KR20240032667A - 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 - Google Patents
막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 Download PDFInfo
- Publication number
- KR20240032667A KR20240032667A KR1020230114740A KR20230114740A KR20240032667A KR 20240032667 A KR20240032667 A KR 20240032667A KR 1020230114740 A KR1020230114740 A KR 1020230114740A KR 20230114740 A KR20230114740 A KR 20230114740A KR 20240032667 A KR20240032667 A KR 20240032667A
- Authority
- KR
- South Korea
- Prior art keywords
- polypeptide
- amino acids
- peptide
- antibacterial
- terminus
- Prior art date
Links
- 150000001413 amino acids Chemical class 0.000 title claims description 105
- 108700042778 Antimicrobial Peptides Proteins 0.000 title description 2
- 102000044503 Antimicrobial Peptides Human genes 0.000 title description 2
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 198
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 112
- 230000000844 anti-bacterial effect Effects 0.000 claims abstract description 99
- 229920001184 polypeptide Polymers 0.000 claims abstract description 52
- 241000894006 Bacteria Species 0.000 claims abstract description 51
- 230000004927 fusion Effects 0.000 claims abstract description 22
- 235000001014 amino acid Nutrition 0.000 claims description 109
- 239000003242 anti bacterial agent Substances 0.000 claims description 22
- 239000003814 drug Substances 0.000 claims description 12
- 239000000203 mixture Substances 0.000 claims description 11
- 229940079593 drug Drugs 0.000 claims description 9
- 241000192125 Firmicutes Species 0.000 claims description 8
- 230000003115 biocidal effect Effects 0.000 claims description 8
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 6
- 239000004472 Lysine Substances 0.000 claims description 6
- 239000004480 active ingredient Substances 0.000 claims description 6
- 239000002537 cosmetic Substances 0.000 claims description 5
- 239000000575 pesticide Substances 0.000 claims description 5
- 239000003674 animal food additive Substances 0.000 claims description 4
- 239000002778 food additive Substances 0.000 claims description 4
- 239000004475 Arginine Substances 0.000 claims description 3
- 230000021736 acetylation Effects 0.000 claims description 3
- 238000006640 acetylation reaction Methods 0.000 claims description 3
- 230000009435 amidation Effects 0.000 claims description 3
- 238000007112 amidation reaction Methods 0.000 claims description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 3
- -1 arparagine Chemical compound 0.000 claims description 3
- 230000021523 carboxylation Effects 0.000 claims description 3
- 238000006473 carboxylation reaction Methods 0.000 claims description 3
- 230000029226 lipidation Effects 0.000 claims description 3
- 230000006320 pegylation Effects 0.000 claims description 3
- 238000002360 preparation method Methods 0.000 claims description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 claims description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 claims description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 claims description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 2
- 239000004473 Threonine Substances 0.000 claims description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 2
- 235000018417 cysteine Nutrition 0.000 claims description 2
- 235000013373 food additive Nutrition 0.000 claims description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 2
- 210000001700 mitochondrial membrane Anatomy 0.000 description 46
- 108090000623 proteins and genes Proteins 0.000 description 30
- 235000018102 proteins Nutrition 0.000 description 26
- 102000004169 proteins and genes Human genes 0.000 description 26
- 241000191967 Staphylococcus aureus Species 0.000 description 20
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 20
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 19
- 230000001580 bacterial effect Effects 0.000 description 19
- 229940088710 antibiotic agent Drugs 0.000 description 18
- 230000001954 sterilising effect Effects 0.000 description 18
- 238000000034 method Methods 0.000 description 17
- 238000004659 sterilization and disinfection Methods 0.000 description 17
- 210000000170 cell membrane Anatomy 0.000 description 14
- 108010059993 Vancomycin Proteins 0.000 description 13
- 125000003275 alpha amino acid group Chemical group 0.000 description 13
- 239000012528 membrane Substances 0.000 description 13
- 229960003165 vancomycin Drugs 0.000 description 13
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 13
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 13
- 102100038800 Cytochrome c oxidase assembly protein COX20, mitochondrial Human genes 0.000 description 12
- 101000957223 Homo sapiens Cytochrome c oxidase assembly protein COX20, mitochondrial Proteins 0.000 description 11
- 238000000691 measurement method Methods 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- MYSWGUAQZAJSOK-UHFFFAOYSA-N ciprofloxacin Chemical compound C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 MYSWGUAQZAJSOK-UHFFFAOYSA-N 0.000 description 10
- 241000194031 Enterococcus faecium Species 0.000 description 9
- 208000022362 bacterial infectious disease Diseases 0.000 description 9
- 230000000149 penetrating effect Effects 0.000 description 9
- 239000008194 pharmaceutical composition Substances 0.000 description 9
- 241000588626 Acinetobacter baumannii Species 0.000 description 8
- 238000012790 confirmation Methods 0.000 description 8
- 235000018977 lysine Nutrition 0.000 description 8
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 7
- 229930182566 Gentamicin Natural products 0.000 description 7
- 235000013305 food Nutrition 0.000 description 7
- 229960002518 gentamicin Drugs 0.000 description 7
- 102100032812 HIG1 domain family member 1A, mitochondrial Human genes 0.000 description 6
- 101001066429 Homo sapiens HIG1 domain family member 1A, mitochondrial Proteins 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 108091005703 transmembrane proteins Proteins 0.000 description 6
- 102000035160 transmembrane proteins Human genes 0.000 description 6
- 102100027476 Cytochrome c oxidase assembly protein COX19 Human genes 0.000 description 5
- 101000770637 Homo sapiens Cytochrome c oxidase assembly protein COX15 homolog Proteins 0.000 description 5
- 101000725442 Homo sapiens Cytochrome c oxidase assembly protein COX19 Proteins 0.000 description 5
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 description 5
- 235000009697 arginine Nutrition 0.000 description 5
- 229960000484 ceftazidime Drugs 0.000 description 5
- NMVPEQXCMGEDNH-TZVUEUGBSA-N ceftazidime pentahydrate Chemical compound O.O.O.O.O.S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 NMVPEQXCMGEDNH-TZVUEUGBSA-N 0.000 description 5
- 229960003405 ciprofloxacin Drugs 0.000 description 5
- 229960002182 imipenem Drugs 0.000 description 5
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 5
- TUPFOYXHAYOHIB-WZGOVNIISA-M sodium;(2s,5r,6r)-6-[[(2s)-2-[(4-ethyl-2,3-dioxopiperazine-1-carbonyl)amino]-2-phenylacetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylate;(2s,3s,5r)-3-methyl-4,4,7-trioxo-3-(triazol-1-ylmethyl)-4$l^{6}-thia-1-azabicyclo[3.2.0]h Chemical compound [Na+].C([C@]1(C)S([C@H]2N(C(C2)=O)[C@H]1C(O)=O)(=O)=O)N1C=CN=N1.O=C1C(=O)N(CC)CCN1C(=O)N[C@@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C([O-])=O)C(C)(C)S[C@@H]21 TUPFOYXHAYOHIB-WZGOVNIISA-M 0.000 description 5
- 241000894007 species Species 0.000 description 5
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 4
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 4
- 102100035386 NADH dehydrogenase [ubiquinone] 1 subunit C2 Human genes 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- 102100036591 Post-GPI attachment to proteins factor 6 Human genes 0.000 description 4
- 229960004821 amikacin Drugs 0.000 description 4
- LKCWBDHBTVXHDL-RMDFUYIESA-N amikacin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O1)O)NC(=O)[C@@H](O)CCN)[C@H]1O[C@H](CN)[C@@H](O)[C@H](O)[C@H]1O LKCWBDHBTVXHDL-RMDFUYIESA-N 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- YZBQHRLRFGPBSL-RXMQYKEDSA-N carbapenem Chemical compound C1C=CN2C(=O)C[C@H]21 YZBQHRLRFGPBSL-RXMQYKEDSA-N 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 239000003085 diluting agent Substances 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 4
- 229960002260 meropenem Drugs 0.000 description 4
- DMJNNHOOLUXYBV-PQTSNVLCSA-N meropenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](C(=O)N(C)C)C1 DMJNNHOOLUXYBV-PQTSNVLCSA-N 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 239000001974 tryptic soy broth Substances 0.000 description 4
- 108010050327 trypticase-soy broth Proteins 0.000 description 4
- MMRINLZOZVAPDZ-LSGRDSQZSA-N (6r,7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-methoxyiminoacetyl]amino]-3-[(1-methylpyrrolidin-1-ium-1-yl)methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid;chloride Chemical compound Cl.S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 MMRINLZOZVAPDZ-LSGRDSQZSA-N 0.000 description 3
- 241000589291 Acinetobacter Species 0.000 description 3
- 102100026596 Bcl-2-like protein 1 Human genes 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 102100024411 Ganglioside-induced differentiation-associated protein 1 Human genes 0.000 description 3
- 101710143708 Ganglioside-induced differentiation-associated protein 1 Proteins 0.000 description 3
- 101001023553 Homo sapiens NADH dehydrogenase [ubiquinone] 1 subunit C2 Proteins 0.000 description 3
- 101001072749 Homo sapiens Post-GPI attachment to proteins factor 6 Proteins 0.000 description 3
- 101000874364 Homo sapiens Protein SCO2 homolog, mitochondrial Proteins 0.000 description 3
- 108090000144 Human Proteins Proteins 0.000 description 3
- 102000003839 Human Proteins Human genes 0.000 description 3
- 102100035546 Protein SCO2 homolog, mitochondrial Human genes 0.000 description 3
- 241001147693 Staphylococcus sp. Species 0.000 description 3
- 239000004098 Tetracycline Substances 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 150000001484 arginines Chemical class 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 229960002100 cefepime Drugs 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 229960002292 piperacillin Drugs 0.000 description 3
- WCMIIGXFCMNQDS-IDYPWDAWSA-M piperacillin sodium Chemical compound [Na+].O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C([O-])=O)C(C)(C)S[C@@H]21 WCMIIGXFCMNQDS-IDYPWDAWSA-M 0.000 description 3
- 235000019364 tetracycline Nutrition 0.000 description 3
- 150000003522 tetracyclines Chemical class 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- 102100023587 ATP synthase F(0) complex subunit C2, mitochondrial Human genes 0.000 description 2
- 102100027691 ATP synthase membrane subunit K, mitochondrial Human genes 0.000 description 2
- 102100032814 ATP-dependent zinc metalloprotease YME1L1 Human genes 0.000 description 2
- 241000588625 Acinetobacter sp. Species 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 102100034304 Armadillo repeat-containing X-linked protein 3 Human genes 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 102100033868 Cannabinoid receptor 1 Human genes 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 241000194032 Enterococcus faecalis Species 0.000 description 2
- 241001495410 Enterococcus sp. Species 0.000 description 2
- 102100029908 Exonuclease 3'-5' domain-containing protein 2 Human genes 0.000 description 2
- 102100024015 Glycerol-3-phosphate acyltransferase 2, mitochondrial Human genes 0.000 description 2
- 102100040017 Growth hormone-inducible transmembrane protein Human genes 0.000 description 2
- 101710168179 HIG1 domain family member 2A Proteins 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101000905797 Homo sapiens ATP synthase F(0) complex subunit C2, mitochondrial Proteins 0.000 description 2
- 101000937382 Homo sapiens ATP synthase membrane subunit K, mitochondrial Proteins 0.000 description 2
- 101000925948 Homo sapiens Armadillo repeat-containing X-linked protein 3 Proteins 0.000 description 2
- 101000710899 Homo sapiens Cannabinoid receptor 1 Proteins 0.000 description 2
- 101001011220 Homo sapiens Exonuclease 3'-5' domain-containing protein 2 Proteins 0.000 description 2
- 101000904251 Homo sapiens Glycerol-3-phosphate acyltransferase 2, mitochondrial Proteins 0.000 description 2
- 101001082070 Homo sapiens Interferon alpha-inducible protein 6 Proteins 0.000 description 2
- 101000588067 Homo sapiens Metaxin-1 Proteins 0.000 description 2
- 101000990982 Homo sapiens Mitochondrial Rho GTPase 1 Proteins 0.000 description 2
- 101000798951 Homo sapiens Mitochondrial import receptor subunit TOM20 homolog Proteins 0.000 description 2
- 101000973601 Homo sapiens Mitoguardin 1 Proteins 0.000 description 2
- 101000636665 Homo sapiens NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Proteins 0.000 description 2
- 101000691787 Homo sapiens Phosphoinositide-interacting protein Proteins 0.000 description 2
