2002-10-25 2005-01-13 Loomis Carson R. Methods of identifying reduced internalization transmembrane receptor agonists
US20050032125A1 (en) * 2002-05-13 2005-02-10 Norak Biosciences, Inc. Constitutively translocating cell line
US20050100934A1 (en) * 2003-07-09 2005-05-12 Lee Kevin J. Method for assaying protein-protein interaction
US20050136431A1 (en) * 2000-11-03 2005-06-23 Oakley Robert H. Methods of screening compositions for G protein-coupled receptor desensitization inhibitory activity
US20060173630A1 (en) * 2004-12-09 2006-08-03 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US20090082410A1 (en) * 2002-05-13 2009-03-26 Molecular Devices Corporation Constitutively translocating cell line
US20160123919A1 (en) * 2013-04-25 2016-05-05 The Trustees Of The University Of Pennsylvania Opioid detection based on high quality graphene transistor arrays and a synthetic mu receptor

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP4969002B2 (ja) 1999-06-08 2012-07-04 ユニバーシテイ・オブ・アイオワ・リサーチ・フアウンデーシヨン rAAV形質導入を増加するための化合物および方法
AU2004227358B8 (en) * 2003-03-31 2009-12-10 Targeted Genetics Corporation Compounds and methods to enhance rAAV transduction
JP2007006830A (ja) * 2005-07-01 2007-01-18 Olympus Corp 細胞内の顆粒状構造物の測定方法
WO2007127464A2 (en) * 2006-04-28 2007-11-08 University Of Iowa Research Foundation Methods and compounds to modulate parvovirus transduction of mammalian cells or to alter virus infection, method to identify a viral receptor or co-receptor
CN101063657A (zh) * 2006-04-29 2007-10-31 中国科学院上海生命科学研究院 在活体细胞中筛选配体与受体结合的方法和系统
CN102460150B (zh) 2009-04-20 2015-05-20 新加坡科技研究局 囊泡系统及其用途
US9096889B2 (en) 2011-11-23 2015-08-04 Promega Corporation Compositions and methods for monitoring transmembrane trafficking
WO2017139381A1 (en) 2016-02-08 2017-08-17 University Of Iowa Research Foundation Methods to produce chimeric adeno-associated virus/bocavirus parvovirus
CA3016985C (en) 2016-03-07 2023-07-04 University Of Iowa Research Foundation Aav-mediated expression using a synthetic promoter and enhancer
WO2017205739A1 (en) 2016-05-26 2017-11-30 University Of Iowa Research Foundation cis AND trans REQUIREMENTS FOR TERMINAL RESOLUTION OF HUMAN BOCAVIRUS 1
US11142775B2 (en) 2017-01-13 2021-10-12 University Of Iowa Research Foundation Bocaparvovirus small noncoding RNA and uses thereof

