SE7909514L - Nya halofenyl-pyridyl-allylaminderivat - Google Patents

Nya halofenyl-pyridyl-allylaminderivat

Info

Publication number
SE7909514L
SE7909514L SE7909514A SE7909514A SE7909514L SE 7909514 L SE7909514 L SE 7909514L SE 7909514 A SE7909514 A SE 7909514A SE 7909514 A SE7909514 A SE 7909514A SE 7909514 L SE7909514 L SE 7909514L
Authority
SE
Sweden
Prior art keywords
halophenyl
pyridyl
new
compounds
allylamine derivatives
Prior art date
Application number
SE7909514A
Other languages
English (en)
Swedish (sv)
Inventor
T Hogberg
Paulis T De
S B Ross
C B J Ulff
Original Assignee
Astra Laekemedel Ab
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Astra Laekemedel Ab filed Critical Astra Laekemedel Ab
Priority to SE7909514A priority Critical patent/SE7909514L/xx
Priority to PCT/SE1980/000286 priority patent/WO1981001407A1/en
Priority to ES496859A priority patent/ES8204721A1/es
Priority to GR63358A priority patent/GR72129B/el
Priority to PL1980232731A priority patent/PL129370B1/pl
Priority to EP80850172A priority patent/EP0029420A1/en
Priority to PT72066A priority patent/PT72066B/pt
Priority to US06/232,043 priority patent/US4418065A/en
Priority to PL1980232732A priority patent/PL129369B1/pl
Priority to CA000364712A priority patent/CA1155128A/en
Priority to JP50260380A priority patent/JPS56501524A/ja
Priority to PL1980227849A priority patent/PL128457B1/pl
Priority to NZ195558A priority patent/NZ195558A/en
Priority to ZA00807102A priority patent/ZA807102B/xx
Priority to AU64378/80A priority patent/AU538087B2/en
Priority to EP83200107A priority patent/EP0081478A3/en
Publication of SE7909514L publication Critical patent/SE7909514L/xx
Priority to DK300781A priority patent/DK300781A/da
Priority to FI812196A priority patent/FI812196L/fi
Priority to NO812401A priority patent/NO812401L/no
Priority to SU813306852A priority patent/SU1103794A3/ru
Priority to ES508064A priority patent/ES508064A0/es
Priority to ES508065A priority patent/ES508065A0/es
Priority to ES508063A priority patent/ES8300095A1/es
Priority to ES508062A priority patent/ES508062A0/es
Priority to SU823419749A priority patent/SU1149874A3/ru
Priority to SU823419750A priority patent/SU1149875A3/ru
Priority to SU823530055A priority patent/SU1138021A3/ru

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D213/28—Radicals substituted by singly-bound oxygen or sulphur atoms
    • C07D213/30—Oxygen atoms
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/24—Antidepressants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D213/26—Radicals substituted by halogen atoms or nitro radicals
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D213/36—Radicals substituted by singly-bound nitrogen atoms
    • C07D213/38—Radicals substituted by singly-bound nitrogen atoms having only hydrogen or hydrocarbon radicals attached to the substituent nitrogen atom
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D213/44—Radicals substituted by doubly-bound oxygen, sulfur, or nitrogen atoms, or by two such atoms singly-bound to the same carbon atom
    • C07D213/46—Oxygen atoms
    • C07D213/48—Aldehydo radicals

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Psychiatry (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pain & Pain Management (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pyridine Compounds (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Plural Heterocyclic Compounds (AREA)
SE7909514A 1979-11-16 1979-11-16 Nya halofenyl-pyridyl-allylaminderivat SE7909514L (sv)

Priority Applications (27)