- 101000945509 Homo sapiens Protein CEBPZOS Proteins 0.000 description 2
- 101000702132 Homo sapiens Protein spinster homolog 1 Proteins 0.000 description 2
- 101001066450 Homo sapiens Putative HIG1 domain family member 2B Proteins 0.000 description 2
- 101000830578 Homo sapiens TOMM20-like protein 1 Proteins 0.000 description 2
- 101000851653 Homo sapiens Transmembrane protein 14A Proteins 0.000 description 2
- 101000621863 Homo sapiens UDP-glucuronic acid decarboxylase 1 Proteins 0.000 description 2
- 102100027354 Interferon alpha-inducible protein 6 Human genes 0.000 description 2
- 241000588747 Klebsiella pneumoniae Species 0.000 description 2
- 241000588754 Klebsiella sp. Species 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 102100031603 Metaxin-1 Human genes 0.000 description 2
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 2
- 102100030331 Mitochondrial Rho GTPase 1 Human genes 0.000 description 2
- 102100034007 Mitochondrial import receptor subunit TOM20 homolog Human genes 0.000 description 2
- 102100028134 Mitochondrial potassium channel ATP-binding subunit Human genes 0.000 description 2
- 101710106113 Mitochondrial potassium channel ATP-binding subunit Proteins 0.000 description 2
- 102100040420 Mitochondrial thiamine pyrophosphate carrier Human genes 0.000 description 2
- 102100022238 Mitoguardin 1 Human genes 0.000 description 2
- 102100031924 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 Human genes 0.000 description 2
- 102100033126 Phosphatidate cytidylyltransferase 2 Human genes 0.000 description 2
- 101710178746 Phosphatidate cytidylyltransferase 2 Proteins 0.000 description 2
- 102100026124 Phosphoinositide-interacting protein Human genes 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 102100034810 Protein CEBPZOS Human genes 0.000 description 2
- 102100030293 Protein spinster homolog 1 Human genes 0.000 description 2
- 241000589774 Pseudomonas sp. Species 0.000 description 2
- 102100032811 Putative HIG1 domain family member 2B Human genes 0.000 description 2
- 108091006207 SLC-Transporter Proteins 0.000 description 2
- 102000037054 SLC-Transporter Human genes 0.000 description 2
- 108091006746 SLC22A14 Proteins 0.000 description 2
- 108091006423 SLC25A19 Proteins 0.000 description 2
- 108091006480 SLC25A44 Proteins 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100021476 Solute carrier family 22 member 14 Human genes 0.000 description 2
- 102100032414 Solute carrier family 25 member 44 Human genes 0.000 description 2
- 102100024577 TOMM20-like protein 1 Human genes 0.000 description 2
- 102100036796 Transmembrane protein 14A Human genes 0.000 description 2
- 102100023914 UDP-glucuronic acid decarboxylase 1 Human genes 0.000 description 2
- 108091009222 YME1L1 Proteins 0.000 description 2
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 150000001540 azides Chemical class 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 229960001139 cefazolin Drugs 0.000 description 2
- MLYYVTUWGNIJIB-BXKDBHETSA-N cefazolin Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 MLYYVTUWGNIJIB-BXKDBHETSA-N 0.000 description 2
- MYPYJXKWCTUITO-KIIOPKALSA-N chembl3301825 Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)C(O)[C@H](C)O1 MYPYJXKWCTUITO-KIIOPKALSA-N 0.000 description 2
- 230000005757 colony formation Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 230000001934 delay Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 229940032049 enterococcus faecalis Drugs 0.000 description 2
- 229960003276 erythromycin Drugs 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 229960003085 meticillin Drugs 0.000 description 2
- 125000001421 myristyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- BDJRBEYXGGNYIS-UHFFFAOYSA-N nonanedioic acid Chemical compound OC(=O)CCCCCCCC(O)=O BDJRBEYXGGNYIS-UHFFFAOYSA-N 0.000 description 2
- 150000002482 oligosaccharides Polymers 0.000 description 2
- 229960001019 oxacillin Drugs 0.000 description 2
- UWYHMGVUTGAWSP-JKIFEVAISA-N oxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1 UWYHMGVUTGAWSP-JKIFEVAISA-N 0.000 description 2
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 235000019371 penicillin G benzathine Nutrition 0.000 description 2
- 229940056360 penicillin g Drugs 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 229960001225 rifampicin Drugs 0.000 description 2
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 125000004079 stearyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- UDPGUMQDCGORJQ-UHFFFAOYSA-N (2-chloroethyl)phosphonic acid Chemical compound OP(O)(=O)CCCl UDPGUMQDCGORJQ-UHFFFAOYSA-N 0.000 description 1
- 102100026397 ADP/ATP translocase 3 Human genes 0.000 description 1
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- 241000194110 Bacillus sp. (in: Bacteria) Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 208000031729 Bacteremia Diseases 0.000 description 1
- 101150008012 Bcl2l1 gene Proteins 0.000 description 1
- 229930186147 Cephalosporin Natural products 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 101710149255 Cytochrome c oxidase assembly protein COX20, mitochondrial Proteins 0.000 description 1
- 101710173353 Cytotoxicity-associated immunodominant antigen Proteins 0.000 description 1
- 108010013198 Daptomycin Proteins 0.000 description 1
- 208000004145 Endometritis Diseases 0.000 description 1
- 241000147019 Enterobacter sp. Species 0.000 description 1
- 241000587112 Enterobacteriaceae sp. Species 0.000 description 1
- 241000488157 Escherichia sp. Species 0.000 description 1
- 206010016952 Food poisoning Diseases 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 108010015899 Glycopeptides Proteins 0.000 description 1
- 102000002068 Glycopeptides Human genes 0.000 description 1
- 101710185632 Growth hormone-inducible transmembrane protein Proteins 0.000 description 1
- 101000886768 Homo sapiens Growth hormone-inducible transmembrane protein Proteins 0.000 description 1
- 101001002063 Homo sapiens Plasminogen receptor (KT) Proteins 0.000 description 1
- 101000735417 Homo sapiens Protein PAPPAS Proteins 0.000 description 1
- 101001116937 Homo sapiens Protocadherin alpha-4 Proteins 0.000 description 1
- 101000621948 Homo sapiens Vitamin K epoxide reductase complex subunit 1-like protein 1 Proteins 0.000 description 1
- 241000588915 Klebsiella aerogenes Species 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- 108010064171 Lysosome-Associated Membrane Glycoproteins Proteins 0.000 description 1
- 102000014944 Lysosome-Associated Membrane Glycoproteins Human genes 0.000 description 1
- 108060003100 Magainin Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 101710157293 Mitochondrial import receptor subunit TOM20 Proteins 0.000 description 1
- 102100028054 Mitochondrial potassium channel Human genes 0.000 description 1
- 101710154679 Mitochondrial potassium channel Proteins 0.000 description 1
- 101710162998 NADH dehydrogenase [ubiquinone] 1 subunit C2 Proteins 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010031252 Osteomyelitis Diseases 0.000 description 1
- 206010033078 Otitis media Diseases 0.000 description 1
- 102100036619 Palmitoyltransferase ZDHHC23 Human genes 0.000 description 1
- 101710097485 Palmitoyltransferase ZDHHC23 Proteins 0.000 description 1
- 206010034133 Pathogen resistance Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 102100035967 Plasminogen receptor (KT) Human genes 0.000 description 1
- 101710159981 Post-GPI attachment to proteins factor 6 Proteins 0.000 description 1
- 102100034919 Protein PAPPAS Human genes 0.000 description 1
- 101000727837 Rattus norvegicus Reduced folate transporter Proteins 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000194022 Streptococcus sp. Species 0.000 description 1
- 241000946759 Streptomyces sindenensis Species 0.000 description 1
- 241000187180 Streptomyces sp. Species 0.000 description 1
- 108010036064 UDP-glucuronate decarboxylase Proteins 0.000 description 1
- 102000004210 Vitamin K Epoxide Reductases Human genes 0.000 description 1
- 108090000779 Vitamin K Epoxide Reductases Proteins 0.000 description 1
- 102100023484 Vitamin K epoxide reductase complex subunit 1-like protein 1 Human genes 0.000 description 1
- 101710204001 Zinc metalloprotease Proteins 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 108700000711 bcl-X Proteins 0.000 description 1
- 235000013361 beverage Nutrition 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000000337 buffer salt Substances 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 229940041011 carbapenems Drugs 0.000 description 1
- 229940124587 cephalosporin Drugs 0.000 description 1
- 150000001780 cephalosporins Chemical class 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 201000003146 cystitis Diseases 0.000 description 1
- DOAKLVKFURWEDJ-QCMAZARJSA-N daptomycin Chemical compound C([C@H]1C(=O)O[C@H](C)[C@@H](C(NCC(=O)N[C@@H](CCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](C(=O)N1)[C@H](C)CC(O)=O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CCCCCCCCC)C(=O)C1=CC=CC=C1N DOAKLVKFURWEDJ-QCMAZARJSA-N 0.000 description 1
- 229960005484 daptomycin Drugs 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229940092559 enterobacter aerogenes Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 235000014304 histidine Nutrition 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 210000005061 intracellular organelle Anatomy 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000003120 macrolide antibiotic agent Substances 0.000 description 1
- 229940041033 macrolides Drugs 0.000 description 1
- 208000004396 mastitis Diseases 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- VHFGEBVPHAGQPI-MYYQHNLBSA-N oritavancin Chemical compound O([C@@H]1C2=CC=C(C(=C2)Cl)OC=2C=C3C=C(C=2O[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O[C@@H]2O[C@@H](C)[C@H](O)[C@@](C)(NCC=4C=CC(=CC=4)C=4C=CC(Cl)=CC=4)C2)OC2=CC=C(C=C2Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]2C(=O)N[C@@H]1C(N[C@H](C1=CC(O)=CC(O)=C1C=1C(O)=CC=C2C=1)C(O)=O)=O)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@@H](O)[C@H](C)O1 VHFGEBVPHAGQPI-MYYQHNLBSA-N 0.000 description 1
- 229960001607 oritavancin Drugs 0.000 description 1
- 108010006945 oritavancin Proteins 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 150000002960 penicillins Chemical class 0.000 description 1
- 206010034674 peritonitis Diseases 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 150000007660 quinolones Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 108091008020 response regulators Proteins 0.000 description 1
- 235000004400 serine Nutrition 0.000 description 1
- 206010040872 skin infection Diseases 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229940040944 tetracyclines Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229960002363 thiamine pyrophosphate Drugs 0.000 description 1
- 235000008170 thiamine pyrophosphate Nutrition 0.000 description 1
- 239000011678 thiamine pyrophosphate Substances 0.000 description 1
- YXVCLPJQTZXJLH-UHFFFAOYSA-N thiamine(1+) diphosphate chloride Chemical compound [Cl-].CC1=C(CCOP(O)(=O)OP(O)(O)=O)SC=[N+]1CC1=CN=C(C)N=C1N YXVCLPJQTZXJLH-UHFFFAOYSA-N 0.000 description 1
- 235000008521 threonine Nutrition 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 239000007201 ts agar Substances 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N37/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
- A01N37/44—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton by a single or double bond, this nitrogen atom not being a member of a derivative or of a thio analogue of a carboxylic group, e.g. amino-carboxylic acids
- A01N37/46—N-acyl derivatives
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
- A23K20/147—Polymeric derivatives, e.g. peptides or proteins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
- A23L33/18—Peptides; Protein hydrolysates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
- A61Q17/005—Antimicrobial preparations
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2200/00—Function of food ingredients
- A23V2200/30—Foods, ingredients or supplements having a functional effect on health
- A23V2200/324—Foods, ingredients or supplements having a functional effect on health having an effect on the immune system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Polymers & Plastics (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Food Science & Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Plant Pathology (AREA)
- Pest Control & Pesticides (AREA)
- Animal Husbandry (AREA)
- Wood Science & Technology (AREA)
- Mycology (AREA)
- Nutrition Science (AREA)
- Birds (AREA)
- Epidemiology (AREA)
- Dentistry (AREA)
- Environmental Sciences (AREA)
- Agronomy & Crop Science (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Dermatology (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단에 일반식 I의 폴리펩타이드가 결합된 융합 폴리펩타이드로서 상기 융합 폴리펩타이드는 그람 양성, 그람 음성, 및 다제내성 박테리아에 대한 항균 활성을 제공할 수 있다.