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5548661A (en) * 1991-07-12 1996-08-20 Price; Jeffrey H. Operator independent image cytometer
US5705335A (en) * 1993-11-26 1998-01-06 Hendry; Lawrence B. Design of drugs involving receptor-ligand-DNA interactions
US5770176A (en) * 1995-12-08 1998-06-23 Chiron Diagnostics Corporation Assays for functional nuclear receptors
US5854004A (en) * 1991-11-25 1998-12-29 Boehringer Ingleheim Gmbh Process for screening substances capable of modulating a receptor-dependent cellular signal transmission path
US5864488A (en) * 1994-02-24 1999-01-26 University Court Of The University Of Glasgow Three dimensional glycoprotein hormone structure representation using a computer
US5874219A (en) * 1995-06-07 1999-02-23 Affymetrix, Inc. Methods for concurrently processing multiple biological chip assays
US5891646A (en) * 1997-06-05 1999-04-06 Duke University Methods of assaying receptor activity and constructs useful in such methods
US5919646A (en) * 1996-08-02 1999-07-06 Axiom Biotechnologies, Inc. Apparatus and method for real-time measurement of cellular response
US5972629A (en) * 1984-08-17 1999-10-26 The Scripps Research Institute Method for characterizing antigenic reactivity of biological sample
US5972639A (en) * 1997-07-24 1999-10-26 Irori Fluorescence-based assays for measuring cell proliferation
US5987390A (en) * 1997-10-28 1999-11-16 Smithkline Beecham Corporation Methods and systems for identification of protein classes
US5989835A (en) * 1997-02-27 1999-11-23 Cellomics, Inc. System for cell-based screening
US6017496A (en) * 1995-06-07 2000-01-25 Irori Matrices with memories and uses thereof
US6025129A (en) * 1995-04-25 2000-02-15 Irori Remotely programmable matrices with memories and uses thereof
US6027890A (en) * 1996-01-23 2000-02-22 Rapigene, Inc. Methods and compositions for enhancing sensitivity in the analysis of biological-based assays
US6067114A (en) * 1996-03-05 2000-05-23 Eastman Kodak Company Detecting compositional change in image
US6100026A (en) * 1995-04-25 2000-08-08 Irori Matrices with memories and uses thereof
US6124102A (en) * 1989-06-07 2000-09-26 Affymetrix, Inc. Methods for determining receptor-ligand binding using probe arrays
US6127133A (en) * 1991-12-20 2000-10-03 Sibia Neurosciences, Inc. Automated analysis equipment and assay method for detecting cell surface protein function using same
US6199017B1 (en) * 1995-03-17 2001-03-06 Kureha Kagaku Kogyo Kabushiki Kaisha Biochemical information processing apparatus, biochemical information processing method, and biochemical information recording medium
US6203987B1 (en) * 1998-10-27 2001-03-20 Rosetta Inpharmatics, Inc. Methods for using co-regulated genesets to enhance detection and classification of gene expression patterns
US6219622B1 (en) * 1995-03-24 2001-04-17 University Of Guelph Computational method for designing chemical structures having common functional characteristics
US6221612B1 (en) * 1997-08-01 2001-04-24 Aurora Biosciences Corporation Photon reducing agents for use in fluorescence assays
US6221600B1 (en) * 1999-10-08 2001-04-24 Board Of Regents, The University Of Texas System Combinatorial oligonucleotide PCR: a method for rapid, global expression analysis

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4219335A (en) * 1978-09-18 1980-08-26 E. I. Du Pont De Nemours And Company Immunochemical testing using tagged reagents
US4324633A (en) * 1980-10-20 1982-04-13 Lovejoy Curtis N Electrolytic apparatus for treating continuous strip material
US4908773A (en) * 1987-04-06 1990-03-13 Genex Corporation Computer designed stabilized proteins and method for producing same
US5324633A (en) * 1991-11-22 1994-06-28 Affymax Technologies N.V. Method and apparatus for measuring binding affinity
US5912122A (en) * 1993-06-04 1999-06-15 Sibia Neurosciences, Inc. Nucleic acids encoding and method for detecting nucleic acid encoding human metabotropic glutamate receptor subtype mGluR6
US5521705A (en) * 1994-05-12 1996-05-28 Oldenbourg; Rudolf Polarized light microscopy
US5463564A (en) * 1994-09-16 1995-10-31 3-Dimensional Pharmaceuticals, Inc. System and method of automatically generating chemical compounds with desired properties
WO2000003246A2 (en) * 1998-07-13 2000-01-20 Cellomics, Inc. A system for cell-based screening