Application Number Priority Date Filing Date Title
SE7909514A SE7909514L (sv) 1979-11-16 1979-11-16 Nya halofenyl-pyridyl-allylaminderivat
GR63358A GR72129B (es) 1979-11-16 1980-11-14
AU64378/80A AU538087B2 (en) 1979-11-16 1980-11-14 Halophenyl-pyridyl - allylamine derivatives
ZA00807102A ZA807102B (en) 1979-11-16 1980-11-14 Novel halophenyl-pyridyl-allylamine derivatives
PL1980232731A PL129370B1 (en) 1979-11-16 1980-11-14 Process for preparing novel derivatives of halophenylpyridylallylamine
EP80850172A EP0029420A1 (en) 1979-11-16 1980-11-14 Novel halophenyl-pyridyl-allylamine derivatives, processes and intermediates as well as pharmaceutical preparations thereof
PT72066A PT72066B (en) 1979-11-16 1980-11-14 Process to prepare novel halophenyl-pyridil-allylamine derivatives and pharmaceutical compositions thereof
US06/232,043 US4418065A (en) 1979-11-16 1980-11-14 Halophenyl-pyridyl-allylamine derivatives and use
ES496859A ES8204721A1 (es) 1979-11-16 1980-11-14 Un procedimiento para preparar derivados de halofenil-piri- dilalilamina
CA000364712A CA1155128A (en) 1979-11-16 1980-11-14 Halophenyl-pyridyl-allylamine derivatives
JP50260380A JPS56501524A (es) 1979-11-16 1980-11-14
PL1980227849A PL128457B1 (en) 1979-11-16 1980-11-14 Process for preparing novel derivatives of halophenylpyridylallylamine
NZ195558A NZ195558A (en) 1979-11-16 1980-11-14 Halophenyl-pyridyl-allylamine derivatives,pharmaceutical compositions,and intermediates
PCT/SE1980/000286 WO1981001407A1 (en) 1979-11-16 1980-11-14 Novel halophenyl-pyridyl-allylamine derivatives
EP83200107A EP0081478A3 (en) 1979-11-16 1980-11-14 Novel halophenyl-pyridyl-allylamine derivatives, processes and intermediates as well as pharmaceutical preparations thereof
PL1980232732A PL129369B1 (en) 1979-11-16 1980-11-14 Process for preparing novel derivatives of halophenylpyridylallylamine
DK300781A DK300781A (da) 1979-11-16 1981-07-07 Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
FI812196A FI812196L (fi) 1979-11-16 1981-07-10 Nya halofenyl-pyridyl-allylaminderivat
NO812401A NO812401L (no) 1979-11-16 1981-07-13 Nye halogenfenyl-pyridyl-allylaminderivater.
SU813306852A SU1103794A3 (ru) 1979-11-16 1981-07-15 Способ получени производных пиридилаллиламина или их солей, или их смеси цис- и транс-изомеров, или индивидуальных изомеров
ES508064A ES508064A0 (es) 1979-11-16 1981-12-16 "un procedimiento para preparar derivados de halofenil-piridil-alilamina".
ES508065A ES508065A0 (es) 1979-11-16 1981-12-16 "un procedimiento para preparar derivados de halofenil-piridil-alilamina".
ES508062A ES508062A0 (es) 1979-11-16 1981-12-16 "un procedimiento para preparar derivados de halofenil-piridil-alilamina".
ES508063A ES8300095A1 (es) 1979-11-16 1981-12-16 "un procedimiento para preparar derivados de halofenil-piridil-alilamina".
SU823419749A SU1149874A3 (en) 1979-11-16 1982-04-13 Method of obtaining derivatives of pyridylallylamine or or their salts with acids, or mixture cis-and trans-isomers
SU823419750A SU1149875A3 (ru) 1979-11-16 1982-04-13 Способ получени производных пиридилаллиламина или их солей с кислотами,или смеси цис- и транс-изомеров,или индивидуальных изомеров
SU823530055A SU1138021A3 (ru) 1979-11-16 1982-12-30 Способ получени производных пиридилаллиламина или их фармацевтически приемлемых солей с кислотами или их смеси цис- и транс-изомеров,или их индивидуальных изомеров

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
SE7909514A SE7909514L (sv) 1979-11-16 1979-11-16 Nya halofenyl-pyridyl-allylaminderivat

Publications (1)

Publication Number Publication Date
SE7909514L true SE7909514L (sv) 1981-05-17

Family

ID=20339337

Family Applications (1)

Application Number Title Priority Date Filing Date
SE7909514A SE7909514L (sv) 1979-11-16 1979-11-16 Nya halofenyl-pyridyl-allylaminderivat

Country Status (17)