Description
본 발명은 세포에서 세포막과 세포 내 소기관 막에 위치하는 막 단백질에서 막을 관통하는 펩타이드 도메인(transmembrane domain)과 이 도메인 양 끝에 염기성 또는 극성(비전하) 아미노산으로 이루어진 항균 펩타이드에 관한 것으로서, 구체적으로 이러한 특징을 갖는 자연계에 존재하는 펩타이드와 인위적으로 합성한 다양한 펩타이드가 그람 양성, 그람 음성, 및 다제내성 박테리아에 대한 항균 활성을 확인하여 상기 각 펩타이드와 각 펩타이드를 포함하는 항균용 조성물 등을 제공하는 것이다.
박테리아 감염에 대한 치료 수단으로 사용되고 있는 항생제의 가장 큰 문제점은 박테리아의 항생제 내성 획득이다. 영국정부의 웰컴트러스트 보고서에 의하면 2050년에는 기존 항생제로 치료할 수 없는 슈퍼박테리아에 의해 세계적으로 사망자 수가 1,000만 명을 초과하여, 사망 원인에 있어서 슈퍼박테리아 감염이 암을 추월하는 위협이 될 것으로 전망된다.
또한, 세계보건기구(WHO)는 수많은 다제내성균에서 위급 단계(critical priority)에는 있는 박테리아로는 카바페넴 내성 아시네토박터균(carbapenem-resistant Acinetobacter baumannii), 카바페넴 내성 녹농균(carbapenem-resistant Pseudomonas aeruginosa), 및 카바페넴 내성 장내세균 속(carbapenem-resistant Enterobacteriaceae sp.) 균종을 선정하고, 최후의 항생제로 알려진 카바페넴계 항생제에 내성을 보이는 그람 음성 슈퍼박테리아를 최우선으로 해결해야 한다고 발표하였다.
상술한 바와 같이, 현재까지 인류가 사용하고 있는 항생제의 가장 큰 문제점은 박테리아의 내성 획득이고, 이를 해결하기 위한 많은 연구가 진행되고 있으며, 특히 박테리아의 항생제 내성 획득을 극복하기 위해 항균 펩타이드(antimicrobial peptide, AMP)의 개발이 활발하게 진행되고 있다. 동물 또는 인간의 방어 단백질(host defense protein) 유래의 다양한 항균 펩타이드가 개발되었으나, 인체 면역 체계에 대한 박테리아의 내성 획득의 가능성이 있고, 혈액 내에서 짧은 반감기와 인체에 나타내는 독성의 문제 및 기존 항생제와 비교하여 제한적인 약효를 나타내는 등의 문제가 있어 실용화되지 못하고 있는 실정이다. 일례로, 마개닌(magainin)는 1999년 미국에서 개발된 항균 펩타이드로 임상 3상 이후 FDA 승인을 요청하였으나 그 약효가 종래 항생제와 비교하여 우수하지 못해 승인이 거부되었다. 또한, 2003 년에 답토마이신(daptomycin), 2014 년에 오리타반신(oritavancin)이 미국 식약처에서 승인을 받았으나, 두개의 펩타이드 모두 그람 양성균에서만 항균 활성을 나타내었으며, 피부 감염 질환에만 적용될 수 있었다.
이를 해결하기 위하여 본 발명자는 선행발명에서 미토콘드리아 내막에 위치하는 Romo1 단백질의 두 번째 막 관통 도메인을 포함하는 펩타이드(KU-5878, AMPR-11)가 그람 양성, 그람 음성, 및 다제내성 박테리아에서 항균활성을 나타내어 광범위한 세균 감염질환 치료에 적용할 수 있음을 확인하고 특허를 출원하고 논문을 발표하였다. 그렇지만 KU-5878의 경우 막 관통 펩타이드 도메인을 포함하고 있지만, 도메인 양 끝쪽에 염기성 아미노산이 각각 1개씩 포함하기 때문에 항균 활성이 우수하지 못하였다. 본 발명자는 더 진보된 연구로서 막 단백질에서 막을 관통하는 펩타이드 도메인(transmembrane domain)과 이 도메인 양 끝에 합이 3 개 이상의 염기성 아미노산과 일부 극성(비전하) 아미노산으로 이루어진 펩타이드가 선행 발명보다 더 우수한 항균 활성이 있다는 것을 발견하게 되었으며 그람 양성, 그람 음성, 및 다제내성 박테리아에서 항균활성을 나타내어 광범위한 세균 감염질환 치료에 적용할 수 있음을 확인하고 본 발명을 완성하였다.
WHO, Global Priority List of Antibiotic-Resistant Bacteria to Guide Research, Discovery, and Development of New Antibiotics (2017. 2. 27)
Lee et al., J. Cell Biol., 217, 2059-2071, 2018
Lee et al., mBio. 11, e03258-19, 2020
Yoo et al., Int J Mol Sci. 22, 8243, 2021
본 발명이 이루고자 하는 기술적 과제는 세포에서 막을 관통하는 펩타이드 도메인(transmembrane domain)과 이 도메인 양 끝에 합이 3 개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 항균 펩타이드로서(도 1), 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 양 말단의 합이 3 개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공하는 것이다.
또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 포함하는 항생제와 상기 항균 펩타이드를 포함하는 식품 및 사료 첨가제, 화장료 조성물, 생물농약, 및 항균용 의약외품 조성물을 제공하는 것을 목적으로 한다.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당해 기술분야의 통상의 기술자에게 명확하게 이해될 수 있을 것이다.
본 발명의 일 양상은 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 양 말단의 합이 3 개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공한다.
본 발명의 다른 일 양상은 상기 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드를 제공한다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 포함하는 항생제와 식품 및 사료 첨가제, 화장료 조성물, 생물농약, 및 항균용 의약외품 조성물을 제공한다.
본 발명의 펩타이드 및 그 변이체는 기존의 항생물질과 선행발명 펩타이드보다 다양한 종류의 세균에 대해 높은 항생능력을 가진다. 특히, 본 발명의 펩타이드는 항생제 내성을 갖는 박테리아에 대해 높은 항균 능력을 발휘하여 기존 항생제 적용의 한계를 넘어서 다제내성 박테리아에 의한 감염성 질환의 예방 또는 치료제로서 제공될 수 있다. 따라서 본 항균 펩타이드는 광범위한 세균성 감염질환의 예방 또는 치료를 목적으로 의약용, 의약부외용, 식품 및 사료 첨가용, 농약 및 화장품 첨가용 등 다양한 방면으로 이용될 것으로 기대된다.
도 1은 막을 관통하는 트랜스멤브레인 도메인(transmembrane domain, TMD)과 이 도메인 양 끝에 염기성 또는 극성(비전하) 아미노산으로 이루어진 항균 펩타이드의 그림을 제공하는 것이다. 상기 펩타이드가 그람 양성, 그람 음성 및 다제내성 박테리아 세포막에 pore를 형성시켜 박테리아를 살상시킨다는 것을 표시하는 도면이다.
본 발명의 일 양상은 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 양 말단의 합이 3개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공한다.
상기 트랜스멤브레인 도메인은 막 관통능을 가진 펩타이드 서열 영역으로서, 막 관통능을 가진 펩타이드는 세포내에 존재하는 소기관의 지질 이중막을 관통하여 존재하는 펩타이드이다. 막 관통 펩타이드에서 지질막을 관통하는 도메인(transmembrane domain, TMD)은 약 22개 정도의 아미노산으로 이루어져 있는데 소수성 아미노산과 일부 친수성 아미노산으로 구성돼 있다. 막 관통 도메인은 하나일 수도 있고 여러 개일 수도 있다.
유전체의 상당 부분이 막 관통 단백질이며 컴퓨터 알고리즘으로 비교적 정확하게 막 관통 부분을 예측할 수 있다. 본 발명에서 막 관통 단백질 서열 정보는 유니프로트(UniProt, www.uniprot.org)에서 확보하였다.
본 발명의 발명자들은 유니프로트에서 검색하여 얻은 정보를 바탕으로 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 다양한 길이의 펩타이드를 합성하여 그 항균활성을 확인하고, 상기 펩타이드의 변이체로부터 항균활성을 확인하여 본 발명을 완성하였다 (실시예 1, 2 참조).
본 발명의 구체적인 실시예에서, 본 발명자들은 상기 서술된 내용과 같이 사람 단백질 중 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 극성 아미노산으로 이루어진 자연계에 존재하는 다양한 길이의 펩타이드를 합성하고, 녹농균 및 황색포도상구균에 대한 각 펩타이드의 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 확인하였다. 그 결과 합성한 펩타이드 모두 기존에 발명한 KU-5878 보다 우수한 항균 활성을 가지는 것을 확인할 수 있었다 (실시예 2 참조).
나아가, 본 발명의 서열번호 1, 2으로 표시되는 펩타이드의 양 끝부분을 일부 결핍시킨 펩타이드를 합성하여 항균 활성을 확인한 결과 항균 활성이 감소됨을 확인하였고, 39와 41로 표시되는 세포막 관통 도메인 양 끝에 염기성 또는 극성 아미노산이 없는 펩타이드는 항균 활성이 없어지는 것을 확인하였기 때문에, 세포막 관통 도메인 양 끝에 염기성 또는 극성 아미노산 서열이 항균 활성에 중요하다는 것을 확인하였다 (실시예 3 참조).
본 발명의 다른 구체적인 실시예에서, 본 발명자들은 세포막 관통 도메인 양 끝에 염기성 아미노산을 인위적으로 반복하여 부착한 합성 펩타이드의 항균 활성을 확인하였다. 그 결과, 세포막 관통 도메인 양쪽에 합이 3개 이상의 라이신(K) 또는 아르기닌(R)을 부착하여 합성한 펩타이드 군이 우수한 항균 활성을 나타냄을 알 수 있었다 (실시예 4 참조).
본 발명의 구체적인 실시예에서, 본 발명자들은 본 발명의 융합 폴리펩타이드가 엔테로코커스 패시움, 대장균, 아시네토박터 바우마니, 다제내성 녹농균, 다제내성 포도상구균, 다제내성 엔테로코커스 패시움 및 다제내성 아시네토박터 바우마니에 대한 상기 펩타이드의 항균 활성을 확인하였다. 그 결과 대표 펩타이드 모두는 그람 양성균, 그람 음성균, 및 다제내성 박테리아 모두에게서 광범위한 항균 활성을 나타냄을 알 수 있었다 (실시예 5, 6 참조).
또한, 본 발명의 다른 구체적인 실시예에서, 본 발명자들은 인간 외의 다른 종의 막 관통 도메인과 도메인 양 끝에 합이 3개 이상의 염기성 아미노산과 극성 아미노산으로 이루어진 펩타이드를 합성하여 항균 활성을 확인하였고, 그 결과 종에 상관없이 공통된 특징을 가진 상기 펩타이드에서 항균 활성을 나타낸다는 것을 알 수 있었다 (실시예 7 참조).
또한, 본 발명의 다른 구체적인 실시예에서, 본 발명자들은 양 말단에 결합된 아미노산 서열을 다른 막 관통 펩타이드에 결합시키더라도 우수한 항균 활성을 나타내는 것을 확인하였다 (실시예 8 참조).