Patent Citations (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5972629A (en) * 1984-08-17 1999-10-26 The Scripps Research Institute Method for characterizing antigenic reactivity of biological sample
US6124102A (en) * 1989-06-07 2000-09-26 Affymetrix, Inc. Methods for determining receptor-ligand binding using probe arrays
US5548661A (en) * 1991-07-12 1996-08-20 Price; Jeffrey H. Operator independent image cytometer
US5854004A (en) * 1991-11-25 1998-12-29 Boehringer Ingleheim Gmbh Process for screening substances capable of modulating a receptor-dependent cellular signal transmission path
US6127133A (en) * 1991-12-20 2000-10-03 Sibia Neurosciences, Inc. Automated analysis equipment and assay method for detecting cell surface protein function using same
US5705335A (en) * 1993-11-26 1998-01-06 Hendry; Lawrence B. Design of drugs involving receptor-ligand-DNA interactions
US5864488A (en) * 1994-02-24 1999-01-26 University Court Of The University Of Glasgow Three dimensional glycoprotein hormone structure representation using a computer
US6199017B1 (en) * 1995-03-17 2001-03-06 Kureha Kagaku Kogyo Kabushiki Kaisha Biochemical information processing apparatus, biochemical information processing method, and biochemical information recording medium
US6219622B1 (en) * 1995-03-24 2001-04-17 University Of Guelph Computational method for designing chemical structures having common functional characteristics
US6100026A (en) * 1995-04-25 2000-08-08 Irori Matrices with memories and uses thereof
US6025129A (en) * 1995-04-25 2000-02-15 Irori Remotely programmable matrices with memories and uses thereof
US6017496A (en) * 1995-06-07 2000-01-25 Irori Matrices with memories and uses thereof
US5874219A (en) * 1995-06-07 1999-02-23 Affymetrix, Inc. Methods for concurrently processing multiple biological chip assays
US5770176A (en) * 1995-12-08 1998-06-23 Chiron Diagnostics Corporation Assays for functional nuclear receptors
US6027890A (en) * 1996-01-23 2000-02-22 Rapigene, Inc. Methods and compositions for enhancing sensitivity in the analysis of biological-based assays
US6067114A (en) * 1996-03-05 2000-05-23 Eastman Kodak Company Detecting compositional change in image
US5919646A (en) * 1996-08-02 1999-07-06 Axiom Biotechnologies, Inc. Apparatus and method for real-time measurement of cellular response
US5989835A (en) * 1997-02-27 1999-11-23 Cellomics, Inc. System for cell-based screening
US6110693A (en) * 1997-06-05 2000-08-29 Duke University Methods of assaying receptor activity and constructs useful in such methods
US5891646A (en) * 1997-06-05 1999-04-06 Duke University Methods of assaying receptor activity and constructs useful in such methods
US5972639A (en) * 1997-07-24 1999-10-26 Irori Fluorescence-based assays for measuring cell proliferation
US6221612B1 (en) * 1997-08-01 2001-04-24 Aurora Biosciences Corporation Photon reducing agents for use in fluorescence assays
US5987390A (en) * 1997-10-28 1999-11-16 Smithkline Beecham Corporation Methods and systems for identification of protein classes
US6203987B1 (en) * 1998-10-27 2001-03-20 Rosetta Inpharmatics, Inc. Methods for using co-regulated genesets to enhance detection and classification of gene expression patterns
US6221600B1 (en) * 1999-10-08 2001-04-24 Board Of Regents, The University Of Texas System Combinatorial oligonucleotide PCR: a method for rapid, global expression analysis

Cited By (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040091946A1 (en) * 2000-11-03 2004-05-13 Oakley Robert H. Methods of screening compositions for G protein -coupled receptor desensitization inhibitory activity
US20050136431A1 (en) * 2000-11-03 2005-06-23 Oakley Robert H. Methods of screening compositions for G protein-coupled receptor desensitization inhibitory activity
US7163800B2 (en) 2000-11-03 2007-01-16 Molecular Devices Corporation Methods of screening compositions for G protein-coupled receptor desensitization inhibitory activity
US7144733B2 (en) * 2001-08-16 2006-12-05 Sloan-Kettering Institute For Cancer Research Bio-synthetic photostimulators and methods of use
US20030040080A1 (en) * 2001-08-16 2003-02-27 Gero Miesenbock Bio-synthetic photostimulators and methods of use
US20090082410A1 (en) * 2002-05-13 2009-03-26 Molecular Devices Corporation Constitutively translocating cell line
US20050032125A1 (en) * 2002-05-13 2005-02-10 Norak Biosciences, Inc. Constitutively translocating cell line
US20090081652A1 (en) * 2002-05-13 2009-03-26 Molecular Devices Corporation Constitutively Translocating Cell Line
US20060029983A1 (en) * 2002-05-13 2006-02-09 Oakley Robert H Methods of screening compounds for GRK6 modulating activity
US7332292B2 (en) 2002-05-13 2008-02-19 Molecular Devices Corporation Constitutively translocating cell line
US7297503B2 (en) 2002-10-25 2007-11-20 Molecular Devices Corporation Methods of identifying reduced internalization transmembrane receptor agonists
US20050009111A1 (en) * 2002-10-25 2005-01-13 Loomis Carson R. Methods of identifying reduced internalization transmembrane receptor agonists
US8017398B2 (en) 2003-07-09 2011-09-13 Life Technologies Corporation Method for assaying protein-protein interaction
US20060147975A1 (en) * 2003-07-09 2006-07-06 Lee Kevin J Method for assaying protein-protein interaction
US7049076B2 (en) 2003-07-09 2006-05-23 Sentigen Biosciences, Inc. Method for assaying protein—protein interaction
US20050100934A1 (en) * 2003-07-09 2005-05-12 Lee Kevin J. Method for assaying protein-protein interaction
US20110096976A1 (en) * 2004-12-09 2011-04-28 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US20060173630A1 (en) * 2004-12-09 2006-08-03 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US20110096977A1 (en) * 2004-12-09 2011-04-28 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US7818130B2 (en) * 2004-12-09 2010-10-19 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US8121383B2 (en) 2004-12-09 2012-02-21 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US8649981B2 (en) 2004-12-09 2014-02-11 Cellomics, Inc. Automated method and system for setting image analysis parameters to control image analysis operations
US20160123919A1 (en) * 2013-04-25 2016-05-05 The Trustees Of The University Of Pennsylvania Opioid detection based on high quality graphene transistor arrays and a synthetic mu receptor
US10809222B2 (en) * 2013-04-25 2020-10-20 The Trustees Of The University Of Pennsylvania Opioid detection based on high quality graphene transistor arrays and a synthetic mu receptor