Country Link
US (1) US4418065A (es)
EP (2) EP0029420A1 (es)
JP (1) JPS56501524A (es)
AU (1) AU538087B2 (es)
CA (1) CA1155128A (es)
DK (1) DK300781A (es)
ES (5) ES8204721A1 (es)
FI (1) FI812196L (es)
GR (1) GR72129B (es)
NO (1) NO812401L (es)
NZ (1) NZ195558A (es)
PL (3) PL129370B1 (es)
PT (1) PT72066B (es)
SE (1) SE7909514L (es)
SU (4) SU1103794A3 (es)
WO (1) WO1981001407A1 (es)
ZA (1) ZA807102B (es)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1150269A (en) * 1980-11-14 1983-07-19 Carl B. J. Ulff Process for preparing 3-(4-bromophenyl)-3-(3-pyridyl)-allylamines
US4610995A (en) * 1984-07-27 1986-09-09 Coker Geoffrey G Certain 1,1-diaryl-propenyl-3-(1-pyrrolidino-2-carboxylic acids, derivatives thereof and their anti-histaminic properties
GB8814639D0 (en) * 1988-06-20 1988-07-27 Ici Plc Heterocyclic tertiary alcohol derivatives
US6288083B1 (en) 1998-09-04 2001-09-11 Millennium Pharmaceuticals, Inc. Chemokine receptor antagonists and methods of use therefor
US6503926B2 (en) 1998-09-04 2003-01-07 Millennium Pharmaceuticals, Inc. Chemokine receptor antagonists and methods of use therefor
GB0219154D0 (en) * 2002-08-16 2002-09-25 Pfizer Ltd Diaryl compounds
US6800652B2 (en) 2002-08-16 2004-10-05 Pfizer Inc. Diaryl compounds
JP6479834B2 (ja) 2013-11-05 2019-03-06 アストラゼネカ・アクチエボラーグＡｓｔｒａｚｅｎｅｃａ Ａｋｔｉｅｂｏｌａｇ Ｎｍｄａアンタゴニストプロドラッグ

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2676964A (en) * 1950-06-07 1954-04-27 Schering Corp 3-pyridyl propylamine antihistamine substances
DE966534C (de) * 1951-03-22 1957-08-22 Schering Corp Verfahren zur Herstellung von basisch substituierten Pyridinverbindungen
GB850298A (en) 1956-10-30 1960-10-05 Maggioni & C Societa Per Azion ª‡,ª‡[(p-chlorophenyl)-(4-pyridyl)] carbinols and method of preparing same
DE1468359A1 (de) * 1963-10-23 1968-11-28 Merck & Co Inc Verfahren zur Herstellung von Dibenzocycloheptehderivaten
US3396224A (en) * 1965-09-09 1968-08-06 Lilly Co Eli Controlling phytopathogenic fungi on plants with 3-pyridyl methane derivatives
US3423510A (en) * 1966-08-31 1969-01-21 Geigy Chem Corp 3-(p-halophenyl) - 3 - (2'-pyridyl-n-methylpropylamine for the treatment of depression
US3471505A (en) * 1967-02-01 1969-10-07 Ciba Geigy Corp 1-(alkoxyphenyl)-1-(3-pyridyl)-carbinols
US3928369A (en) * 1971-04-28 1975-12-23 Haessle Ab Compounds useful as antidepressive agents, and a process for their preparation
US3928613A (en) * 1971-04-28 1975-12-23 Haessle Ab Compounds useful as antidepressive agents
SE361663B (es) * 1971-04-28 1973-11-12 Haessle Ab
SE373850B (es) * 1972-11-16 1975-02-17 Haessle Ab
US4094908A (en) * 1973-08-15 1978-06-13 Richter Gedeon Vegyeszeti Gyar Rt. Alpha-substituted benzhydrol derivatives
GB1480593A (en) * 1973-11-30 1977-07-20 Kefalas As Xanthene and thioxanthene derivatives having pharmaceutical activity
US4102887A (en) * 1974-11-21 1978-07-25 Per Arvid Emil Carlsson Intermediates used in the preparation of phenyl-pyridylamine derivatives
SE388854B (sv) 1974-11-21 1979-03-26 Astra Laekemedel Ab Forfarande for framstellning av fenylpyridylaminderivat
US4186202A (en) * 1974-11-21 1980-01-29 Astra Lakemedel Aktiebolag Phenyl-pyridylamine derivatives
SE418291B (sv) * 1976-05-17 1981-05-18 Astra Laekemedel Ab 4-bromfenyl-3-pyridylderivat som mellanprodukter vid framstellning av fenylpyridylaminer
SE409706B (sv) * 1976-05-21 1979-09-03 Astra Pharma Prod Forfarande for framstellning av n,n-dimetyl-3-(4-bromfenyl)-3-3(3-pyridyl)-allylamin dihydroklorid monohydrat
SE418399B (sv) * 1976-05-21 1981-05-25 Astra Laekemedel Ab Forfarande for framstellning av n,n-dimetyl-3-(4 bromfenyl)-3-(3-pyridyl)allylamin
EP0000322B1 (en) * 1977-07-04 1982-05-05 Astra Läkemedel Aktiebolag Compounds having an anti-depressive or tranquilizing activity, pharmaceutical compositions containing them, and processes and intermediates for their preparation
SE409861B (sv) * 1977-07-04 1979-09-10 Astra Laekemedel Ab Ett nytt forfarande for framstellning av en terapeutisk aktiv pyridinforening
SE409860B (sv) * 1977-07-04 1979-09-10 Astra Laekemedel Ab En ny mellanprodukt for framstellning av terapeutiskt aktiva pyridinforeningar

Also Published As

Publication number Publication date
AU538087B2 (en) 1984-07-26
GR72129B (es) 1983-09-16
AU6437880A (en) 1981-05-21
ES496859A0 (es) 1982-05-01
WO1981001407A1 (en) 1981-05-28
ES8300097A1 (es) 1982-10-01
ES8300096A1 (es) 1982-10-01
PL129369B1 (en) 1984-05-31
EP0081478A3 (en) 1984-01-04
SU1149875A3 (ru) 1985-04-07
ES8204721A1 (es) 1982-05-01
JPS56501524A (es) 1981-10-22
DK300781A (da) 1981-07-07
ES508063A0 (es) 1982-10-01
SU1103794A3 (ru) 1984-07-15
PL129370B1 (en) 1984-05-31
FI812196L (fi) 1981-07-10
NO812401L (no) 1981-07-13
NZ195558A (en) 1984-07-06
ES508065A0 (es) 1982-10-01
ES508064A0 (es) 1982-10-01
PL227849A1 (es) 1981-12-23
EP0081478A2 (en) 1983-06-15
PT72066B (en) 1982-09-02
PL232732A1 (es) 1982-08-16
ES8300094A1 (es) 1982-10-01
PT72066A (en) 1980-12-01
SU1149874A3 (en) 1985-04-07
PL232731A1 (es) 1982-08-16
ZA807102B (en) 1981-07-29
SU1138021A3 (ru) 1985-01-30
CA1155128A (en) 1983-10-11
EP0029420A1 (en) 1981-05-27
PL128457B1 (en) 1984-01-31
ES508062A0 (es) 1982-10-01
US4418065A (en) 1983-11-29
ES8300095A1 (es) 1982-10-01

Similar Documents

Publication Publication Date Title
FI793238A (fi) Difenylbutyl-piperazinekarboxamider
RU92016445A (ru) Применение амидов изоксазол-4-карбоновой кислоты и амидов гидроксиалкилиденциануксусной кислоты
ATE103812T1 (de) Zusammensetzung zur behandlung von ischaemischen stoerungen in organen.
ATE418975T1 (de) Pharmazeutische zubereitungen zur behandlung von hemoglobulinopathien der beta-chain
ATE31927T1 (de) (4-oxo-4h-(1)-benzopyran-8-yl)-alkansaueren, salze und derivate, herstellung und diese enthaltende arzneimittel.
DE69321835D1 (de) 7-(2-aminoethyl)-benzothiazolone
BG47946A3 (en) Method for preparing derivatives of oxycames
SE7601143L (sv) Nytt oxadiazolinonderivat
SE7909514L (sv) Nya halofenyl-pyridyl-allylaminderivat
SE7705310L (sv) Kinazolinderivat
AR213100A1 (es) Procedimiento para la preparacion de compuestos derivados de n-(2-hidriximetil-n-imidazolil)-guanidina
NO872574D0 (no) Fremgangsmaate for fremstilling av terapeutisk aktive tetrahydro-benzotiazoler.
SE7403176L (es)
NO923983L (no) Bisfenyletanderivater, fremgangsmaate for deres fremstilling og farmasoeytiske preparater derav
ATE80396T1 (de) Alpha-hydroxy-azolylethyloxirane und diese enthaltende fungizide.
ES2062214T3 (es) Derivados de aminooligohidroxi inhibidores de renina.
IL64210A0 (en) 5-phenyltetrazoles containing basic substituents,a process for their preparation and their use as drugs
ATE84938T1 (de) Mikrobizide mittel.
SE7506729L (sv) Forfarande for framstellning av nya substituerade 1-(2',4',6'-trihydrofenyl)-propandion-(1,2)-foreningar
ATE60048T1 (de) Aminoverbindungen und diese enthaltende fungizide.
IL60383A0 (en) Cyclophosphathiazene derivatives,their preparation and pharmaceutical compositions containing them
ES2053808T3 (es) Nuevos compuestos azolicos.
BE839229A (fr) Procede de preparation d'halogenures de triorgano-etain utilisables comme substances bactericides
SE8005309L (sv) Nya 5alfa-pregnan-20-ol-derivat och salter derav med syror, sett for framstellning samt anvendning derav sasom lekemedel samt kompositioner innehallande dessa foreningar
ES8103774A1 (es) Un procedimiento para preparar nuevos compuestos de triazeno

Legal Events

Date Code Title Description
NAV Patent application has lapsed

Ref document number: 7909514-7

Format of ref document f/p: F