본 명세서에서 “펩타이드”는 펩타이드 결합에 의해 아미노산 잔기들이 서로 결합되어 형성된 선형의 분자를 의미한다. 당 업계에 공지된 화학적 합성 방법, 특히 고상 합성 기술 또는 액상 합성 기술에 따라 제조될 수 있다.
본 발명의 일 구체예로, 상기 트랜스멤브레인 도메인은 17 내지 25개 아미노산으로 구성되는 것일 수 있으며, 더욱 구체적으로는 서열번호 39, 41, 54, 73 내지 78 중 어느 하나일 수 있다.
상기 말단 아미노산은 막 관통 펩타이드 도메인의 C-말단 및 N-말단에 결합되는 것으로 각각의 말단에 하나 이상, 합이 3 개 이상의 아미노산, 구체적으로, C-말단 및 N-말단 각각에 3 내지 6개의 아미노산이 포함되어, 최소 1개에서 최대 6개의 아미노산이 양 말단에 결합되는 것일 수 있다.
상기 말단 아미노산은 염기성 아미노산 및 극성 아미노산들에서 선택되는 것으로, 상기 말단 아미노산은 라이신, 아르기닌, 히스티딘, 세린, 트레오닌 시스테인, 글루타민, 아르파라긴 및 티로신 중 어느 하나일 수 있다.
이 때 C-말단 및 N-말단에 결합되는 말단 아미노산은 양 말단에 각각 1개 이상, 양 말단의 아미노산 개수의 합이 3개 이상이면 족하고, 각각의 아미노산은 서로 독립적이며, C-말단 및 N-말단에 결합되는 펩타이드가 서로 다른 아미노산 구성, 서로 다른 길이여도 본 발명에 포함된다. 상기 말단 아미노산의 일 예시로 트랜스멤브레인 도메인의 일 말단에 1개의 아미노산이 결합되고, 타 말단에 2개 이상의 아미노산이 결합되는 구성일 수 있다.
본 발명의 일 구체예로, 상기 융합 폴리펩타이드는 서열번호 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65, 66, 71 및 72 중 어느 하나일 수 있다.
본 발명의 또 다른 구현예로서, 상기 폴리펩타이드는 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)일 수 있고, 더욱 구체적으로 아미노 말단은 아세틸기, 플루오레닐 메톡시 카르보닐기, 포르밀기, 팔미토일기, 미리스틸기, 스테아릴기 및 폴리에틸렌글리콜(PEG) 등의 보호기가 결합될 수 있으며, 펩타이드의 카르복시 말단은 히드록시기(-OH), 아미노기(-NH2), 아자이드(-NHNH2) 등으로 변형될 수 있다. 또한 본 발명의 펩타이드의 말단 또는 아미노산의 R-잔기(R-group)에 지방산(fatty acids), 당사슬(oligosaccharides chains), 모든 나노입자(골드입자, 리포솜, 헤파린, 하이드로젤 등), 아미노산, 담체 단백질(carrier proteins) 등을 결합할 수 있다.
본 발명의 또 다른 구현예로서, 상기 펩타이드를 구성하는 아미노산은 각각 독립적으로 L-형 또는 D-형의 아미노산일 수 있으며, 방사선 또는 형광 라벨된 아미노산 유사체일 수 있다.
본 발명의 또 다른 구현예로서, 상기 펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 가질 수 있다.
본 발명의 다른 일 양상은 상기 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드를 제공한다.
전술한 바와 같이 상기 융합 폴리펩타이드는 막 관통 펩타이드 도메인과 양 말단에 아미노산 잔기를 더 포함하여 세포막을 관통, 세균을 용출 시켜 항균 효과를 가길 수 있으므로, 본 발명은 상기 융합 폴리펩타이드를 포함하는 항균 능을 가진 폴리펩타이드를 제공할 수 있다.
본 발명의 일 구체예로, 상기 폴리펩타이드는 N-말단 또는 C-말단에 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)을 더 포함하는 것일 수 있고, 더욱 구체적으로 아미노 말단은 아세틸기, 플루오레닐 메톡시 카르보닐기, 포르밀기, 팔미토일기, 미리스틸기, 스테아릴기 및 폴리에틸렌글리콜(PEG) 등의 보호기가 결합될 수 있으며, 펩타이드의 카르복시 말단은 히드록시기(-OH), 아미노기(-NH2), 아자이드(-NHNH2) 등으로 변형될 수 있다. 또한 본 발명의 펩타이드의 말단 또는 아미노산의 R-잔기(R-group)에 지방산(fatty acids), 당사슬(oligosaccharides chains), 모든 나노입자(골드입자, 리포솜, 헤파린, 하이드로젤 등), 아미노산, 담체 단백질(carrier proteins) 등을 결합할 수 있다.
본 발명의 일 구체예로, 상기 폴리펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 갖는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 그람 양성균은 포도상구균 속(Staphylococcus sp.), 간균 속(Bacillus sp.), 엔테로코커스 속(Enterococcus sp.), 스트렙토마이세스 속(Streptomyces sp.), 및 스트렙토코커스 속(Streptococcus sp.)으로 이루어진 군으로부터 선택되는 하나의 속(Genus)에 속하는 세균일 수 있으며, 바람직하게 상기 그람 양성균은 황색포도상구균(Staphylococcus aureus), 고초균(Bacillus subtilis), 엔테로코커스 패시움(Enterococcus faecium), 스트렙토마이세스 신데넨시스(Streptomyces sindenensis), 엔테로코커스 패칼리스(Enterococcus faecalis), 및 스트렙토코커스 뉴모니아(Streptococcus pneumoniae)로 이루어진 군으로부터 선택되는 하나 이상의 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 그람 음성균은 대장균 속(Escherichia sp.), 클렙시엘라 속(Klebsiella sp.), 아시네토박터 속(Acinetobacter sp.), 수도모나스 속(Pseudomonas sp.), 및 엔테로박터 속(Enterobacter sp.)으로 이루어진 군으로부터 선택되는 하나의 속(Genus)에 속하는 세균일 수 있으며, 바람직하게 상기 그람 음성균은 대장균(Escherichia coli), 클렙시엘라 뉴모니아(Klebsiella pneumoniae), 아시네토박터 바우마니(Acinetobacter baumannii), 녹농균(Pseudomonas aeruginosa), 및 엔테로박터 에어로게네스(Enterobacter aerogenes)로 이루어진 군으로부터 선택되는 하나 이상의 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 다제내성균은 페니실린계(penicillins), 카바페넴계(carbapenems), 세팔로스포린계(cephalosporins), 퀴놀론계(quinolones), 마크로라이드계(macrolides), 테트라사이클린계(tetracyclins), 또는 글리코펩티드계(glycopeptides)에 속하는 1종 이상의 항생물질에 대한 내성을 갖는 상기 그람 양성균 또는 그람 음성균으로서, 바람직하게 상기 다제내성균은 메티실린 내성 포도상구균(methicillin-resistant Staphylococcus sp.), 다제내성 수도모나스 속(multidrug-resistant Pseudomonas sp.), 반코마이신 내성 엔테로코커스 속(vancomycin-resistant Enterococcus sp.), 다제내성 클렙시엘라 속(multidrug-resistant Klebsiella sp.), 다제내성 아시네토박터 속(multidrug-resistant Acinetobacter sp.), 및 반코마이신 내성 포도상구균(vancomycin-resistant Staphylococcus sp.)으로 이루어진 군으로부터 선택되는 하나의 속(Genus)에 속하는 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 다제내성균은 메티실린 내성 황색포도상구균(methicillin-resistant S. aureus), 다제내성 녹농균(multidrug-resistant P. aeruginosa), 다제내성 아시네토박터 바우마니(multidrug-resistant A. baumannii), 다제내성 클렙시엘라 뉴모니아(multidrug-resistant K. pneumoniae), 반코마이신 내성 엔테로코커스 패시움(vancomycin-resistant E. faecium), 및 반코마이신 내성 황색포도상구균(vancomycin-resistant S. aureus)로 이루어진 군으로부터 선택되는 하나 이상의 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 다제내성 녹농균은 피페라실린(piperacilin), 피페라실린타조박탐(piperacilin-tazobactam), 세프타지딤(ceftazidime), 이미페넴(imipenem), 메로페넴(meropenem), 젠타마이신(gentamicin), 아미카신(amikacin), 및 시프로플록사신(ciprofloxacin)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 갖는 것일 수 있으며, 상기 다제내성 아시네토박터 바우마니는 피페라실린, 피페라실린타조박탐, 세프타지딤, 이미페넴, 메로페넴, 젠타마이신, 아미카신, 시프로플록사신, 및 세페핌(cefepime)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 갖는 것일 수 있고, 상기 다제내성 클렙시엘라 뉴모니아는 피페라실린타조박탐, 세프타지딤, 세페핌, 이미페넴, 젠타마이신, 및 시프로플록사신으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 갖는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 반코마이신 내성 엔테로코커스 패시움은 반코마이신 외에도 리팜핀(rifampin), 테트라사이클린, 젠타마이신, 에리트로마이신(erythromycin), 스트렙토마이신(streptomycin), 및 암피실린(ampicillin)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 추가로 갖는 것일 수 있으며, 상기 반코마이신 내성 황색포도상구균은 반코마이신 외에도 옥사실린(oxacillin), 벤질페니실린(benzylpenicillin), 암피실린 및 세파졸린(cefazolin)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 추가로 갖는 것일 수 있다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 유효성분으로 포함하는 항생제를 제공한다.
또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 포함하는 세균성 감염 질환 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명에서 "예방"이란 본 발명에 따른 약학적 조성물의 투여에 의해 상기 그람 양성균, 그람 음성성균, 및/또는 다제내성 세균의 감염을 지연시키거나, 그 감염에 의한 질병의 발병을 지연시키는 모든 행위를 의미하고, "치료"란 본 발명에 따른 약학적 조성물의 투여에 의해 상기 세균 감염에 따른 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
본 발명에서 약학적 조성물(pharmaceutical composition)은 상기 융합 폴리펩타이드 또는 항균 폴리펩타이드 외에 공지의 항생물질을 1종 이상 더 포함할 수 있으며, 약학적 조성물의 제조에 통상적으로 사용되는 적절한 담체, 부형제, 및 희석제를 더 포함할 수 있다.
본 발명에서 "담체(carrier)"란 비이클(vehicle)이라고도 불리우며, 세포 또는 조직 내로의 단백질 또는 펩타이드의 부가를 용이하게 하는 화합물을 의미하는 것으로서, 예를 들어, 디메틸술폭사이드(DMSO)는 생물체의 세포 또는 조직 내로의 많은 유기물의 투입을 용이하게 하는 통상 사용되는 담체이다.
본 발명에서 "희석제(diluent)"란 대상 단백질 또는 펩타이드의 생물학적 활성 형태를 안정화시킬 뿐만 아니라, 단백질 또는 펩타이드를 용해시키게 되는 물에서 희석되는 화합물로 정의된다. 버퍼 용액에 용해되어 있는 염은 당해 분야에서 희석제로 사용된다. 통상 사용되는 버퍼 용액은 포스페이트 버퍼 식염수이며, 이는 인간 용액의 염 상태를 모방하고 있기 때문이다. 버퍼 염은 낮은 농도에서 용액의 pH를 제어할 수 있기 때문에, 버퍼 희석제가 화합물의 생물학적 활성을 변형하는 일은 드물다. 여기에 사용된 아젤라산을 함유하는 화합물들은 인간 환자에게 그 자체로서, 또는 결합 요법에서와 같이 다른 성분들과 함께 또는 적당한 담체나 부형제와 함께 혼합된 약학적 조성물로서, 투여될 수 있다.
또한, 본 발명에 따른 약학적 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 외용제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있으며, 본 발명의 약학적 조성물은 목적하는 방법에 따라 경구 투여하거나 비경구 투여(예를 들어, 정맥 내, 피하, 복강 내 또는 국소에 적용)할 수 있으며, 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있으며, 예를 들어, 약학적으로 허용가능한 담체와 혼합된 형태로 약 0.001mg 내지 1000mg이 투여될 수 있다. 본 발명의 약학적 조성물은 필요에 따라 일일 1회 내지 수회로 나누어 투여할 수 있으며, 단독으로, 또는 수술, 호르몬 치료, 약물 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
또한, 본 발명은 상기 항균 펩타이드를 개체에 투여하는 단계를 포함하는 세균성 감염 질환 예방 또는 치료 방법을 제공한다.
또한, 본 발명은 세균성 감염 질환 예방 또는 치료용 약제의 제조를 위한 상기 항균 펩타이드의 용도를 제공한다.
본 발명의 일 구현예로서, 상기 세균성 감염 질환은 피부감염, 식중독, 중이염, 방광염, 복막염, 요로감염, 유방염, 폐렴, 심내막염, 결막염, 관절염, 자궁내막염, 선역, 균혈증, 패혈증, 골수염 및 여드름으로 이루어진 군으로부터 선택되는 하나 이상의 질병일 수 있고, 바람직하게는 폐렴 또는 패혈증일 수 있다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 포함하는 식품 첨가제, 사료 첨가제, 화장료 조성물, 항균용 생물 농약 제제 및 항균용 의약외품 조성물을 제공한다.
본 발명의 펩타이드를 식품 또는 사료의 첨가물 등으로 사용할 경우, 상기 펩타이드를 그대로 첨가하거나 다른 식품, 사료, 또는 그 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효성분의 혼합양은 사용 목적(세균의 증식 및 생장 억제를 통한 감염성 질환의 예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다. 일반적으로, 사료, 식품 또는 음료의 제조 시 본 발명의 펩타이드 원료에 대하여 15중량% 이하, 바람직하게는 10 중량% 이하의 양으로 첨가된다. 그러나, 건강 및 위생을 목적으로 하거나 또는 건강 조절을 목적으로 하는 장기간의 섭취의 경우 상기 양은 상기 범위 이하일 수 있으며, 안전성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다. 상기 식품 및 사료의 종류에는 특별한 제한은 없다.
본 발명은 다양한 변환을 가할 수 있고 여러 가지 실시예를 가질 수 있는 바, 이하 특정 실시예들을 도면에 예시하고 상세한 설명에 상세하게 설명하고자 한다. 그러나, 이는 본 발명을 특정한 실시 형태에 대해 한정하려는 것이 아니며, 본 발명의 사상 및 기술 범위에 포함되는 모든 변환, 균등물 내지 대체물을 포함하는 것으로 이해되어야 한다. 본 발명을 설명함에 있어서 관련된 공지 기술에 대한 구체적인 설명이 본 발명의 요지를 흐릴 수 있다고 판단되는 경우 그 상세한 설명을 생략한다.
[실시예]
실시예 1. 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드 탐색
본 발명에서 막 관통 단백질 서열 정보는 단백질의 서열 및 기능에 대한 정보가 들어 있는 유니프로트(UniProt, www.uniprot.org)에서 탐색하였다. 유니프로트 홈페이지에 접속하여 proteins UniProt knowledgesbase를 접속한 후 reviewed (Swiss-Prot)에 접속한다. 이어서 proteins with transmembrane에 접속하면 79,724 단백질이 검색이 된다. 인간 단백질의 경우 20,422 단백질이 검색이 되고 이 중 막 관통 단백질은 5,217 단백질이 검색이 된다. 각각의 막 관통 단백질에 접속하면 각각의 단백질 정보를 확인이 가능하며 동시에 막 관통 펩타이드 도메인의 펩타이드 서열의 확인이 가능하다. 본 발명자는 우선 5,217의 막 관통 단백질에서 막 관통 도메인과 그 주변 서열을 탐색하였고 이 중 도 1과 유사한 구조를 갖는 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드를 합성하였다 (표 1).
실시예 2. UniProt에서 탐색한 펩타이드의 항균 활성 확인
본 발명자는 UniProt에서 탐색한 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 36종을 합성하고, 박테리아 살균 최소 농도 측정법 (minimum bactericidal concentration: MBC)을 이용하여 각 펩타이드의 항균 활성을 확인하였다 (각 펩타이드의 정보는 하기 표 1 참조). 상기 각 펩타이드의 박테리아 살균 최소 농도 측정법을 이용한 항균 활성 확인은 구체적으로 하기와 같이 수행되었다.
먼저, 녹농균 (ATCC 27853)과 황색포도상구균 (NCCP 15872)를 LB (1% tryptone, 0.5% yeast extract, 1% sodium chloride) 액체 배지 또는 3%(w/v) TSB (Tryptic Soy Broth) 액체 배지에 37℃, 200 rpm 조건으로 overnight 배양한 후, 다시 동일한 조건에서 2 시간 동안 2차 배양하였다. 상기 2차 배양한 각 균주의 최종 농도가 5×105 CFU/㎖ 농도가 되도록 10 mM sodium phosphate 용액으로 희석하여 균주 용액을 준비하였다.
이어서, 96-웰 마이크로 플레이트의 각 웰에 농도를 달리하여 (최종 농도: 0 ㎍/㎖ - 200 ㎍/㎖ 펩타이드) 각 펩타이드를 100 ㎕ 씩 분주하고, 상기 준비된 균주 용액을 100 ㎕ 를 넣고 섞어 37℃ 항온기에서 1 시간 동안 반응시켰다.
그리고, LB 25 g/L 또는 TS (Tryptic Soy) 30 g/L 와 한천 15 g/L을 증류수에 녹이고 멸균한 다음 100 ㎜ 원형 플레이트에 20 ㎖을 붓고 하루 이상 실온에서 굳혀서 제조한 LB 또는 TS 한천 플레이트에 상기 펩타이드와 균주의 반응 용액을 10 ㎕씩 일정한 크기로 도말하고, 37℃ 항온기에서 18 시간 동안 배양한 뒤, 플레이트에서 콜로니 생성을 확인하였다. 박테리아 살균 최소농도는 콜로니가 단 하나도 생성되지 않은 펩타이드의 최소 농도로 정의하였고, 실험 결과는 하기 표 1과 같다.
SEQ.No | 펩타이드명 | UniPort entry | 단백질 이름 | 유전자이름 | 총 아미노산 수/항균 펩타이드 위치 | 펩타이드 서열(막 관통 도메인/아미노산 수) | 세포내 위치 | MBC 값 (μg/ml) |
막 관통 도메인 양 끝 아미노산 수 |
||
녹농균 | 황색포도상구균 | K+R | 친수성 아미노산 | ||||||||
1 | COX20-1 | Q5RI15 | Cytochrome c oxidase assembly protein COX20, mitochondrial-Human | COX20 | 118/31-57 | RHSILYGSLGSVVAGFGHFLFTSRIRR(34-51/27) | 미토콘드리아막 | 4 | 10 | 4 | 4 |
2 | HIG1A-1 | Q9Y241 | HIG1 domain family member 1A, mitochondrial-Human | HIG1A | 93/22-51 | RKAKEAPFVPVGIAGFAAIVAYGLYKLKSR(26-46/30) | 미토콘드리아막 | 3 | 11 | 6 | 1 |
3 | PIRT | P0C851 | Phosphoinositide-interacting protein-Human | PIRT | 131/84-123 | KSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQK(94-114/40) | 세포막 | 2 | 10 | 8 | 5 |
4 | HIG1C | A8MV81 | HIG1 domain family member 1C-Human | HIG1C | 97/21-51 | RKSRDSPFVPIGIAGFVTVVSCGLYKLKYRR(27-47/31) | 미토콘드리아막 | 2 | 9 | 6 | 2 |
5 | HIG2A-1 | Q9BW72 | HIG1 domain family member 2A, mitochondrial-Human | HIG2A | 106/81-105 | TRIAAQGFTVAAILLGLAVTAMKSR(83-103/25) | 미토콘드리아막 | 11 | 20 | 2 | 2 |
6 | PAPPA | Q5QFB9 | Protein PAPPAS-Human | PAPPA-AS1 | 102/7-38 | RKKHRGLFLTTVAALPIWNPISEFVKWYKSHK(13-33/32) | ER막 | 7 | 20 | 6 | 3 |
7 | PLGRKT-1 | Q9HBL7 | Plasminogen receptor-Human | PLGRKT | 147/50-76 | SREFLKYFGTFFGLAAISLTAGAIKKK(53-73/27) | 세포 막 | 7 | 80 | 4 | 1 |
8 | PGAP6 | Q9HCN3 | Post-GPI attachment to proteins factor 6-Human | PGAP6 | 771/543-568 | QQRAATLLLTLSNLMFLAPIAVSVRR(546-566/26) | 세포막, 리소좀막 | 6 | 50 | 3 | 2 |
9 | OPA1-1 | O60313 | Dynamin-like 120 kDa protein, mitochondrial-Human | OPA1 | 960/92-118 | RLATRLLKLRYLILGSAVGGGYTAKKT (97-113/27) | 미토콘드리아막 | 1 | 4 | 4 | 3 |
10 | TOMM20 | Q15388 | Mitochondrial import receptor subunit TOM20 homolog-Human | TOMM20 | 145/4-30) | RNSAIAAGVCGALFIGYCIYFDRKRRS(7-24/27) | 미토콘드리아막 | 20 | 35 | 5 | 3 |
11 | SLC25A19 | Q9HC21 | Mitochondrial thiamine pyrophosphate carrier-Human | SLC25A19 | 320(212-243) | KKNENLQNLLCGSGAGVISKTLTYPLDLFKKR(220-240/32) | 미토콘드리아막 | 5 | 30 | 5 | 4 |
12 | VKORL | Q8N0U8 | Vitamin K epoxide reductase complex subunit 1-like protein 1-Human | VKORC1L1 | 176(13-42) | RWERVARYAVCAAGILLSIYAYHVEREKER (17-37/30) | ER막 | 30 | 25 | 5 | 0 |
13 | YME1L1 | Q96TA2 | ATP-dependent zinc metalloprotease YME1L1-Human | YME1L1 | 773(291-322) | RRTRLILFVLLLFGIYGLLKNPFLSVRFRTTT(296-316/32) | 미토콘드리아막 | 6 | 18 | 5 | 4 |
14 | SLC22A14 | Q9Y267 | Solute carrier family 22 member 14-Human | SLC22A14 | 594(181-210) | TKKDTAQIMFMAGLPIGSLIFRLITDKMGR (185-205/30) | 미토콘드리아막 | 10 | 20 | 4 | 1 |
15 | SCO2 | O43819 | Protein SCO2 homolog, mitochondrial-Human | SCO2 | 266(58-82) | RTRLLITGLFGAGLGGAWLALRAEK (61-78/25) | 미토콘드리아막 | 16 | 25 | 4 | 1 |
16 | ABCB8 | Q9NUT2 | Mitochondrial potassium channel ATP-binding subunit-Human | ABCB8 | 735(291-322) | STRLTLLLMVATPALMGVGTLMGSGLRKLSRQ(296-316/32) | 미토콘드리아막 | 25 | 25 | 4 | 5 |
17 | UXS1 | Q8NBZ7 | UDP-glucuronic acid decarboxylase 1-Human | UXS1 | 420(15-44) | RRRMKLLLGIALLAYVASVWGNFVNMRSIQ(20-40/30) | 골지체막 | 24 | 25 | 5 | 2 |
18 | TOMM20L | Q6UXN7 | TOMM20-like protein 1 | TOMM20L | 152(5-34) | RSLLRLLAAAAACGAFAFLGYCIYLNRKRR(10-29/30) | 미토콘드리아막 | 16 | 10 | 6 | 2 |
19 | CNR1 | P21554 | Cannabinoid receptor 1 | CNR1 | 472(373-405) | KLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLR(378-399/33) | 미토콘드리아막, 세포막 | 12 | 24 | 5 | 2 |
20 | ARMCX3 | Q9UH62 | Armadillo repeat-containing X-linked protein 3 | ARMCX3 | 379(5-35) | RKVGWVTAGLVIGAGACYCIYRLTRGRKQNK(7-29/31) | 미토콘드리아막 | 10 | 22 | 5 | 2 |
21 | GDAP1-1 | Q8TB36 | Ganglioside-induced differentiation-associated protein 1 | GDAP1 | 358(285-318) | KRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPK(292-312/34) | 미토콘드리아막 | 1 | 4 | 8 | 2 |
22 | GDAP1-2 | Q8TB36 | Ganglioside-induced differentiation-associated protein 1 | GDAP1 | 358(313-343) | KKRAPKVLGTTLVVGLLAGVGYFAFMLFRKR(320-340/31) | 미토콘드리아막 | 4 | 6 | 7 | 0 |
23 | GPAT2 | Q6NUI2 | Glycerol-3-phosphate acyltransferase 2, mitochondrial | GPAT2 | 795(444-476) | RRLSCHVLSASVGSSAVMSTAIMATLLLFKHQK(450-472/33) | 미토콘드리아막 | 4 | 13 | 4 | 5 |
24 | CDS2 | O95674 | Phosphatidatecytidylyltransferase 2 | CDS2 | 445(160-191) | TM3.RILSKYHRFISFTLYLIGFCMFVLSLVKKHYR(166-186/32) | ER 막 | 50 | 45 | 5 | 2 |
25 | BCL2L1 | Q07817 | Bcl-2-like protein 1 | BCL2L1 | 233(204-233) | RKGQERFNRWFLTGMTVAGVVLLGSLFSRK(210-22630) | 미토콘드리아막 | 4 | 6 | 5 | 3 |
26 | ATP5MK | Q96IX5 | ATP synthase membrane subunit K, mitochondrial | ATP5MK | 58(16-51) | KKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKK(23-45/36) | 미토콘드리아막 | 80 | 80 | 6 | 3 |
27 | CEBPZOS | A8MTT3 | Protein CEBPZOS | CEBPZOS | 80(10-38) | KKIFKGVLVAELVGVFGAYFLFSKMHTSQ(15-32/29) | 미토콘드리아막 | 7 | 40 | 4 | 4 |
28 | EXD2 | Q9NVH0 | Exonuclease 3'-5' domain-containing protein 2 | EXD2 | 621(2-32) | SRQNLVALTVTTLLGVAVGGFVLWKGIQRRR(5-25/31) | 미토콘드리아막 | 14 | 70 | 5 | 3 |
29 | MIGA1 | Q8NAN2 | Mitoguardin 1 | MIGA1 | 632(64-96) | SQIKFSPVAKKLFVVTAVSAISVIFLAHFKRKR(70-90/33) | 미토콘드리아막 | 5 | 7 | 5 | 4 |
30 | RHOT1 | Q8IXI2 | Mitochondrial Rho GTPase 1 | RHOT1 | 618(588-618) | KSSTFWLRASFGATVFAVLGFAMYKALLKQR(593-615/31) | 미토콘드리아막 | 8 | 5 | 3 | 4 |
31 | MTX1 | Q13505 | Metaxin-1 | MTX1 | 466(416-445) | RRRNQILSVLAGLAAMVGYALLSGIVSIQR(421-441/30) | 미토콘드리아막 | 12 | 10 | 4 | 4 |
32 | NDUFA13 | Q9P0J0 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | NDUFA13 | 144(27-58) | RRGLSGYSMLAIGIGTLIYGHWSIMKWNRERR(30-51/32) | 미토콘드리아막 | 16 | 4 | 6 | 1 |
33 | SPNS1 | Q9H2V7 | Protein spinster homolog 1 | SPNS1 | 528(183-210 | QRSRMLSIFYFAIPVGSGLGYIAGSKVK(187-207/28) | 미토콘드리아막 | 4 | 20 | 4 | 2 |
34 | SLC25A44 | Q96H78 | Solute carrier family 25 member 44 | SLC25A44 | 314(17-49) | KKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQK(20-42/33) | 미토콘드리아막 | 8 | 3 | 5 | 3 |
35 | TMEM14A | Q9Y6G1 | Transmembrane protein 14A | TMEM14A | 99(21-51) | KRRGGVPSLIAGLFVGCLAGYGAYRVSNDKR(24-44/31) | 미토콘드리아막 | 4 | 8 | 6 | 2 |
36 | IFI6 | P09912 | Interferon alpha-inducible protein 6 | IFI6 | 130(2-27) | RQKAVSLFLCYLLLFTCSGVEAGKKK (4-24/26) | 미토콘드리아막 | 12 | 50 | 4 | 1 |
(밑줄: 막 관통 도메인 아미노산 서열)
상기 표 1에 나타낸 바와 같이, UniProt에서 탐색한 막 관통 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 36종은 우수한 항균 활성을 가짐을 확인할 수 있었다. 본 발명자는 선행연구에서 Romo1 단백질의 두 번째 막 관통 도메인을 포함하는 펩타이드가 항균 활성을 가지고 있다는 것을 발명하였고 연속된 연구에서 21개의 아미노산 잔기로 구성되어 있는 KU-5878 펩타이드의 항균활성이 가장 우수하다는 것을 발명하였다(녹농균 MBC 값: 100 μg/ml; 황색포도상구균 MBC 값: 100 μg/ml). 본 발명에서 발견한 펩타이드는 KU-5878보다 녹농균의 경우 1.25~100배, 황색포도상구균의 경우 1.25~25배 우수한 항균 활성을 가짐을 확인할 수 있었다.
실시예 3. UniProt에서 탐색한 펩타이드에서 막 관통 도메인 양 끝의 일부 아미노산이 결핍된 펩타이드의 항균 활성 확인
UniProt에서 탐색한 펩타이드에서 막 관통 도메인 양 끝 부분이 일부 결핍된 펩타이드의 항균 활성 확인하기 위하여 상기 표 1에 나타낸 합성 펩타이드 중 COX20-1 펩타이드를 대표로 선정하여 녹농균과 황색포도상구균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다. COX20-1 펩타이드의 양끝에서 일부 아미노산이 결핍된 아미노산 서열을 포함하는 3종의 펩타이드 (서열번호 37, 38, 39)를 합성하여 박테리아 살균 최소 농도 측정법을 통해 각 펩타이드의 항균 활성을 비교 확인하였다 (각 펩타이드의 정보는 하기 표 2 참조). 동일한 실험으로 HIG1A-1 펩타이드의 양끝에서 일부 아미노산이 결핍된 아미노산 서열을 포함하는 2종의 펩타이드 (서열번호 40, 41)를 합성하여 박테리아 살균 최소 농도 측정법을 통해 각 펩타이드의 항균 활성을 비교 확인하였다 (각 펩타이드의 정보는 하기 표 2 참조).
SEQ.No | 펩타이드 이름 | UniPort entry | 단백질 이름 | 유전자이름 | 총 아미노산 수/항균 펩타이드 위치 | 펩타이드 서열(막 관통 도메인/아미노산 수) | 세포내 위치 | MBC 값 (μg/ml) |
막 관통 도메인 양 끝 아미노산 수 |
||
녹농균 | 황색포도상구균 | K+R | 친수성 아미노산 | ||||||||
1 | COX20-1 | Q5RI15 | Cytochrome c oxidase assembly protein COX20, mitochondrial-Human | COX20 | 118/31-57 | RHSILYGSLGSVVAGFGHFLFTSRIRR(34-51/27) | 미토콘드리아막 | 4 | 10 | 4 | 4 |
37 | COX20-2 | Q5RI15 | Cytochrome c oxidase assembly protein COX20, mitochondrial-Human | COX20 | 118/33-57 | SILYGSLGSVVAGFGHFLFTSRIRR(34-51/25) | 미토콘드리아막 | 30 | 55 | 3 | 3 |
38 | COX20-3 | Q5RI15 | Cytochrome c oxidase assembly protein COX20, mitochondrial-Human | COX20 | 118/31-54 | RHSILYGSLGSVVAGFGHFLFTSR(34-51/24) | 미토콘드리아막 | 25 | 200< | 2 | 4 |
39 | COX20-0 | Q5RI15 | Cytochrome c oxidase assembly protein COX20, mitochondrial-Human | COX20 | 118/34-51 | ILYGSLGSVVAGFGHFLF(34-51/18) | 미토콘드리아막 | 200< | 200< | 0 | 0 |
2 | HIG1A-1 | Q9Y241 | HIG1 domain family member 1A, mitochondrial-Human | HIG1A | 93/22-51 | RKAKEAPFVPVGIAGFAAIVAYGLYKLKSR(26-46/30) | 미토콘드리아막 | 3 | 11 | 6 | 1 |
40 | HIG1A-2 | Q9Y241 | HIG1 domain family member 1A, mitochondrial-Human | HIG1A | 93/23-49 | KAKEAPFVPVGIAGFAAIVAYGLYKLK(26-46/27) | 미토콘드리아막 | 11 | 200< | 4 | 0 |
41 | HIG1A-0 | Q9Y241 | HIG1 domain family member 1A, mitochondrial-Human | HIG1A | 93/26-46 | EAPFVPVGIAGFAAIVAYGLY(26-46/21) | 미토콘드리아막 | 200< | 200< | 0 | 0 |
상기 표 2에 나타낸 바와 같이, 막 관통 도메인 양 끝의 일부 아미노산을 결핍할 경우 펩타이드의 항균 활성이 처음 항균 활성을 나타냈던 펩타이드 (서열번호 1 또는 2)에 비해 감소하는 것을 확인하였고, 특히 세포막 관통 펩타이드 도메인 양 끝에 염기성 또는 극성 아미노산이 없는 펩타이드는 항균 활성이 낮아서 박테리아 살균 최소 농도 측정법을 이용하여 측정이 불가능하였다(서열번호 39, 41). 따라서 막 관통 도메인 양 끝의 염기성 아미노산과 극성 아미노산 서열이 항균 활성에 영향을 준다는 것을 알 수 있다.
실시예 4. 막 관통 도메인 양 끝에 염기성 아미노산을 인위적으로 부착하여 합성한 펩타이드의 항균 활성 확인
본 발명에서는 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드군이 선행 연구에서 발명한 KU-5878보다 우수한 항균활성을 나타냄을 확인하였다 (상기 실시예 2). 이들 항균 펩타이드군은 자연계에서 존재하는 아미노산 서열을 포함하는 펩타이드이다. 본 실시 예에서는 이들 항균 펩타이드군과 유사한 특징을 가지고 자연계에서 존재하지 않는 아미노산 서열로 이루어진 펩타이드를 합성하여 박테리아 살균 최소 농도 측정법을 통해 각 펩타이드의 항균 활성을 비교 확인하였다 (각 펩타이드의 정보는 하기 표 3 참조).
KU-5878의 경우 막 관통 도메인은 58번째 아미노산으로부터 77번 아미노산에 해당한다. 막 관통 도메인 오른쪽에는 아르기닌(R)이 한 개 존재하지만 왼쪽에는 염기성 아미노산이 존재하지 않는다. 그렇지만 막 관통 도메인 내부의 왼쪽에 염기성 아미노산 라이신(K)이 한 개가 존재한다. 본 발명에서는 막 관통 도메인 양쪽에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드의 항균 활성을 확인하였다. 표 3에서와 같이 HIG1A, COX20 단백질의 막 관통 도메인에 라이신(K) 또는 아르기닌(R)을 각각 1개에서 5개까지 인위적으로 부착하여 합성한 펩타이드의 항균 활성을 측정하였다.
SEQ.No | 펩타이드 이름 | UniPort entry | 단백질 이름 | 유전자이름 | 총 아미노산 수/항균 펩타이드 위치 | 펩타이드 서열(막 관통 도메인/아미노산 수) | 세포내 위치 | MBC 값 (μg/ml) |
막 관통 도메인 양 끝 아미노산 수 |
||
녹농균 | 황색포도상구균 | K+R | 친수성 아미노산 | ||||||||
41 | HIG1A-0 | Q9Y241 | HIG1 domain family member 1A, mitochondrial-Human | HIG1A | 93/26-46 | EAPFVPVGIAGFAAIVAYGLY(26-46/21) | 미토콘드리아막 | 200< | 200< | 0 | 0 |
42 | HIG1A-0-K1 | - | - | - | - | KEAPFVPVGIAGFAAIVAYGLYK(23) | - | 200< | 200< | 2 | 0 |
43 | HIG1A-0-K2 | - | - | - | - | KKEAPFVPVGIAGFAAIVAYGLYKK(25) | - | 18 | 100 | 4 | 0 |
44 | HIG1A-0-K3 | - | - | - | - | KKKEAPFVPVGIAGFAAIVAYGLYKKK(27) | - | 2 | 2 | 6 | 0 |
45 | HIG1A-0-K4 | - | - | - | - | KKKKEAPFVPVGIAGFAAIVAYGLYKKKK(29) | - | 1 | 2 | 8 | 0 |
46 | HIG1A-0-K5 | - | - | - | - | KKKKKEAPFVPVGIAGFAAIVAYGLYKKKKK(31) | - | 1 | 2 | 10 | 0 |
47 | HIG1A-0-R2 | - | - | - | - | RREAPFVPVGIAGFAAIVAYGLYRR(25) | - | 12 | 15 | 4 | 0 |
48 | HIG1A-0-R3 | - | - | - | - | RRREAPFVPVGIAGFAAIVAYGLYRRR(27) | - | 5 | 2 | 6 | 0 |
49 | HIG1A-0-R4 | - | - | - | - | RRRREAPFVPVGIAGFAAIVAYGLYRRRR(29) | - | 1 | 1 | 8 | 0 |
50 | COX20-0-K2 | - | - | - | - | KKILYGKLGKVVAGFGHFLFKK (22) | - | 7 | 18 | 4 | 0 |
51 | COX20-0-K3 | - | - | - | - | KKKILYGKLGKVVAGFGHFLFKKK (24) | - | 5 | 5 | 6 | 0 |
52 | COX20-0-R2 | - | - | - | - | RRILYGKLGKVVAGFGHFLFRR (22) | - | 5 | 10 | 4 | 0 |
53 | COX20-0-R3 | - | - | - | - | RRRILYGKLGKVVAGFGHFLFRRR (24) | - | 5 | 3 | 6 | 0 |
54 | SLC25A6-0 | P12236 | ADP/ATP translocase 3 | SLC25A6 | 298/75-99 | LANVIRYFPTQALNFAFKDKYKQIF(75-99/25) | 미토콘드리아막 | 200<x | 200<x | 0 | 0 |
55 | SLC25A6-0-K1 | - | - | - | - | KLANVIRYFPTQALNFAFKDKYKQIFK(75-99/27) | - | 4 | 50 | 2 | 0 |
56 | SLC25A6-0-K2 | - | - | - | - | KKLANVIRYFPTQALNFAFKDKYKQIFKK(75-99/29) | - | 1 | 40 | 4 | 0 |
57 | SLC25A6-0-K3 | - | - | - | - | KKKLANVIRYFPTQALNFAFKDKYKQIFKKK(75-99/31) | - | 1 | 30 | 6 | 0 |
58 | ATP5MC2 | Q06055 | ATP synthase F(0) complex subunit C2, mitochondrial | ATP5MC2 | 141/80-104 | ATVGVAGSGAGIGTVFGSLIIGYAR (82-102/25) | 미토콘드리아막 | <200 | <200 | 1 | 1 |
59 | ATP5MC2-0-K4 | - | - | - | - | KKKKVGVAGSGAGIGTVFGSLIIGYKKKK(29) | - | 4 | 8 | 8 | 0 |
60 | NDUFC2(NDn-1) | O95298 | NADH dehydrogenase [ubiquinone] 1 subunit C2 | NDUFC2 | 119/54-77 | TAGLHRQLLYITAFFFAGYYLVKR(56-75/24) | 미토콘드리아막 | <200 | <200 | 2 | 1 |
61 | NDUFC2 (NDn-1)-0-K4 | - | - | - | - | KKKKGLHRQLLYITAFFFAGYYLVKKKK (28) | - | 3 | 30 | 8 | 0 |
62 | HIGD2B | Q4VC39 | Putative HIG1 domain family member 2B | HIGD2B | 106/80-104 | HTQIAAQGFTIAAILLGLAATAMKS(82-102/25) | 미토콘드리아막 | <200 | <200 | 1 | 3 |
63 | HIGD2B-0-K4 | - | - | - | - | KKKKQIAAQGFTIAAILLGLAATAMKKKK (29) | - | 4 | 20 | 8 | 0 |
64 | ZDH23-K4-> ZDH23-0-K4 | Q8IYP9 (TMD number) | Palmitoyltransferase ZDHHC23 (TMD only) | - | KKKKVGPVQLAVLTCGLFLILLALHKKKK(166-186/29) | - | 3 | 10 | 8 | 0 | |
65 | PGAP6-K4-> PGAP6-0-K4 | Q9HCN3 (TMD number) | Post-GPI attachment to proteins factor 6 (TMD only) | PGAP6 (TMD only) | - | KKKKAATLLLTLSNLMFLAPIAVSVKKKK(546-566/29) | - | 1 | 30 | 8 | 0 |
66 | GHITM-K4->GHITM-0-K4 | Q9H3K2 (TMD number) |
Growth hormone-inducible transmembrane protein (TMD only) | GHITM (TMD only) | - | KKKKSTYMYLAGSIGLTALSAIAISKKKK(126-146/29) | - | 3 | 6 | 8 | 0 |
표 2와 3에서 나타낸 바와 같이, 세포막 관통 도메인 양 끝에 염기성 또는 극성 아미노산이 없는 펩타이드는 항균 활성이 낮아서 박테리아 살균 최소 농도 측정법을 이용하여 측정이 불가능하였지만, 상기 표 3에서 확인할 수 있는 바와 같이, 라이신 또는 아르기닌을 각각 2개 이상 인위적으로 부착하여 합성한 펩타이드군은 KU-5878보다 우수한 항균 활성을 나타냄을 알 수 있었다.
또한 탐색을 통해 서열번호 54, 58, 60, 62, 64, 65, 66번에 대한 막 관통 도메인을 추가 합성하고 도메인 양 끝에 라이신(K)을 1개에서 4개까지 인위적으로 부착하여 합성한 펩타이드의 항균 활성을 측정한 결과, 라이신을 인위적으로 부착했을 때, 각 펩타이드의 항균 활성이 증가한 것을 알 수 있었다.
실시예 5. 표 1과 3에서 확인한 항균 펩타이드 중에서 대표 펩타이드의 다양한 박테리아에 대한 항균 활성 확인
상기 실시예 2와 4에서 항균활성을 확인한 펩타이드가 살균력을 발휘하는 세균의 종류를 확인하기 위하여, 상기 표 1에 나타낸 합성 펩타이드 중 OPA1-1, HIG1C, COX20-1 3개의 펩타이드와 표 3에 나타낸 합성 펩타이드 중 HIG1A-0-K4, HIG1A-0-R4 2개의 펩타이드를 대표로 선정하여 하기 표 4에 나타낸 세균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다.
구체적으로, 각 세균을 3%(w/v) TSB (Tryptic Soy Broth) 액체 배지에 37℃ 200 rpm 조건으로 overnight 배양한 후, 다시 동일한 조건에서 2 시간 동안 2차 배양하였다. 상기 2차 배양한 각 균주의 최종 농도가 5Х105 CFU/㎖ 농도가 되도록 10 mM sodium phosphate 용액으로 희석하여 균주 용액을 준비하였다.
이어서, 96-웰 마이크로 플레이트의 각 웰에 농도를 달리하여 (최종 농도: 0 ㎍/㎖ - 200 ㎍/㎖ 펩타이드) 각 펩타이드를 분주하고, 상기 준비된 균주 용액을 100 ㎕ 를 넣고 섞어 37℃항온기에서 1 시간 동안 반응시켰다.
그리고, TS (Tryptic Soy) 30 g/L 및 한천 15 g/L을 증류수에 녹이고 멸균한 다음 100 ㎜ 원형 플레이트에 20 ㎖을 붓고 하루 이상 실온에서 굳혀서 제조한 TS 한천 플레이트에 상기 펩타이드와 균주의 반응 용액을 10 ㎕씩 일정한 크기로 도말하고, 37℃항온기에서 18 시간 동안 배양한 뒤, 플레이트에서 콜로니 생성을 확인하였다. 박테리아 살균 최소농도는 콜로니가 단 하나도 생성되지 않은 펩타이드의 최소 농도로 정의하였고, 실험 결과는 하기 표 4와 같다.
SEQ.No | 펩타이드 이름 | Enterococcus faecium (14475) MBC 값 (μg/ml) | E. coli MBC 값 (μg/ml) | Acinetobacter baumannii MBC 값 (μg/ml) |
1 | COX20-1 | 7 | 4 | 2 |
4 | HIG1C | 3 | 4 | 2 |
9 | OPA1-1 | 3 | 1 | 1 |
45 | HIG1A-0-K4 | 1 | 3 | 3 |
49 | HIG1A-0-R4 | 2 | 2 | 3 |
상기 표 4에서 확인할 수 있는 바와 같이, 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드는 그람 양성균, 그람 음성균 박테리아 모두에게서 광범위한 항균 활성을 나타냄을 알 수 있었다.
실시예 6. 표 1과 3에서 확인한 항균 펩타이드 중에서 대표 펩타이드의 다제내성 박테리아에서 항균 활성 확인
상기 실시예 2와 4에서 항균활성을 확인한 펩타이드가 다제내성 박테리아에서 항균 활성 확인하기 위하여, 상기 표 1에 나타낸 합성 펩타이드 중 OPA1-1, HIG1C, COX20-1 3개의 펩타이드와 표 3에 나타낸 합성 펩타이드 중 HIG1A-0-K4, HIG1A-0-R4 2개의 펩타이드를 대표로 선정하여 하기 표 5에 나타낸 세균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다.
한편, 하기 표 5에서 다제내성 녹농균 과 다제내성 아시네토박터는 고려대학교 안암병원의 환자로부터 분리한 균으로서, 다제내성 녹농균의 경우 피페라실린(piperacilin), 피페라실린타조박탐(piperacilin-tazobactam), 세프타지딤(ceftazidime), 이미페넴(imipenem), 메로페넴(meropenem), 젠타마이신(gentamicin), 아미카신(amikacin), 및 시프로플록사신(ciprofloxacin) 항생제에 내성을 나타내고, 다제내성 아시네토박터는 피페라실린, 피페라실린타조박탐, 세프타지딤, 이미페넴, 메로페넴, 젠타마이신, 아미카신, 시프로플록사신, 및 세페핌(cefepime) 항생제에 내성을 나타냄을 확인하고 실험에 이용하였다.
또한, 하기 표 5에서 반코마이신 내성 엔테로코커스 패시움 및 반코마이신 내성 황색포도상구균은 국가병원체자원은행(national culture collection for pathogens, NCCP)에서 구입하였으며, 반코마이신 내성 엔테로코커스 패시움은 반코마이신, 리팜핀(rifampin), 테트라사이클린, 젠타마이신, 에리트로마이신(erythromycin), 스트렙토마이신(streptomycin) 및 암피실린(ampicillin)에 내성을 가지며, 반코마이신 내성 황색포도상구균은 반코마이신, 옥사실린(oxacillin), 벤질페니실린(benzylpenicillin), 암피실린 및 세파졸린(cefazolin)에 내성을 가짐을 확인하고 실험에 이용하였다.
SEQ.No | 펩타이드 이름 | 다제내성 녹농균 MBC 값 (μg/ml) | 다제내성 포도상구균(16870) MBC 값 (μg/ml) | 다제내성 Enterococcus faecium (14475) MBC 값 (μg/ml) | 다제내성 Acinetobacter baumannii MBC 값 (μg/ml) |
1 | COX20-1 | 6 | 18 | 7 | 4 |
4 | HIG1C | 2 | 8 | 2 | 2 |
9 | OPA1-1 | 0.5 | 6 | 2 | 1 |
45 | HIG1A-0-K4 | 3 | 2 | 1 | 3 |
49 | HIG1A-0-R4 | 2 | 2 | 2 | 2 |
상기 표 5에서 확인할 수 있는 바와 같이, 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드는 다제내성 그람 양성균, 다제내성 그람 음성균 박테리아 모두에게서 광범위한 항균 활성을 나타냄을 알 수 있었다.
실시예 7. 표 1에서의 향균 펩타이드의 일부 펩타이드에서 다른 종에 해당하는 단백질 중 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드의 항균 활성 확인
본 발명자는 앞선 실시예 1에서 사람 단백질 중 막 관통 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 펩타이드가 우수한 항균 활성을 가짐을 확인하였고, 이것이 다른 종의 단백질 중에서도 동일한 모티프의 펩타이드가 항균 활성을 가진다는 것을 확인하기 위하여 하기 표 6에 나타낸 펩타이드를 합성하고 녹농균과 황색포도상구균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다.
SEQ.No | 펩타이드 이름 | UniPort entry | 단백질 이름 | 유전자이름 | 펩타이드 서열(막 관통 도메인/아미노산 수) | 세포내 위치 | MBC 값 (μg/ml) |
막 관통 도메인 양 끝 아미노산 수 |
||
녹농균 | 황색포도상구균 | K+R | 친수성 아미노산 | |||||||
67 | COX-20-mouse | Q9D7J4 | Cytochrome c oxidase assembly protein COX20, mitochondrial | COX-20 | RESILYGSLGSIVTGLGHFLVTSRIRR (27) | 미토콘드리아막 | 30 | 80 | 4 | 3 |
68 | OPA1-rat | Q2TA68 | Dynamin-like 120 kDa protein, mitochondrial | OPA1 | RLAARLLKLRYIILGSAVGGGYTAKKT (97-113/27) | 미토콘드리아막 | 2 | 2 | 4 | 2 |
69 | GDAP1-bovine | A6QQZ0 | Ganglioside-induced differentiation-associated protein 1 | GDAP1 | KRKTFNKVLGHVNNILISAVLPTAFRVAKKR (292-312/31) | 미토콘드리아막 | 4 | 4 | 7 | 2 |
70 | BCL2L1-chick | Q07816 | Bcl-2-like protein 1 | BCL2L1 | RKGQETFNKWLLTGATVAGVLLLGSLLSRK (206-223/30) | 미토콘드리아막 | 8 | 8 | 4 | 4 |
상기 표 6에서 확인할 수 있는 바와 같이, 다른 종에 해당하는 단백질 중 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 역시 항균 활성을 가진다는 것을 알 수 있었다.
실시예 8. 서로 다른 두가지 이상의 항균 펩타이드의 세포막 관통 도메인과 도메인 양 끝의 N-말단과 C-말단의 서열을 융합하여 합성한 펩타이드의 항균 활성 확인
본 발명자들은 앞선 실시예의 항균 펩타이드 중 서열번호 5, 60번의 막 관통 도메인과, 서열번호 40의 도메인 양 끝의 아미노산 서열(KAK---KLK)을 융합하여 제작한 뒤, 녹농균과 황색포도상구균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다. 그 결과 서열번호 5, 60번의 막 관통 도메인은 그 자체로 항균 활성이 없지만 이들 막 관통 도메인과 양 끝에 각각 4개의 염기성 아미노산으로 이루어진 새로운 융합 펩타이드가 우수한 항균 활성을 나타내는 것을 확인하였다 (서열번호 71, 72).
SEQ.No | 펩타이드 이름 | 막 관통 도메인의 UniPort entry | 막 관통 도메인의 단백질 이름 | 펩타이드 서열(막 관통 도메인/아미노산 수) | MBC 값 (μg/ml) |
막 관통 도메인 양 끝 아미노산 수 |
||
녹농균 | 황색포도상구균 | K+R | 친수성 아미노산 | |||||
71 | HI2-m1 | Q9BW72 | HIG1 domain family member 2A, mitochondrial-Human | KAKIAAQGFTVAAILLGLAVTAMKKLK (27) | 3 | 12 | 4 | 0 |
72 | NDn-1-m1 | O95298 | NADH dehydrogenase [ubiquinone] 1 subunit C2 | KAKGLHRQLLYITAFFFAGYYLVKLK (26) | 13 | 25 | 4 | 0 |
상기 표 7에서 확인할 수 있는 바와 같이, 앞선 실시예와 같은 패턴의 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 융합 펩타이드 역시 모두 우수한 항균 활성을 나타내는 것을 확인하였다.
이제까지 본 발명에 대하여 그 바람직한 실시예들을 중심으로 살펴보았다. 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자는 본 발명이 본 발명의 본질적인 특성에서 벗어나지 않는 범위에서 변형된 형태로 구현될 수 있음을 이해할 수 있을 것이다. 그러므로 개시된 실시예들은 한정적인 관점이 아니라 설명적인 관점에서 고려되어야 한다. 본 발명의 범위는 전술한 설명이 아니라 특허청구범위에 나타나 있으며, 그와 동등한 범위 내에 있는 모든 차이점은 본 발명에 포함된 것으로 해석되어야 할 것이다.
Claims (15)
15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 합이 3개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드.
제 1항에 있어서,
상기 트랜스멤브레인 도메인(transmembrane domain, TMD)은 서열번호 39, 41, 54, 73 내지 78 중 어느 하나인 융합 폴리펩타이드.
상기 트랜스멤브레인 도메인(transmembrane domain, TMD)은 서열번호 39, 41, 54, 73 내지 78 중 어느 하나인 융합 폴리펩타이드.
제 1항에 있어서,
상기 말단 아미노산은 C-말단 및 N-말단 각각에 2 내지 6개의 아미노산이 결합된 것인 융합 폴리펩타이드.
상기 말단 아미노산은 C-말단 및 N-말단 각각에 2 내지 6개의 아미노산이 결합된 것인 융합 폴리펩타이드.
제 1항에 있어서,
상기 말단 아미노산은 염기성 아미노산 및 극성 아미노산으로 이루어진 군으로부터 선택되는 것인 융합 폴리펩타이드.
상기 말단 아미노산은 염기성 아미노산 및 극성 아미노산으로 이루어진 군으로부터 선택되는 것인 융합 폴리펩타이드.
제 1항에 있어서,
상기 말단 아미노산은 라이신, 아르기닌, 히스티딘, 세린, 트레오닌 시스테인, 글루타민, 아르파라긴 및 티로신 중 어느 하나인 융합 폴리펩타이드.
상기 말단 아미노산은 라이신, 아르기닌, 히스티딘, 세린, 트레오닌 시스테인, 글루타민, 아르파라긴 및 티로신 중 어느 하나인 융합 폴리펩타이드.
제 1항에 있어서,
상기 융합 폴리펩타이드는 서열번호 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65, 66, 71 및 72 중 어느 하나인 융합 폴리펩타이드.
상기 융합 폴리펩타이드는 서열번호 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65, 66, 71 및 72 중 어느 하나인 융합 폴리펩타이드.
제 1항의 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드.
제 7항에 있어서,
상기 폴리펩타이드는 N-말단 또는 C-말단에 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)을 더 포함하는 것인 항균 폴리펩타이드.
상기 폴리펩타이드는 N-말단 또는 C-말단에 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)을 더 포함하는 것인 항균 폴리펩타이드.
제 7항에 있어서,
상기 폴리펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 갖는 것을 특징으로 하는 항균 폴리펩타이드.
상기 폴리펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 갖는 것을 특징으로 하는 항균 폴리펩타이드.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 유효성분으로 포함하는 항생제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 식품 첨가제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 사료 첨가제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 화장료 조성물.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 항균용 생물 농약 제제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 항균용 의약외품 조성물.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/KR2023/012962 WO2024049232A1 (ko) | 2022-09-01 | 2023-08-31 | 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220110830 | 2022-09-01 | ||
KR20220110830 | 2022-09-01 |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20240032667A true KR20240032667A (ko) | 2024-03-12 |
Family
ID=90299722
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020230114740A KR20240032667A (ko) | 2022-09-01 | 2023-08-30 | 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR20240032667A (ko) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20200072112A (ko) | 2018-12-12 | 2020-06-22 | 주식회사 오픈시스넷 | 개인의 상황을 파악한 개인 맞춤형 비정상 생체 신호 감지를 위한 사물 인터넷 디바이스 연동 시스템 및 그 제어 방법 |
KR20200072111A (ko) | 2018-12-12 | 2020-06-22 | 현대자동차주식회사 | 변형 헤드라이닝 장치 |
-
2023
- 2023-08-30 KR KR1020230114740A patent/KR20240032667A/ko unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20200072112A (ko) | 2018-12-12 | 2020-06-22 | 주식회사 오픈시스넷 | 개인의 상황을 파악한 개인 맞춤형 비정상 생체 신호 감지를 위한 사물 인터넷 디바이스 연동 시스템 및 그 제어 방법 |
KR20200072111A (ko) | 2018-12-12 | 2020-06-22 | 현대자동차주식회사 | 변형 헤드라이닝 장치 |
Non-Patent Citations (4)
Title |
---|
Lee et al., J. Cell Biol., 217, 2059-2071, 2018 |
Lee et al., mBio. 11, e03258-19, 2020 |
WHO, Global Priority List of Antibiotic-Resistant Bacteria to Guide Research, Discovery, and Development of New Antibiotics (2017. 2. 27) |
Yoo et al., Int J Mol Sci. 22, 8243, 2021 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102499670B1 (ko) | 라이신 치환을 포함하는 Romo1 유래 항균 펩타이드 및 그 변이체 | |
Campoli-Richards et al. | Teicoplanin: a review of its antibacterial activity, pharmacokinetic properties and therapeutic potential | |
ES2952858T3 (es) | Nuevos polipéptidos y uso médico de los mismos | |
KR102224929B1 (ko) | 해삼에서 분리한 항균 펩타이드로부터 유래한 신규 항균 펩타이드 및 이의 용도 | |
WO1997018827A1 (en) | Compositions and methods for the prevention and treatment of oral mucositis | |
US11479587B2 (en) | Cationic intrinsically disordered antimicrobial peptides | |
KR102415725B1 (ko) | 신규한 항균 펩타이드 h123 및 이의 용도 | |
US20100166708A1 (en) | Antimicrobial and anti-inflammatory therapies and compositions | |
US20210260070A1 (en) | Lysin cf-301 resensitizes methicillin-resistant staphylococcus aureua (mrsa) to penicillin derivatives and first generation cephalosporins | |
WO2020076381A1 (en) | Anti-microbial peptides | |
TW201028154A (en) | Antibiotic synergism | |
KR20240032667A (ko) | 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 | |
WO2024049232A1 (ko) | 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 | |
US10150795B2 (en) | Peptide having antimicrobial activity against pathogens and antimicrobial peptide composition comprising the same | |
EP3845237A2 (en) | Use of recombinant antibacterial protein ablysin for effectively killing multidrug-resistant pathogenic bacteria | |
KR102381481B1 (ko) | 신규한 항균 펩타이드 또는 펩타이드 유사체 및 이의 용도 | |
JP3488133B2 (ja) | 抗菌性ペプチド | |
KR102430003B1 (ko) | 아메리카왕거저리 유충으로부터 유래된 펩타이드인 조포바신-1 및 이의 용도 | |
KR102492395B1 (ko) | 호랑나비 유충으로부터 유래된 펩타이드인 파필리오신-3 및 이의 용도 | |
AU704851B2 (en) | Compositions and methods for the prevention and treatment of oral mucositis | |
KR102511151B1 (ko) | 왕지네 유래 펩타이드 스콜로펜드라신-13을 포함하는 항균 조성물 | |
US20090149391A1 (en) | Novel antimicrobial bolisin peptides | |
WO2022261360A1 (en) | Plyss2 lysins and variants thereof for use against multidrug resistant gram-positive bacteria | |
CN112194707A (zh) | 一种新型蜂毒肽及其应用 |