Also Published As

Publication number Publication date
JP2004532978A (ja) 2004-10-28
WO2002073199A1 (en) 2002-09-19
US20050181423A1 (en) 2005-08-18
EP1386154A1 (en) 2004-02-04
US20040029190A1 (en) 2004-02-12
CA2440683A1 (en) 2002-09-19
US7455982B2 (en) 2008-11-25
AU2002248597B2 (en) 2008-01-31
EP1386154A4 (en) 2004-09-15

Similar Documents

Publication Publication Date Title
US7455982B2 (en) Automated methods of detecting receptor activity
AU2002248597A1 (en) Automated methods of detecting receptor activity
Kallal et al. Using green fluorescent proteins to study G-protein-coupled receptor localization and trafficking
Eidne et al. Applications of novel resonance energy transfer techniques to study dynamic hormone receptor interactions in living cells
EP2073013B1 (en) Method of identifying transmembrane protein-interacting compounds
Mores et al. Arrestin recruitment and signaling by G protein-coupled receptor heteromers
US6893827B1 (en) Receptor function assay for G-protein coupled receptors and orphan receptors by reporter enzyme mutant complementation
EP1504030B1 (en) Constitutively translocating cell line
Chakraborty et al. Excitements and challenges in GPCR oligomerization: molecular insight from FRET
JP2008514185A (ja) Gタンパク質共役受容体およびそのシグナル伝達経路の断片相補アッセイ
US7163800B2 (en) Methods of screening compositions for G protein-coupled receptor desensitization inhibitory activity
US7541151B2 (en) Single-cell biosensor for the measurement of GPCR ligands in a test sample
US7297503B2 (en) Methods of identifying reduced internalization transmembrane receptor agonists
CN101432624A (zh) 在活体细胞中筛选配体与受体结合的方法和系统
US20050136431A1 (en) Methods of screening compositions for G protein-coupled receptor desensitization inhibitory activity
US20070196865A1 (en) Methods Of Screening Compositions For G Protein-Coupled Receptors Aganist Agonists
Zhang et al. Screening and characterization of G-protein–coupled receptor ligands for drug discovery
Moreno et al. Techniques for the study of GPCR heteromerization in living cells and animal models
JP2004180668A (ja) リガンドの決定方法
HK1128957B (en) Method of identifying transmembrane protein-interacting compounds

Legal Events

Date Code Title Description
AS Assignment

Owner name: DUKE UNIVERSITY, NORTH CAROLINA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BARAK, LARRY S.;OAKLEY, ROBERT H.;REEL/FRAME:013033/0753;SIGNING DATES FROM 20020506 TO 20020510

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION