WO2022261360A1 - Plyss2 lysins and variants thereof for use against multidrug resistant gram-positive bacteria - Google Patents
Plyss2 lysins and variants thereof for use against multidrug resistant gram-positive bacteria Download PDFInfo
- Publication number
- WO2022261360A1 WO2022261360A1 PCT/US2022/032883 US2022032883W WO2022261360A1 WO 2022261360 A1 WO2022261360 A1 WO 2022261360A1 US 2022032883 W US2022032883 W US 2022032883W WO 2022261360 A1 WO2022261360 A1 WO 2022261360A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- resistant
- multidrug
- lysin polypeptide
- antibiotic
- Prior art date
Links
- 241000192125 Firmicutes Species 0.000 title claims abstract description 118
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 466
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims abstract description 453
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 448
- 229920001184 polypeptide Polymers 0.000 claims abstract description 441
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims abstract description 149
- 230000003115 biocidal effect Effects 0.000 claims abstract description 108
- 239000003242 anti bacterial agent Substances 0.000 claims abstract description 105
- 238000000034 method Methods 0.000 claims abstract description 84
- 229940088710 antibiotic agent Drugs 0.000 claims abstract description 80
- 230000012010 growth Effects 0.000 claims abstract description 61
- 150000001413 amino acids Chemical group 0.000 claims abstract description 43
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 24
- 208000035143 Bacterial infection Diseases 0.000 claims abstract description 23
- 208000022362 bacterial infectious disease Diseases 0.000 claims abstract description 19
- 230000002147 killing effect Effects 0.000 claims abstract description 18
- 241000894006 Bacteria Species 0.000 claims description 83
- 235000001014 amino acid Nutrition 0.000 claims description 83
- 238000006467 substitution reaction Methods 0.000 claims description 77
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 claims description 58
- 241000191967 Staphylococcus aureus Species 0.000 claims description 41
- 229960001019 oxacillin Drugs 0.000 claims description 41
- UWYHMGVUTGAWSP-JKIFEVAISA-N oxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1 UWYHMGVUTGAWSP-JKIFEVAISA-N 0.000 claims description 41
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 claims description 35
- -1 clindamycin) Chemical compound 0.000 claims description 35
- 229960003085 meticillin Drugs 0.000 claims description 35
- GSDSWSVVBLHKDQ-JTQLQIEISA-N Levofloxacin Chemical compound C([C@@H](N1C2=C(C(C(C(O)=O)=C1)=O)C=C1F)C)OC2=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-JTQLQIEISA-N 0.000 claims description 33
- 229960003376 levofloxacin Drugs 0.000 claims description 33
- 229940036735 ceftaroline Drugs 0.000 claims description 31
- ZCCUWMICIWSJIX-NQJJCJBVSA-N ceftaroline fosamil Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OCC)C=2N=C(NP(O)(O)=O)SN=2)CC=1SC(SC=1)=NC=1C1=CC=[N+](C)C=C1 ZCCUWMICIWSJIX-NQJJCJBVSA-N 0.000 claims description 31
- 108010013198 Daptomycin Proteins 0.000 claims description 29
- 229960005484 daptomycin Drugs 0.000 claims description 29
- DOAKLVKFURWEDJ-QCMAZARJSA-N daptomycin Chemical compound C([C@H]1C(=O)O[C@H](C)[C@@H](C(NCC(=O)N[C@@H](CCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](C(=O)N1)[C@H](C)CC(O)=O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CCCCCCCCC)C(=O)C1=CC=CC=C1N DOAKLVKFURWEDJ-QCMAZARJSA-N 0.000 claims description 29
- 229960003276 erythromycin Drugs 0.000 claims description 29
- 229940124530 sulfonamide Drugs 0.000 claims description 28
- 150000003456 sulfonamides Chemical class 0.000 claims description 28
- IEDVJHCEMCRBQM-UHFFFAOYSA-N trimethoprim Chemical compound COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 IEDVJHCEMCRBQM-UHFFFAOYSA-N 0.000 claims description 28
- 229960001082 trimethoprim Drugs 0.000 claims description 28
- 229960002227 clindamycin Drugs 0.000 claims description 26
- KDLRVYVGXIQJDK-AWPVFWJPSA-N clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 claims description 26
- 239000004098 Tetracycline Substances 0.000 claims description 25
- 229960002180 tetracycline Drugs 0.000 claims description 25
- 229930101283 tetracycline Natural products 0.000 claims description 25
- 235000019364 tetracycline Nutrition 0.000 claims description 25
- 150000003522 tetracyclines Chemical class 0.000 claims description 25
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 claims description 24
- 229960003722 doxycycline Drugs 0.000 claims description 24
- WZRJTRPJURQBRM-UHFFFAOYSA-N 4-amino-n-(5-methyl-1,2-oxazol-3-yl)benzenesulfonamide;5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1.COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 WZRJTRPJURQBRM-UHFFFAOYSA-N 0.000 claims description 22
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 claims description 22
- 229930182566 Gentamicin Natural products 0.000 claims description 22
- 229940047766 co-trimoxazole Drugs 0.000 claims description 22
- 229960002518 gentamicin Drugs 0.000 claims description 22
- 229960003907 linezolid Drugs 0.000 claims description 22
- TYZROVQLWOKYKF-ZDUSSCGKSA-N linezolid Chemical compound O=C1O[C@@H](CNC(=O)C)CN1C(C=C1F)=CC=C1N1CCOCC1 TYZROVQLWOKYKF-ZDUSSCGKSA-N 0.000 claims description 22
- 108010059993 Vancomycin Proteins 0.000 claims description 18
- 229960003165 vancomycin Drugs 0.000 claims description 18
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 claims description 18
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 claims description 18
- OJMMVQQUTAEWLP-UHFFFAOYSA-N Lincomycin Natural products CN1CC(CCC)CC1C(=O)NC(C(C)O)C1C(O)C(O)C(O)C(SC)O1 OJMMVQQUTAEWLP-UHFFFAOYSA-N 0.000 claims description 17
- 229940126575 aminoglycoside Drugs 0.000 claims description 17
- 229940124307 fluoroquinolone Drugs 0.000 claims description 17
- 238000001990 intravenous administration Methods 0.000 claims description 17
- 239000003835 ketolide antibiotic agent Substances 0.000 claims description 17
- OJMMVQQUTAEWLP-KIDUDLJLSA-N lincomycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@@H](C)O)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 OJMMVQQUTAEWLP-KIDUDLJLSA-N 0.000 claims description 17
- 229960005287 lincomycin Drugs 0.000 claims description 17
- 102220232846 rs1085307645 Human genes 0.000 claims description 17
- 108010028921 Lipopeptides Proteins 0.000 claims description 16
- MYPYJXKWCTUITO-KIIOPKALSA-N chembl3301825 Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)C(O)[C@H](C)O1 MYPYJXKWCTUITO-KIIOPKALSA-N 0.000 claims description 16
- 238000001802 infusion Methods 0.000 claims description 16
- 239000003120 macrolide antibiotic agent Substances 0.000 claims description 15
- 229930186147 Cephalosporin Natural products 0.000 claims description 13
- 108010015899 Glycopeptides Proteins 0.000 claims description 13
- 102000002068 Glycopeptides Human genes 0.000 claims description 13
- 229940124587 cephalosporin Drugs 0.000 claims description 13
- 150000001780 cephalosporins Chemical class 0.000 claims description 13
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 claims description 12
- IZXIZTKNFFYFOF-UHFFFAOYSA-N 2-Oxazolidone Chemical class O=C1NCCO1 IZXIZTKNFFYFOF-UHFFFAOYSA-N 0.000 claims description 12
- 206010014665 endocarditis Diseases 0.000 claims description 12
- 150000003952 β-lactams Chemical class 0.000 claims description 12
- WZPBZJONDBGPKJ-VEHQQRBSSA-N aztreonam Chemical compound O=C1N(S([O-])(=O)=O)[C@@H](C)[C@@H]1NC(=O)C(=N/OC(C)(C)C(O)=O)\C1=CSC([NH3+])=N1 WZPBZJONDBGPKJ-VEHQQRBSSA-N 0.000 claims description 10
- 229960003644 aztreonam Drugs 0.000 claims description 10
- YZBQHRLRFGPBSL-RXMQYKEDSA-N carbapenem Chemical compound C1C=CN2C(=O)C[C@H]21 YZBQHRLRFGPBSL-RXMQYKEDSA-N 0.000 claims description 10
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 9
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 8
- 210000002421 cell wall Anatomy 0.000 claims description 8
- 201000007119 infective endocarditis Diseases 0.000 claims description 8
- 208000031729 Bacteremia Diseases 0.000 claims description 7
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 7
- 229930182555 Penicillin Natural products 0.000 claims description 7
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 7
- 235000018417 cysteine Nutrition 0.000 claims description 7
- 150000002960 penicillins Chemical class 0.000 claims description 7
- 229960003250 telithromycin Drugs 0.000 claims description 7
- LJVAJPDWBABPEJ-PNUFFHFMSA-N telithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)[C@@H](C)C(=O)O[C@@H]([C@]2(OC(=O)N(CCCCN3C=C(N=C3)C=3C=NC=CC=3)[C@@H]2[C@@H](C)C(=O)[C@H](C)C[C@@]1(C)OC)C)CC)[C@@H]1O[C@H](C)C[C@H](N(C)C)[C@H]1O LJVAJPDWBABPEJ-PNUFFHFMSA-N 0.000 claims description 7
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 claims description 6
- 229960004821 amikacin Drugs 0.000 claims description 6
- LKCWBDHBTVXHDL-RMDFUYIESA-N amikacin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O1)O)NC(=O)[C@@H](O)CCN)[C@H]1O[C@H](CN)[C@@H](O)[C@H](O)[C@H]1O LKCWBDHBTVXHDL-RMDFUYIESA-N 0.000 claims description 6
- 229940106164 cephalexin Drugs 0.000 claims description 6
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N cephalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 claims description 6
- 229960002182 imipenem Drugs 0.000 claims description 6
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 claims description 6
- 229960005404 sulfamethoxazole Drugs 0.000 claims description 6
- JLKIGFTWXXRPMT-UHFFFAOYSA-N sulphamethoxazole Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1 JLKIGFTWXXRPMT-UHFFFAOYSA-N 0.000 claims description 6
- 229960000707 tobramycin Drugs 0.000 claims description 6
- NLVFBUXFDBBNBW-PBSUHMDJSA-N tobramycin Chemical compound N[C@@H]1C[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N NLVFBUXFDBBNBW-PBSUHMDJSA-N 0.000 claims description 6
- MINDHVHHQZYEEK-UHFFFAOYSA-N (E)-(2S,3R,4R,5S)-5-[(2S,3S,4S,5S)-2,3-epoxy-5-hydroxy-4-methylhexyl]tetrahydro-3,4-dihydroxy-(beta)-methyl-2H-pyran-2-crotonic acid ester with 9-hydroxynonanoic acid Natural products CC(O)C(C)C1OC1CC1C(O)C(O)C(CC(C)=CC(=O)OCCCCCCCCC(O)=O)OC1 MINDHVHHQZYEEK-UHFFFAOYSA-N 0.000 claims description 5
- 229960004099 azithromycin Drugs 0.000 claims description 5
- MQTOSJVFKKJCRP-BICOPXKESA-N azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 claims description 5
- 229960003128 mupirocin Drugs 0.000 claims description 5
- 229930187697 mupirocin Natural products 0.000 claims description 5
- DDHVILIIHBIMQU-YJGQQKNPSA-L mupirocin calcium hydrate Chemical compound O.O.[Ca+2].C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1.C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1 DDHVILIIHBIMQU-YJGQQKNPSA-L 0.000 claims description 5
- 102000004092 Amidohydrolases Human genes 0.000 claims description 4
- 108090000531 Amidohydrolases Proteins 0.000 claims description 4
- 108091005804 Peptidases Proteins 0.000 claims description 4
- 102000035195 Peptidases Human genes 0.000 claims description 4
- 108010053950 Teicoplanin Proteins 0.000 claims description 4
- DDTDNCYHLGRFBM-YZEKDTGTSA-N chembl2367892 Chemical compound CC(=O)N[C@H]1[C@@H](O)[C@H](O)[C@H](CO)O[C@H]1O[C@@H]([C@H]1C(N[C@@H](C2=CC(O)=CC(O[C@@H]3[C@H]([C@H](O)[C@H](O)[C@@H](CO)O3)O)=C2C=2C(O)=CC=C(C=2)[C@@H](NC(=O)[C@@H]2NC(=O)[C@@H]3C=4C=C(O)C=C(C=4)OC=4C(O)=CC=C(C=4)[C@@H](N)C(=O)N[C@H](CC=4C=C(Cl)C(O5)=CC=4)C(=O)N3)C(=O)N1)C(O)=O)=O)C(C=C1Cl)=CC=C1OC1=C(O[C@H]3[C@H]([C@@H](O)[C@H](O)[C@H](CO)O3)NC(C)=O)C5=CC2=C1 DDTDNCYHLGRFBM-YZEKDTGTSA-N 0.000 claims description 4
- 125000004122 cyclic group Chemical group 0.000 claims description 4
- 230000001419 dependent effect Effects 0.000 claims description 4
- 235000019833 protease Nutrition 0.000 claims description 4
- 229960003879 tedizolid Drugs 0.000 claims description 4
- XFALPSLJIHVRKE-GFCCVEGCSA-N tedizolid Chemical compound CN1N=NC(C=2N=CC(=CC=2)C=2C(=CC(=CC=2)N2C(O[C@@H](CO)C2)=O)F)=N1 XFALPSLJIHVRKE-GFCCVEGCSA-N 0.000 claims description 4
- 229960001608 teicoplanin Drugs 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 2
- 239000003782 beta lactam antibiotic agent Substances 0.000 claims 2
- 239000002132 β-lactam antibiotic Substances 0.000 claims 2
- 229940124586 β-lactam antibiotics Drugs 0.000 claims 2
- 230000003190 augmentative effect Effects 0.000 abstract description 7
- 101710126949 Lysin Proteins 0.000 description 138
- 125000003275 alpha amino acid group Chemical group 0.000 description 100
- 241000894007 species Species 0.000 description 67
- 239000000203 mixture Substances 0.000 description 54
- 230000000694 effects Effects 0.000 description 44
- 230000002829 reductive effect Effects 0.000 description 37
- 239000003814 drug Substances 0.000 description 36
- 125000000539 amino acid group Chemical group 0.000 description 35
- 229940024606 amino acid Drugs 0.000 description 34
- 239000012634 fragment Substances 0.000 description 34
- 230000005847 immunogenicity Effects 0.000 description 31
- 229940079593 drug Drugs 0.000 description 27
- 108090000623 proteins and genes Proteins 0.000 description 25
- 239000013598 vector Substances 0.000 description 25
- 208000015181 infectious disease Diseases 0.000 description 23
- 230000036457 multidrug resistance Effects 0.000 description 23
- 238000011282 treatment Methods 0.000 description 23
- 230000001580 bacterial effect Effects 0.000 description 22
- 239000003795 chemical substances by application Substances 0.000 description 22
- 102000004169 proteins and genes Human genes 0.000 description 22
- 235000018102 proteins Nutrition 0.000 description 21
- 206010040047 Sepsis Diseases 0.000 description 20
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 20
- 239000000546 pharmaceutical excipient Substances 0.000 description 19
- 210000004027 cell Anatomy 0.000 description 17
- 239000000243 solution Substances 0.000 description 17
- 208000037815 bloodstream infection Diseases 0.000 description 16
- 230000004927 fusion Effects 0.000 description 15
- 108700010690 exebacase Proteins 0.000 description 13
- 229950009605 exebacase Drugs 0.000 description 13
- 239000004094 surface-active agent Substances 0.000 description 13
- 230000000844 anti-bacterial effect Effects 0.000 description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 12
- 239000003755 preservative agent Substances 0.000 description 12
- 239000000969 carrier Substances 0.000 description 11
- 239000000839 emulsion Substances 0.000 description 11
- 230000004048 modification Effects 0.000 description 11
- 238000012986 modification Methods 0.000 description 11
- 244000052769 pathogen Species 0.000 description 11
- 230000000699 topical effect Effects 0.000 description 11
- 230000000845 anti-microbial effect Effects 0.000 description 10
- 239000007788 liquid Substances 0.000 description 10
- 230000002101 lytic effect Effects 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- 239000003380 propellant Substances 0.000 description 10
- 239000000725 suspension Substances 0.000 description 10
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 9
- 241000194017 Streptococcus Species 0.000 description 9
- 239000004480 active ingredient Substances 0.000 description 9
- 239000003937 drug carrier Substances 0.000 description 9
- 239000003921 oil Substances 0.000 description 9
- 108091033319 polynucleotide Proteins 0.000 description 9
- 102000040430 polynucleotide Human genes 0.000 description 9
- 239000002157 polynucleotide Substances 0.000 description 9
- 239000000843 powder Substances 0.000 description 9
- 230000002265 prevention Effects 0.000 description 9
- 239000002904 solvent Substances 0.000 description 9
- 239000003826 tablet Substances 0.000 description 9
- 241000588724 Escherichia coli Species 0.000 description 8
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 8
- 238000009635 antibiotic susceptibility testing Methods 0.000 description 8
- 230000003385 bacteriostatic effect Effects 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 235000019198 oils Nutrition 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 239000002585 base Substances 0.000 description 7
- 239000002775 capsule Substances 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 239000006185 dispersion Substances 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 206010057190 Respiratory tract infections Diseases 0.000 description 6
- 241000191940 Staphylococcus Species 0.000 description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 6
- 239000000654 additive Substances 0.000 description 6
- 239000000443 aerosol Substances 0.000 description 6
- 238000002815 broth microdilution Methods 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 238000011260 co-administration Methods 0.000 description 6
- DDRJAANPRJIHGJ-UHFFFAOYSA-N creatinine Chemical compound CN1CC(=O)NC1=N DDRJAANPRJIHGJ-UHFFFAOYSA-N 0.000 description 6
- 238000010790 dilution Methods 0.000 description 6
- 239000012895 dilution Substances 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 6
- 230000002209 hydrophobic effect Effects 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 239000008194 pharmaceutical composition Substances 0.000 description 6
- 208000020029 respiratory tract infectious disease Diseases 0.000 description 6
- 239000007787 solid Substances 0.000 description 6
- 239000007921 spray Substances 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 108090000988 Lysostaphin Proteins 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 5
- 238000010611 checkerboard assay Methods 0.000 description 5
- 208000035475 disorder Diseases 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 5
- 150000007523 nucleic acids Chemical class 0.000 description 5
- 239000002674 ointment Substances 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 230000000087 stabilizing effect Effects 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 239000004474 valine Substances 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 4
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 201000003883 Cystic fibrosis Diseases 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 4
- 206010031252 Osteomyelitis Diseases 0.000 description 4
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- 206010062237 Renal impairment Diseases 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 206010051017 Staphylococcal bacteraemia Diseases 0.000 description 4
- 229920002472 Starch Polymers 0.000 description 4
- 241000194021 Streptococcus suis Species 0.000 description 4
- 230000005867 T cell response Effects 0.000 description 4
- 102220499972 Target of EGR1 protein 1_R35E_mutation Human genes 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 230000000996 additive effect Effects 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 239000006172 buffering agent Substances 0.000 description 4
- 230000003197 catalytic effect Effects 0.000 description 4
- 125000002091 cationic group Chemical group 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 208000020832 chronic kidney disease Diseases 0.000 description 4
- 239000003995 emulsifying agent Substances 0.000 description 4
- 201000000523 end stage renal failure Diseases 0.000 description 4
- 235000019441 ethanol Nutrition 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 150000004676 glycans Chemical class 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 239000008101 lactose Substances 0.000 description 4
- 230000000813 microbial effect Effects 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 230000006320 pegylation Effects 0.000 description 4
- 239000006187 pill Substances 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 235000019698 starch Nutrition 0.000 description 4
- 230000002195 synergetic effect Effects 0.000 description 4
- 241001515965 unidentified phage Species 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 101800002011 Amphipathic peptide Proteins 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 206010060968 Arthritis infective Diseases 0.000 description 3
- 108010065152 Coagulase Proteins 0.000 description 3
- 241000194032 Enterococcus faecalis Species 0.000 description 3
- 241000194031 Enterococcus faecium Species 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 3
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- 241000186779 Listeria monocytogenes Species 0.000 description 3
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 229920001214 Polysorbate 60 Polymers 0.000 description 3
- 206010041925 Staphylococcal infections Diseases 0.000 description 3
- 241000191963 Staphylococcus epidermidis Species 0.000 description 3
- 241000191982 Staphylococcus hyicus Species 0.000 description 3
- 241000191980 Staphylococcus intermedius Species 0.000 description 3
- 241001147691 Staphylococcus saprophyticus Species 0.000 description 3
- 241000192097 Staphylococcus sciuri Species 0.000 description 3
- 241000191978 Staphylococcus simulans Species 0.000 description 3
- 241000194049 Streptococcus equinus Species 0.000 description 3
- 241001134658 Streptococcus mitis Species 0.000 description 3
- 241000194019 Streptococcus mutans Species 0.000 description 3
- 241000193998 Streptococcus pneumoniae Species 0.000 description 3
- 241000193996 Streptococcus pyogenes Species 0.000 description 3
- 241000194024 Streptococcus salivarius Species 0.000 description 3
- 241000194023 Streptococcus sanguinis Species 0.000 description 3
- 241001312524 Streptococcus viridans Species 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000000853 adhesive Substances 0.000 description 3
- 230000001070 adhesive effect Effects 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 239000004599 antimicrobial Substances 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 239000008346 aqueous phase Substances 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 229940041011 carbapenems Drugs 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- 239000006071 cream Substances 0.000 description 3
- 229940109239 creatinine Drugs 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 230000003111 delayed effect Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 3
- 229940032049 enterococcus faecalis Drugs 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 125000005456 glyceride group Chemical group 0.000 description 3
- 239000005090 green fluorescent protein Substances 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 239000007937 lozenge Substances 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 150000004667 medium chain fatty acids Chemical class 0.000 description 3
- 208000015688 methicillin-resistant staphylococcus aureus infectious disease Diseases 0.000 description 3
- 239000004530 micro-emulsion Substances 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 239000003208 petroleum Substances 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 3
- 238000009097 single-agent therapy Methods 0.000 description 3
- 235000010356 sorbitol Nutrition 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 229940037648 staphylococcus simulans Drugs 0.000 description 3
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 208000019206 urinary tract infection Diseases 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- DDMOUSALMHHKOS-UHFFFAOYSA-N 1,2-dichloro-1,1,2,2-tetrafluoroethane Chemical compound FC(F)(Cl)C(F)(F)Cl DDMOUSALMHHKOS-UHFFFAOYSA-N 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 206010053555 Arthritis bacterial Diseases 0.000 description 2
- 241000193830 Bacillus <bacterium> Species 0.000 description 2
- QFOHBWFCKVYLES-UHFFFAOYSA-N Butylparaben Chemical compound CCCCOC(=O)C1=CC=C(O)C=C1 QFOHBWFCKVYLES-UHFFFAOYSA-N 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000792859 Enema Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 208000008745 Healthcare-Associated Pneumonia Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 208000004575 Infectious Arthritis Diseases 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 108010013639 Peptidoglycan Proteins 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 241000295644 Staphylococcaceae Species 0.000 description 2
- 241000193985 Streptococcus agalactiae Species 0.000 description 2
- 241000194042 Streptococcus dysgalactiae Species 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 239000003070 absorption delaying agent Substances 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 239000004479 aerosol dispenser Substances 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- 239000003899 bactericide agent Substances 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 229920001400 block copolymer Polymers 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 206010006451 bronchitis Diseases 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 229960004424 carbon dioxide Drugs 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 108010082025 cyan fluorescent protein Proteins 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 229940009976 deoxycholate Drugs 0.000 description 2
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 2
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 2
- 229940042935 dichlorodifluoromethane Drugs 0.000 description 2
- 229940087091 dichlorotetrafluoroethane Drugs 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 239000000890 drug combination Substances 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000003974 emollient agent Substances 0.000 description 2
- 208000028208 end stage renal disease Diseases 0.000 description 2
- 239000007920 enema Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000012055 enteric layer Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 239000006260 foam Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 229940041010 fourth-generation cephalosporins Drugs 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 238000001631 haemodialysis Methods 0.000 description 2
- 230000000322 hemodialysis Effects 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 210000001624 hip Anatomy 0.000 description 2
- 210000004394 hip joint Anatomy 0.000 description 2
- 239000003906 humectant Substances 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 238000000126 in silico method Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 210000001503 joint Anatomy 0.000 description 2
- 230000003907 kidney function Effects 0.000 description 2
- 210000003127 knee Anatomy 0.000 description 2
- 210000000629 knee joint Anatomy 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 239000006210 lotion Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 239000003094 microcapsule Substances 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 239000002324 mouth wash Substances 0.000 description 2
- 239000007922 nasal spray Substances 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000008055 phosphate buffer solution Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 108010054624 red fluorescent protein Proteins 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 201000001223 septic arthritis Diseases 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000008247 solid mixture Substances 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 229940032147 starch Drugs 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 229940030998 streptococcus agalactiae Drugs 0.000 description 2
- 229940115920 streptococcus dysgalactiae Drugs 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- CYRMSUTZVYGINF-UHFFFAOYSA-N trichlorofluoromethane Chemical compound FC(Cl)(Cl)Cl CYRMSUTZVYGINF-UHFFFAOYSA-N 0.000 description 2
- 229940029284 trichlorofluoromethane Drugs 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000002691 unilamellar liposome Substances 0.000 description 2
- 230000001018 virulence Effects 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- NOOLISFMXDJSKH-UTLUCORTSA-N (+)-Neomenthol Chemical compound CC(C)[C@@H]1CC[C@@H](C)C[C@@H]1O NOOLISFMXDJSKH-UTLUCORTSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- RXZBMPWDPOLZGW-XMRMVWPWSA-N (E)-roxithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=N/OCOCCOC)/[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 RXZBMPWDPOLZGW-XMRMVWPWSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- FFJCNSLCJOQHKM-CLFAGFIQSA-N (z)-1-[(z)-octadec-9-enoxy]octadec-9-ene Chemical compound CCCCCCCC\C=C/CCCCCCCCOCCCCCCCC\C=C/CCCCCCCC FFJCNSLCJOQHKM-CLFAGFIQSA-N 0.000 description 1
- TXGPGHBYAPBDAG-UHFFFAOYSA-N 1,1,2,2,3,3-hexafluoro-4,4-bis(trifluoromethyl)cyclobutane Chemical compound FC(F)(F)C1(C(F)(F)F)C(F)(F)C(F)(F)C1(F)F TXGPGHBYAPBDAG-UHFFFAOYSA-N 0.000 description 1
- OKMWKBLSFKFYGZ-UHFFFAOYSA-N 1-behenoylglycerol Chemical compound CCCCCCCCCCCCCCCCCCCCCC(=O)OCC(O)CO OKMWKBLSFKFYGZ-UHFFFAOYSA-N 0.000 description 1
- HBXWUCXDUUJDRB-UHFFFAOYSA-N 1-octadecoxyoctadecane Chemical compound CCCCCCCCCCCCCCCCCCOCCCCCCCCCCCCCCCCCC HBXWUCXDUUJDRB-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- GDMDOMRUYVLLHM-UHFFFAOYSA-N 2-(1-iodoethyl)pentyl carbamate Chemical compound CCCC(C(C)I)COC(N)=O GDMDOMRUYVLLHM-UHFFFAOYSA-N 0.000 description 1
- SMZOUWXMTYCWNB-UHFFFAOYSA-N 2-(2-methoxy-5-methylphenyl)ethanamine Chemical compound COC1=CC=C(C)C=C1CCN SMZOUWXMTYCWNB-UHFFFAOYSA-N 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N 2-Propenoic acid Natural products OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- ACTOXUHEUCPTEW-BWHGAVFKSA-N 2-[(4r,5s,6s,7r,9r,10r,11e,13e,16r)-6-[(2s,3r,4r,5s,6r)-5-[(2s,4r,5s,6s)-4,5-dihydroxy-4,6-dimethyloxan-2-yl]oxy-4-(dimethylamino)-3-hydroxy-6-methyloxan-2-yl]oxy-10-[(2s,5s,6r)-5-(dimethylamino)-6-methyloxan-2-yl]oxy-4-hydroxy-5-methoxy-9,16-dimethyl-2-o Chemical compound O([C@H]1/C=C/C=C/C[C@@H](C)OC(=O)C[C@@H](O)[C@@H]([C@H]([C@@H](CC=O)C[C@H]1C)O[C@H]1[C@@H]([C@H]([C@H](O[C@@H]2O[C@@H](C)[C@H](O)[C@](C)(O)C2)[C@@H](C)O1)N(C)C)O)OC)[C@@H]1CC[C@H](N(C)C)[C@@H](C)O1 ACTOXUHEUCPTEW-BWHGAVFKSA-N 0.000 description 1
- GHCZTIFQWKKGSB-UHFFFAOYSA-N 2-hydroxypropane-1,2,3-tricarboxylic acid;phosphoric acid Chemical compound OP(O)(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O GHCZTIFQWKKGSB-UHFFFAOYSA-N 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 1
- OSDLLIBGSJNGJE-UHFFFAOYSA-N 4-chloro-3,5-dimethylphenol Chemical compound CC1=CC(O)=CC(C)=C1Cl OSDLLIBGSJNGJE-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 102000013563 Acid Phosphatase Human genes 0.000 description 1
- 108010051457 Acid Phosphatase Proteins 0.000 description 1
- 241000186046 Actinomyces Species 0.000 description 1
- 206010001076 Acute sinusitis Diseases 0.000 description 1
- 235000019489 Almond oil Nutrition 0.000 description 1
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 1
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 239000002028 Biomass Substances 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- 208000025721 COVID-19 Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102100036419 Calmodulin-like protein 5 Human genes 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 206010008326 Cervicitis gonococcal Diseases 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 108010078777 Colistin Proteins 0.000 description 1
- 208000037041 Community-Acquired Infections Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 206010011409 Cross infection Diseases 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- NOOLISFMXDJSKH-UHFFFAOYSA-N DL-menthol Natural products CC(C)C1CCC(C)CC1O NOOLISFMXDJSKH-UHFFFAOYSA-N 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108010002069 Defensins Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010056340 Diabetic ulcer Diseases 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- ZGTMUACCHSMWAC-UHFFFAOYSA-L EDTA disodium salt (anhydrous) Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 description 1
- 108010059378 Endopeptidases Proteins 0.000 description 1
- 102000005593 Endopeptidases Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 208000001860 Eye Infections Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 206010016936 Folliculitis Diseases 0.000 description 1
- 241000700662 Fowlpox virus Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 229920002148 Gellan gum Polymers 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 101000714353 Homo sapiens Calmodulin-like protein 5 Proteins 0.000 description 1
- 239000004831 Hot glue Substances 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 201000008225 Klebsiella pneumonia Diseases 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 241000194036 Lactococcus Species 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 206010024971 Lower respiratory tract infections Diseases 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 206010061304 Nail infection Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 101150012394 PHO5 gene Proteins 0.000 description 1
- 206010034133 Pathogen resistance Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 206010035717 Pneumonia klebsiella Diseases 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 108010093965 Polymyxin B Proteins 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- ZVGNESXIJDCBKN-WUIGKKEISA-N R-Tiacumicin B Natural products O([C@@H]1[C@@H](C)O[C@H]([C@H]([C@H]1O)OC)OCC1=CC=CC[C@H](O)C(C)=C[C@@H]([C@H](C(C)=CC(C)=CC[C@H](OC1=O)[C@@H](C)O)O[C@H]1[C@H]([C@@H](O)[C@H](OC(=O)C(C)C)C(C)(C)O1)O)CC)C(=O)C1=C(O)C(Cl)=C(O)C(Cl)=C1CC ZVGNESXIJDCBKN-WUIGKKEISA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102000000395 SH3 domains Human genes 0.000 description 1
- 108050008861 SH3 domains Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 208000019802 Sexually transmitted disease Diseases 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 239000004141 Sodium laurylsulphate Substances 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- 239000004147 Sorbitan trioleate Substances 0.000 description 1
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
- 239000004187 Spiramycin Substances 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 241000701093 Suid alphaherpesvirus 1 Species 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 206010047139 Vasoconstriction Diseases 0.000 description 1
- 239000004164 Wax ester Substances 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 206010048038 Wound infection Diseases 0.000 description 1
- 239000006096 absorbing agent Substances 0.000 description 1
- 229940124532 absorption promoter Drugs 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229940081735 acetylcellulose Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 201000010439 acute gonococcal cervicitis Diseases 0.000 description 1
- 101150063416 add gene Proteins 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 230000003113 alkalizing effect Effects 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- 239000012080 ambient air Substances 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 210000003423 ankle Anatomy 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000003092 anti-cytokine Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 230000002421 anti-septic effect Effects 0.000 description 1
- 230000000941 anti-staphylcoccal effect Effects 0.000 description 1
- 230000000935 anti-streptococcal effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 210000000544 articulatio talocruralis Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000000022 bacteriostatic agent Substances 0.000 description 1
- OGBUMNBNEWYMNJ-UHFFFAOYSA-N batilol Chemical class CCCCCCCCCCCCCCCCCCOCC(O)CO OGBUMNBNEWYMNJ-UHFFFAOYSA-N 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000032770 biofilm formation Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 238000009640 blood culture Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 239000000337 buffer salt Substances 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- XNVWFBHTEBDKCA-UHFFFAOYSA-N butanedioic acid;2-hydroxypropane-1,2,3-tricarboxylic acid Chemical compound OC(=O)CCC(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O XNVWFBHTEBDKCA-UHFFFAOYSA-N 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 1
- 229940067596 butylparaben Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 229940078456 calcium stearate Drugs 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229940081733 cetearyl alcohol Drugs 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- YMKDRGPMQRFJGP-UHFFFAOYSA-M cetylpyridinium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 YMKDRGPMQRFJGP-UHFFFAOYSA-M 0.000 description 1
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 235000015218 chewing gum Nutrition 0.000 description 1
- 229960005443 chloroxylenol Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 229960004106 citric acid Drugs 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 229960002626 clarithromycin Drugs 0.000 description 1
- AGOYDEPGAOXOCK-KCBOHYOISA-N clarithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@](C)([C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)OC)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 AGOYDEPGAOXOCK-KCBOHYOISA-N 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229960003326 cloxacillin Drugs 0.000 description 1
- LQOLIRLGBULYKD-JKIFEVAISA-N cloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1Cl LQOLIRLGBULYKD-JKIFEVAISA-N 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229960003346 colistin Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 235000009508 confectionery Nutrition 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- DTPCFIHYWYONMD-UHFFFAOYSA-N decaethylene glycol Polymers OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO DTPCFIHYWYONMD-UHFFFAOYSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 235000019700 dicalcium phosphate Nutrition 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- XXJWXESWEXIICW-UHFFFAOYSA-N diethylene glycol monoethyl ether Chemical compound CCOCCOCCO XXJWXESWEXIICW-UHFFFAOYSA-N 0.000 description 1
- 229940075557 diethylene glycol monoethyl ether Drugs 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- WSDISUOETYTPRL-UHFFFAOYSA-N dmdm hydantoin Chemical compound CC1(C)N(CO)C(=O)N(CO)C1=O WSDISUOETYTPRL-UHFFFAOYSA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- 210000000613 ear canal Anatomy 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 210000001513 elbow Anatomy 0.000 description 1
- 210000002310 elbow joint Anatomy 0.000 description 1
- 239000008387 emulsifying waxe Substances 0.000 description 1
- 229940095399 enema Drugs 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000000686 essence Substances 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- DKQVJMREABFYNT-UHFFFAOYSA-N ethene Chemical group C=C.C=C DKQVJMREABFYNT-UHFFFAOYSA-N 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- MVPICKVDHDWCJQ-UHFFFAOYSA-N ethyl 3-pyrrolidin-1-ylpropanoate Chemical compound CCOC(=O)CCN1CCCC1 MVPICKVDHDWCJQ-UHFFFAOYSA-N 0.000 description 1
- 229940044949 eucalyptus oil Drugs 0.000 description 1
- 239000010642 eucalyptus oil Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 208000011323 eye infectious disease Diseases 0.000 description 1
- 239000004744 fabric Substances 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- ZVGNESXIJDCBKN-UUEYKCAUSA-N fidaxomicin Chemical compound O([C@@H]1[C@@H](C)O[C@H]([C@H]([C@H]1O)OC)OCC\1=C/C=C/C[C@H](O)/C(C)=C/[C@@H]([C@H](/C(C)=C/C(/C)=C/C[C@H](OC/1=O)[C@@H](C)O)O[C@H]1[C@H]([C@@H](O)[C@H](OC(=O)C(C)C)C(C)(C)O1)O)CC)C(=O)C1=C(O)C(Cl)=C(O)C(Cl)=C1CC ZVGNESXIJDCBKN-UUEYKCAUSA-N 0.000 description 1
- 229960000628 fidaxomicin Drugs 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000003349 gelling agent Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 229940049654 glyceryl behenate Drugs 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 208000028320 gonococcal cervicitis Diseases 0.000 description 1
- 208000020426 gonococcal urethritis Diseases 0.000 description 1
- 208000027096 gram-negative bacterial infections Diseases 0.000 description 1
- 208000027136 gram-positive bacterial infections Diseases 0.000 description 1
- 239000003979 granulating agent Substances 0.000 description 1
- 210000004247 hand Anatomy 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 244000144980 herd Species 0.000 description 1
- UBHWBODXJBSFLH-UHFFFAOYSA-N hexadecan-1-ol;octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO.CCCCCCCCCCCCCCCCCCO UBHWBODXJBSFLH-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000022760 infectious otitis media Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 229940041682 inhalant solution Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 239000000644 isotonic solution Substances 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 231100000225 lethality Toxicity 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229940041028 lincosamides Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 201000011643 malignant otitis externa Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 229940041616 menthol Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- JORAUNFTUVJTNG-BSTBCYLQSA-N n-[(2s)-4-amino-1-[[(2s,3r)-1-[[(2s)-4-amino-1-oxo-1-[[(3s,6s,9s,12s,15r,18s,21s)-6,9,18-tris(2-aminoethyl)-3-[(1r)-1-hydroxyethyl]-12,15-bis(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-h Chemical compound CC(C)CCCCC(=O)N[C@@H](CCN)C(=O)N[C@H]([C@@H](C)O)CN[C@@H](CCN)C(=O)N[C@H]1CCNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCN)NC(=O)[C@H](CCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCN)NC1=O.CCC(C)CCCCC(=O)N[C@@H](CCN)C(=O)N[C@H]([C@@H](C)O)CN[C@@H](CCN)C(=O)N[C@H]1CCNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCN)NC(=O)[C@H](CCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCN)NC1=O JORAUNFTUVJTNG-BSTBCYLQSA-N 0.000 description 1
- 210000000282 nail Anatomy 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 239000007923 nasal drop Substances 0.000 description 1
- 229940100662 nasal drops Drugs 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 208000004235 neutropenia Diseases 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- BCCOBQSFUDVTJQ-UHFFFAOYSA-N octafluorocyclobutane Chemical compound FC1(F)C(F)(F)C(F)(F)C1(F)F BCCOBQSFUDVTJQ-UHFFFAOYSA-N 0.000 description 1
- 235000019407 octafluorocyclobutane Nutrition 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- UYDLBVPAAFVANX-UHFFFAOYSA-N octylphenoxy polyethoxyethanol Chemical compound CC(C)(C)CC(C)(C)C1=CC=C(OCCOCCOCCOCCO)C=C1 UYDLBVPAAFVANX-UHFFFAOYSA-N 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 206010033072 otitis externa Diseases 0.000 description 1
- RARSHUDCJQSEFJ-UHFFFAOYSA-N p-Hydroxypropiophenone Chemical compound CCC(=O)C1=CC=C(O)C=C1 RARSHUDCJQSEFJ-UHFFFAOYSA-N 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 230000009518 penetrating injury Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229940021222 peritoneal dialysis isotonic solution Drugs 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229950008885 polyglycolic acid Drugs 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000024 polymyxin B Polymers 0.000 description 1
- XDJYMJULXQKGMM-UHFFFAOYSA-N polymyxin E1 Natural products CCC(C)CCCCC(=O)NC(CCN)C(=O)NC(C(C)O)C(=O)NC(CCN)C(=O)NC1CCNC(=O)C(C(C)O)NC(=O)C(CCN)NC(=O)C(CCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCN)NC1=O XDJYMJULXQKGMM-UHFFFAOYSA-N 0.000 description 1
- KNIWPHSUTGNZST-UHFFFAOYSA-N polymyxin E2 Natural products CC(C)CCCCC(=O)NC(CCN)C(=O)NC(C(C)O)C(=O)NC(CCN)C(=O)NC1CCNC(=O)C(C(C)O)NC(=O)C(CCN)NC(=O)C(CCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCN)NC1=O KNIWPHSUTGNZST-UHFFFAOYSA-N 0.000 description 1
- 229960005266 polymyxin b Drugs 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000000275 quality assurance Methods 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000012959 renal replacement therapy Methods 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 239000006254 rheological additive Substances 0.000 description 1
- 229960005224 roxithromycin Drugs 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 150000004666 short chain fatty acids Chemical class 0.000 description 1
- 235000021391 short chain fatty acids Nutrition 0.000 description 1
- 210000002832 shoulder Anatomy 0.000 description 1
- 210000000323 shoulder joint Anatomy 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 206010040872 skin infection Diseases 0.000 description 1
- 239000003009 skin protective agent Substances 0.000 description 1
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 1
- 235000010378 sodium ascorbate Nutrition 0.000 description 1
- 229960005055 sodium ascorbate Drugs 0.000 description 1
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 1
- 239000004299 sodium benzoate Substances 0.000 description 1
- 235000010234 sodium benzoate Nutrition 0.000 description 1
- 229960003885 sodium benzoate Drugs 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 239000008109 sodium starch glycolate Substances 0.000 description 1
- 229940079832 sodium starch glycolate Drugs 0.000 description 1
- 229920003109 sodium starch glycolate Polymers 0.000 description 1
- 229940045902 sodium stearyl fumarate Drugs 0.000 description 1
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- 235000019337 sorbitan trioleate Nutrition 0.000 description 1
- 229960000391 sorbitan trioleate Drugs 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 239000008347 soybean phospholipid Substances 0.000 description 1
- 229960001294 spiramycin Drugs 0.000 description 1
- 235000019372 spiramycin Nutrition 0.000 description 1
- 229930191512 spiramycin Natural products 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 239000003351 stiffener Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 230000000475 sunscreen effect Effects 0.000 description 1
- 239000000516 sunscreening agent Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000009044 synergistic interaction Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- MHXBHWLGRWOABW-UHFFFAOYSA-N tetradecyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCC MHXBHWLGRWOABW-UHFFFAOYSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 239000008181 tonicity modifier Substances 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 239000012049 topical pharmaceutical composition Substances 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 238000002627 tracheal intubation Methods 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 239000001974 tryptic soy broth Substances 0.000 description 1
- 108010050327 trypticase-soy broth Proteins 0.000 description 1
- 231100000397 ulcer Toxicity 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 230000025033 vasoconstriction Effects 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 235000019386 wax ester Nutrition 0.000 description 1
- 210000003857 wrist joint Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/10—Animal feeding-stuffs obtained by microbiological or biochemical processes
- A23K10/14—Pretreatment of feeding-stuffs with enzymes
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/189—Enzymes
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/195—Antibiotics
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L29/00—Foods or foodstuffs containing additives; Preparation or treatment thereof
- A23L29/06—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/429—Thiazoles condensed with heterocyclic ring systems
- A61K31/43—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
- A61K31/431—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems containing further heterocyclic rings, e.g. ticarcillin, azlocillin, oxacillin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/12—Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/14—Peptides containing saccharide radicals; Derivatives thereof, e.g. bleomycin, phleomycin, muramylpeptides or vancomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01017—Lysozyme (3.2.1.17)
Definitions
- the present disclosure relates generally to antibacterial agents and more specifically to PlySs2 and to modified, non-naturally occurring lysin polypeptides, notably, modified PlySs2 lytic enzymes, and the use of these polypeptides alone or in combination with antibiotics in killing multidrug-resistant Gram-positive bacteria and combating bacterial infection and contamination ⁇
- Antibiotic resistance is one of the biggest public health challenges of our time. Each year in the U.S. at least 2.8 million people get an antibiotic -resistant infection, and more than 35,000 people die. Accordingly, there is an ongoing need in the art for agents and methods that are capable of effectively treating bacterial infections including those caused by antibiotic- resistant bacteria, particularly multidrug-resistant bacteria. SUMMARY OF THE DISCLOSURE
- the disclosure provides a method for inhibiting the growth, reducing the population, or killing at least one species of multi-drug resistant Gram-positive bacteria, comprising contacting the bacteria with a lysin polypeptide comprising SEQ ID NO: 1 (wild type PlySs2) or SEQ ID NO: 18 (having a deletion of the N terminal methionine of SEQ ID NO: 1), and/or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as multidrug-resistant Gram-positive bacteria.
- a lysin polypeptide comprising SEQ ID NO: 1 (wild type PlySs2) or SEQ ID NO: 18 (having a deletion of the N terminal methionine of SEQ ID NO: 1), and/or a variant thereof having at least 80% identity,
- a method for inhibiting the growth, reducing the population, or killing at least one species of multi-drug resistant Gram-positive bacteria comprising contacting the bacteria with a lysin polypeptide, particularly PlySs2 and/or a modified lysin polypeptide having at least one amino acid substitution relative to a counterpart wild-type PlySs2 lysin disclosed herein.
- the method further comprises contacting the bacteria with one or more antibiotic(s).
- a method for preventing or treating a bacterial infection, including bloodstream infection such as bacteremia or infective endocarditis, caused by at least one species of multi-drug resistant Gram-positive bacteria comprising administering a therapeutically effective amount of a lysin polypeptide to a subject comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity, to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as a multidrug-resistant Gram-positive bacteria.
- the method comprising administering to a subject diagnosed with, at risk for, or exhibiting symptoms of the bacterial infection an amount of PlySs2 and/or a modified lysin polypeptide having at least one amino acid substitution relative to a counterpart wild-type PlySs2 lysin.
- the method further comprises co-administering to said subject, an amount of an antibiotic suitable for the treatment of a Gram positive bacterial infection.
- the subject is diagnosed with, at risk for, or exhibits symptoms of a bacterial infection, such as bacteremia or infective endocarditis, bone and/or joint infection, and/or other bacterial infections disclosed herein.
- a method for augmenting the efficacy of an antibiotic suitable for the treatment of a multi-drug resistant Gram-positive bacteria or bacterial infection comprising co- administering the antibiotic with a lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity, to SEQ ID NO: 1 or SEQ ID NO: 18, wherein co-administration is more effective in inhibiting the growth, or reducing the population, or killing the multidrug-resistant Gram-positive bacteria, than administration of either the one or more antibiotic(s) or the variant thereof individually.
- a method for augmenting the efficacy of an antibiotic suitable for the treatment of a multi-drug resistant Gram-positive bacterial infection comprising co-administering the antibiotic in combination with PlySs2 and/or a modified lysin polypeptide having at least one amino acid substitution relative to a counterpart wild-type PlySs2 lysin, wherein co-administration is more effective in inhibiting the growth, or reducing the population, or killing the multi-drug resistant Gram-positive bacteria than administration of either the antibiotic or the modified lysin polypeptide individually.
- a combination comprising a lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18, and/or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits growth, reduces a population, or kills at least one species of multidrug-resistant Gram-positive bacteria and one or more antibiotic(s), wherein the combination is capable of synergistically inhibiting the growth, reducing the population, or killing at least one species of multidrug-resistant Gram positive bacteria.
- the amount of lysin polypeptide or the variant thereof used in the foregoing methods may be below that which would result in a concentration equal to the minimal inhibitory concentration (MIC) of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof when used in the absence of antibiotic (/. ⁇ ? ., a “sub- MIC lysin amount”); alternatively or additionally, the amount of antibiotic used in the foregoing methods may be below that which corresponds to the MIC for the antibiotic when used in the absence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof (/. ⁇ ? ., a “sub-MIC antibiotic amount”).
- MIC minimal inhibitory concentration
- a combination comprising PlySs2 or a modified lysin polypeptide and an antibiotic.
- the minimum amount of the modified lysin polypeptide, the antibiotic, or both or PlySs2, the antibiotic or both that is effective in the combination is below the respective MIC amount of the modified lysin polypeptide and/or the antibiotic or PlySs2 and/or the antibiotics.
- the PlySs2 and the antibiotic or the modified lysin polypeptide and the antibiotic are provided in the same composition, and in certain embodiments, the PlySs2 and the antibiotic or the modified lysin polypeptide and the antibiotic are provided in different compositions [0011]
- the one or more antibiotic(s) is one or more of a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbapenem (e.g.
- imipenem and entapenem a macrolide (e.g. erythromycin, azithromycin), an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), ketolides (e.g., telithromycin), a glycopeptide (e.g., vancomycin, teicoplanin), oxazolidinones (e.g., linezolid and tedizolid), a fluoroquinolone (e.g., levofloxacin), a lipopeptide, such as cyclic lipopeptides (e.g.
- the antibiotic is one or more of vancomycin and daptomycin. In other embodiments, the antibiotic is oxacillin.
- the multidrug-resistant Gram-positive bacteria comprise Staphylococcus aureus, such as methicillin-resistant Staphylococcus aureus (MRSA) or methicillin sensitive Staphylococcus aureus (MSSA).
- Staphylococcus aureus such as methicillin-resistant Staphylococcus aureus (MRSA) or methicillin sensitive Staphylococcus aureus (MSSA).
- the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and a sulfonamide/trimethoprim.
- antibiotics such as at least three antibiotics, optionally in addition to oxacillin, selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquino
- the multidrug -resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- antibiotics such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from a beta-lactam, a cephalosporin, a monobact
- the multidrug -resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to at least two, such as at least three, such as at least four antibiotics, wherein the at least two, such as the at least three, such as the at least four antibiotics, are each from a different antibiotic class.
- the multidrug-resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, wherein each antibiotic is from at least two different antibiotic classes, such as at least three different antibiotic classes, selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- the multidrug-resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least three antibiotics, wherein each antibiotic is from at least three different antibiotic classes selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- each antibiotic is from at least three different antibiotic classes selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimeth
- the multidrug-resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to at least four antibiotics, wherein each antibiotic is from a different class selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- each antibiotic is from a different class selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/
- the multidrug-resistant Gram positive bacteria are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, wherein each antibiotic is from a different antibiotic class selected from a macrolide, an aminoglycoside, a fluoroquinolone, a ketolide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
- antibiotics such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to a beta lactam, such as oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
- a beta lactam such as oxacillin and/or methicillin
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to a beta lactam, such as oxacillin and/or methicillin, selected from ceftaroline, clindamycin, doxycycline, erythromycin, gentamicin, levofloxacin, and/or trimethoprim/sulfamethoxazole.
- a beta lactam such as oxacillin and/or methicillin
- the multidrug-resistant bacteria such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to all beta lactams including penicillins, carbapenems and first to fourth generation cephalosporins, but not to the fifth generation anti-MRSA cephalosporins (for example ceftaroline).
- the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected from erythoromycin, levofloxacin, ceftaroline, linezolid and vancomycin. In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected erythromycin, levofloxacin and ceftaroline.
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected from erythoromycin, levofloxacin, ceftaroline, linezolid and/or vancomycin.
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or oxacillin, selected from erythromycin, levofloxacin and/or ceftaroline.
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant to methicillin and are non-susceptible to oxacillin and at least two antibiotics, such as at least three antibiotics selected from ceftaroline, erythromycin, clindamycin, doxycycline, levofloxacin, gentamicin, linezolid, trimethoprim- sulfamethoxazole, daptomycin and vancomycin.
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant to methicillin and are non-susceptible to oxacillin and at least two or three antibiotics selected from erythromycin, levofloxacin, clindamycin, ceftarolin and doxycycline, in another embodiment, erythromycin, levofloxacin and clindamycin, in still another embodiment, erythromycin, levofloxacin and clindamycin and in still another embodiment, erythromycin and levofloxacin.
- the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least three antibiotics from at least three different antibiotic classes wherein at least one of the three antibiotics is selected from a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) a carbapenem (e.g. imipenem and entapenem); an aminoglycoside (e.g.
- cephalosporin e.g. ceftaroline, cefalexin and cefactor
- a monobactam e.g. aztreonanl
- carbapenem e.g. imipenem and entapenem
- aminoglycoside e.g.
- gentamicin tobramycin, amikacin
- a ketolide e.g., telithromycin
- a fluoroquinolone e.g., levofloxacin
- a lincomycin e.g., clindamycin
- a tetracycline e.g., tetracycline, doxycycline
- a sulfonamide e.g. sulfamethoxazole
- trimethoprim e.g. trimethoprim/sulfamethoxazole
- the multidrug resistant bacteria are also resistant and/or non-susceptible to methicillin, oxacillin, daptomycin and/or vancomycin.
- the amount of PlySs2 or the modified lysin polypeptide used in the foregoing methods may be below that which would result in a concentration equal to the MIC of the PlySs2 or the modified lysin polypeptide when used in the absence of antibiotic (/. ⁇ ?., a “sub-MIC lysin amount”); alternatively or additionally, the amount of antibiotic used in the foregoing methods may be below that which corresponds, /. ⁇ ?
- the variant of SEQ ID NO: 1 or SEQ ID NO: 18 (/. ⁇ ? ., a “sub- MIC antibiotic amount”), such as the modified lysin polypeptide has reduced immunogenicity as compared to the counterpart wild-type PlySs2 lysin.
- the wild-type PlySs2 lysin (SEQ ID NO: 1) or SEQ ID NO: 18 has a cysteine, histidine-dependent amidohydrolase/peptidase (CHAP) endopeptidase domain, which is the enzymatically active domain (EAD) of the PlySs2 polypeptide, and a C-terminal SH3b_5 (SH3b) cell wall-binding domain (CBD).
- CHAP histidine-dependent amidohydrolase/peptidase
- EAD enzymatically active domain
- SH3b_5 SH3b cell wall-binding domain
- the variant of SEQ ID NO: 1 or SEQ ID NO: 18 such as the modified lysin polypeptides comprise at least one amino acid substitutions in the CHAP and/or one or more amino acid substitutions in the SH3b domain(s), wherein the variant inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- the modified lysin polypeptide comprises at least one amino acid substitution as compared to a wild-type PlySs2 lysin polypeptide, wherein the wild-type PlySs2 lysin polypeptide has an amino acid sequence of SEQ ID NO: 1, a cysteine, histidine-dependent amidohydrolase/peptidase (CHAP) domain, and a cell wall binding (SH3b) domain, and wherein the at least one amino acid substitution is in the CHAP domain and/or the SH3b domain, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- the wild-type PlySs2 lysin polypeptide has an amino acid sequence of SEQ ID NO: 1, a cysteine, histidine-dependent amidohydrolase/peptidase (CHAP) domain, and a cell wall binding (SH3b) domain
- CHAP domain and/or the SH3b domain cell wall binding
- the variant lysin polypeptide comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, N184D, and S198Q (pp296).
- active fragments of PlySs2 SEQ ID NO: 1 or SEQ ID NO: 18, e.g., the CHAP domain and the SH3b domain as well as active fragments of the lysin polypeptide variants disclosed herein, wherein the active fragments of the variants include one or more amino acid substitutions in the CHAP domain and/or the SH3b domain.
- the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the United States (in 2020).
- the activity of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is consistent, regardless of resistance phenotype (methicillin- sensitive Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), including multidrug-resistant (MDR) isolates).
- MSSA methicillin- sensitive Staphylococcus aureus
- MRSA methicillin-resistant Staphylococcus aureus
- MDR multidrug-resistant
- a PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, may be used for the treatment of Staphylococcus aureus bacteremia, including those caused by MDR MRSA isolates
- the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure is administered or formulated as a one-time intravenous infusion.
- the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure is administered or formulated in an effective amount of 0.25 mg/kg administered or formulated as a one-time intravenous infusion.
- the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure is administered or formulated in an effective amount of 18 mg and administered or formulated as a one-time intravenous infusion.
- the subject has normal renal function (e.g., creatinine clearance [CrCl*] >60 mL/minute) or mild renal impairment, and the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 18 mg administered as a one-time intravenous infusion.
- normal renal function e.g., creatinine clearance [CrCl*] >60 mL/minute
- mild renal impairment e.g., the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 18 mg administered as a one-time intravenous infusion.
- the subject has moderate or severe renal impairment (e.g., creatinine clearance [CrCl*] of 15 to ⁇ 60 mL/minute) and the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 12 mg administered as a one-time intravenous infusion.
- moderate or severe renal impairment e.g., creatinine clearance [CrCl*] of 15 to ⁇ 60 mL/minute
- the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure is 12 mg administered as a one-time intravenous infusion.
- the subject has end-stage renal disease (ESRD; e.g. CrCl* ⁇ 15 mL/minute) and/or is on hemodialysis, and the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 18 mg administered as a one-time intravenous infusion.
- the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the United States in 2020.
- the activity of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is consistent, regardless of resistance phenotype (methicillin-sensitive Staphylococcus aureus (MSSA), methicillin- resistant Staphylococcus aureus (MRSA), including multidrug-resistant (MDR) isolates).
- MSSA methicillin-sensitive Staphylococcus aureus
- MRSA methicillin- resistant Staphylococcus aureus
- MDR multidrug-resistant
- a PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, may be used for the treatment of Staphylococcus aureus bacteremia, including those caused by MDR MRSA isolatesln certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the United States in 2020.
- the activity of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is consistent, regardless of resistance phenotype (methicillin- sensitive Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), including multidrug-resistant (MDR) isolates).
- MSSA methicillin- sensitive Staphylococcus aureus
- MRSA methicillin-resistant Staphylococcus aureus
- MDR multidrug-resistant
- a PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, may be used for the treatment of Staphylococcus aureus bacteremia, including those caused by MDR MRSA isolates
- FIG. 1 depicts the prevalence of Staphylococcus aureus and methicillin-resistant Staphylococcus aureus (MRSA) among all causative pathogens of blood stream infections in U.S. hospitals over a 5-year period as described in the Examples.
- MRSA methicillin-resistant Staphylococcus aureus
- FIG. 2 depicts the proportion of a methicillin-resistant phenotype among Staphylococcus aureus isolates from patients with blood stream infections, including infective endocarditis, in U.S. hospitals over a 5-year period as described in the Examples.
- Carrier refers to a solvent, additive, excipient, dispersion medium, solubilizing agent, coating, preservative, isotonic and absorption delaying agent, surfactant, propellant, diluent, vehicle and the like with which an active compound is administered.
- Such carriers can be sterile liquids, such as water, saline solutions, aqueous dextrose solutions, aqueous glycerol solutions, and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like.
- “Pharmaceutically acceptable carrier” refers to any and all solvents, additives, excipients, dispersion media, solubilizing agents, coatings, preservatives, isotonic and absorption delaying agents, surfactants, propellants, diluents, vehicles and the like that are physiologically compatible.
- the carrier(s) must be “acceptable” in the sense of not being deleterious to the subject to be treated in amounts typically used in medicaments.
- Pharmaceutically acceptable carriers are compatible with the other ingredients of the composition without rendering the composition unsuitable for its intended purpose.
- pharmaceutically acceptable carriers are suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response).
- Non-limiting examples of pharmaceutically acceptable carriers or excipients include any of the standard pharmaceutical carriers such as phosphate buffered saline solutions, water, and emulsions such as oil/water emulsions and microemulsions. Suitable pharmaceutical carriers are described, for example, in Remington's Pharmaceutical Sciences by E.W. Martin, 18th Edition.
- Bactericidal refers to the property of causing the death of bacteria or capable of killing bacteria to an extent of at least a 3-log 10 (99.9%) or better reduction among an initial population of bacteria over an 18-24 hour period.
- Bacteriostatic refer to the property of inhibiting bacterial growth, including inhibiting growing bacterial cells, thus causing a 2-loglO (99%) or better and up to just under a 3-log reduction among an initial population of bacteria over an 18-24 hour period.
- Antibacterial refers to both bacteriostatic and bactericidal agents.
- Antibiotic refers to a compound having properties that have a negative effect on bacteria, such as lethality or reduction of growth. An antibiotic can have a negative effect on Gram-positive bacteria, Gram-negative bacteria, or both. By way of example, an antibiotic can affect cell wall peptidoglycan biosynthesis, cell membrane integrity, or DNA or protein synthesis in bacteria.
- Nonlimiting examples of antibiotics active against Gram-positive bacteria include methicillin, oxacillin, vancomycin, daptomycin, mupirocin, lysostaphin, penicillins, cloxacillin, erythromycin, carbapenems, cephalosporins, gly copeptides, lincosamides, azithromycin, clarithromycin, roxithromycin, telithromycin, spiramycin, and fidaxomicin.
- “Drug resistant” generally refers to a bacterium that is resistant to the antibacterial activity of a drug. When used in certain ways, drug resistance may specifically refer to antibiotic resistance. In some cases, a bacterium that is generally susceptible to a particular antibiotic can develop resistance to the antibiotic, thereby becoming a drug resistant microbe or strain.
- Effective amount refers to an amount which, when applied or administered in an appropriate frequency or dosing regimen, is sufficient to prevent, reduce, inhibit, or eliminate bacterial growth or bacterial burden or to prevent, reduce, or ameliorate the onset, severity, duration, or progression of the disorder being treated (for example, bacterial pathogen growth or infection), prevent the advancement of the disorder being treated, cause the regression of the disorder being treated, or enhance or improve the prophylactic or therapeutic effect(s) of another therapy, such as antibiotic or bacteriostatic therapy.
- Co-administer is intended to embrace separate administration of two agents, such as a lysin polypeptide and an antibiotic or any other antibacterial agent in a sequential manner as well as administration of these agents in a substantially simultaneous manner, such as in a single mixture/composition or in doses given separately, but nonetheless administered substantially simultaneously to the subject, for example at different times in the same day or 24-hour period.
- agents such as a lysin polypeptide and an antibiotic or any other antibacterial agent
- Such co-administration of lysin polypeptides with one or more additional antibacterial agents can be provided as a continuous treatment lasting up to days, weeks, or months. Additionally, depending on the use, the co-administration need not be continuous or coextensive.
- the lysin polypeptide could be administered only initially within 24 hours of the first antibiotic use, and then the antibiotic use may continue without further administration of the lysin polypeptide.
- Subject refers to a mammal, a plant, a lower animal, a single cell organism, or a cell culture.
- the term “subject” is intended to include organisms, e.g., prokaryotes and eukaryotes, which are susceptible to or afflicted with bacterial infections, for example Gram positive or Gram-negative bacterial infections.
- subjects include mammals, e.g., humans, dogs, cows, horses, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non human animals.
- the subject is a human, e.g., a human suffering from, at risk of suffering from, or susceptible to infection by Gram-positive bacteria, whether such infection be systemic, topical or otherwise concentrated or confined to a particular organ or tissue.
- Polypeptide is used interchangeably with the term “protein,” “peptide,” and refers to a polymer made from amino acid residues. In certain embodiments, the polypeptide has at least about 30 amino acid residues. The term may include not only polypeptides in isolated form, but also active fragments and derivatives thereof. The term “polypeptide” also encompasses fusion proteins or fusion polypeptides comprising PlySs2, an active fragment thereof, and a modified lysin polypeptide as described herein, which maintains the lysin function. Depending on context, a polypeptide can be a naturally-occurring polypeptide or a recombinant, engineered, or synthetically-produced polypeptide.
- a particular lysin polypeptide can be, for example, derived or removed from a native protein by enzymatic or chemical cleavage, or can be prepared using conventional peptide synthesis techniques (e.g., solid phase synthesis) or molecular biology techniques (such as those disclosed in Sambrook, J. et ak, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989)) or can be strategically truncated or segmented yielding active fragments, maintaining lytic activity against the same or at least one common target bacterium.
- conventional peptide synthesis techniques e.g., solid phase synthesis
- molecular biology techniques such as those disclosed in Sambrook, J. et ak, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989)
- can be strategically truncated or segmented yielding active fragments, maintaining lytic activity against the same or at least one common target bacterium can be strategically t
- Fusion polypeptide refers to an expression product resulting from the fusion of two or more nucleic acid segments, resulting in a fused expression product typically having two or more domains or segments with different properties or functionality.
- fusion polypeptide also refers to a polypeptide or peptide comprising two or more heterologous polypeptides or peptides covalently linked, either directly or via an amino acid or peptide linker.
- the polypeptides forming the fusion polypeptide are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N- terminus, or N-terminus to C-terminus.
- fusion polypeptide can be used interchangeably with the term “fusion protein.”
- the open-ended expression “a polypeptide comprising” a certain structure includes larger molecules than the recited structure such as fusion polypeptides or constructs.
- the constructs referred to herein can be made as fusion polypeptides or as conjugates (by linking two or more moieties).
- “Heterologous” refers to nucleotide, peptide, or polypeptide sequences that are not naturally contiguous.
- heterologous can be used to describe a combination or fusion of two or more peptides and/or polypeptides wherein the fusion peptide or polypeptide is not normally found in nature, such as for example a modified lysin polypeptide and a cationic and/or a polycationic peptide, an amphipathic peptide, a sushi peptide (Ding et al. Cell Mol Life Sci., 65(7-8): 1202-19 (2008)), a defensin peptide (Ganz, T.
- hydrophobic peptide and/or an antimicrobial peptide which may have enhanced lytic activity or fusion polypeptide comprising a PlySs2 CHAP and/or Sh3b domain fused to another lysins.
- fusion polypeptide comprising a PlySs2 CHAP and/or Sh3b domain fused to another lysins.
- two or more lysin polypeptides or active fragments thereof. can be used to make a fusion polypeptide with lytic activity.
- Active fragment refers to a portion of a polypeptide that retains one or more functions or biological activities of the isolated polypeptide from which the fragment was taken.
- an active fragment of a modified lysin polypeptide or PlySs2 inhibits the growth, or reduces the population, or kills at least one Gram-positive bacterial species, such as S. aureus.
- Amphipathic peptide refers to a peptide having both hydrophilic and hydrophobic functional groups. In certain embodiments, secondary structure places hydrophobic and hydrophilic amino acid residues at opposite sides (e.g.
- “Cationic peptide” refers to a peptide having a high percentage of positively charged amino acid residues.
- a cationic peptide has a pKa-value of 8.0 or greater.
- the term “cationic peptide” in the context of the present disclosure also encompasses polycationic peptides which are synthetically produced peptides composed of mostly positively charged amino acid residues, such as lysine and/or arginine residues. The amino acid residues that are not positively charged can be neutrally charged amino acid residues, negatively charged amino acid residues, and/or hydrophobic amino acid residues.
- Hydrophobic group refers to a chemical group such as an amino acid side chain which has low or no affinity for water molecules but higher affinity for oil molecules. Hydrophobic substances tend to have low or no solubility in water or aqueous phases and are typically apolar but tend to have higher solubility in oil phases. Examples of hydrophobic amino acids include glycine (Gly), alanine (Ala), valine (Val), Leucine (Leu), isoleucine (lie), proline (Pro), phenylalanine (Phe), methionine (Met), and tryptophan (Trp).
- “Augmenting” as used herein refers to a degree of activity of an agent, such as antimicrobial activity, that is higher than it would be otherwise. “Augmenting” encompasses additive as well as synergistic (superadditive) effects.
- “Synergistic” or “superadditive” refers to a beneficial effect brought about by two substances in combination that exceeds the sum of the effects of the two agents working independently. In certain embodiments the synergistic or superadditive effect significantly, /. ⁇ ? ., statistically significantly, exceeds the sum of the effects of the two agents working independently.
- One or both active ingredients may be employed at a subthreshold level, /. ⁇ ? ., a level at which if the active substance is employed individually produces no or a very limited effect. The effect can be measured by assays such as a checkerboard assay, described here.
- Treatment refers to any process, action, application, therapy, or the like, wherein a subject, including a human being, is subjected to medical aid with the object of curing a disorder, eradicating a pathogen, or improving the subject's condition, directly or indirectly. Treatment also refers to reducing incidence, alleviating symptoms, eliminating recurrence, preventing recurrence, preventing incidence, reducing the risk of incidence, improving symptoms, improving prognosis, or combinations thereof. “Treatment” may further encompass reducing the population, growth rate, or virulence of the bacteria in the subject and thereby controlling or reducing a bacterial infection in a subject or bacterial contamination of an organ, tissue, or environment.
- treatment that reduces incidence is effective to inhibit growth of at least one Gram-positive bacterium in a particular milieu, whether it be a subject or an environment.
- treatment of an already established infection refers to reducing the population, killing, inhibiting the growth, and/or eradicating the Gram-positive bacteria responsible for an infection or contamination ⁇
- the term “preventing” and includes the prevention of the incidence, recurrence, spread, onset, or establishment of a disorder such as a bacterial infection. It is not intended that the present disclosure be limited to complete prevention or to prevention of establishment of an infection. In some embodiments, the onset is delayed, or the severity of a subsequently contracted disease or the chance of contracting it is reduced, and such constitute examples of prevention. With specific reference to biofilm prevention, the term includes prevention of the formation of biofilm, for example by interfering with the adherence of bacteria on a surface of interest, such as the surface of a medical device (e.g., inhaler, catheter, intubation, valve, or other prosthesis).
- a medical device e.g., inhaler, catheter, intubation, valve, or other prosthesis.
- Constracted disease refers to a disease manifesting with clinical or subclinical symptoms, such as the detection of fever, sepsis, or bacteremia, as well as disease that may be detected by growth of a bacterial pathogen (e.g., in culture) when symptoms associated with such pathology are not yet manifest.
- a contracted disease shall include a biofilm containing bacteria, such as Staphylococcus or Streptococcus bacteria, and forming when such a device is in use.
- derivatives in the context of a peptide or polypeptide (which as stated herein includes an active fragment) is intended to encompass, for example, a polypeptide modified to contain one or more chemical moieties other than an amino acid that do not substantially adversely impact or destroy the polypeptides ’s activity, such as lytic activity.
- the chemical moiety can be linked covalently to the peptide, e.g., via an amino terminal amino acid residue, a carboxy terminal amino acid residue, or at an internal amino acid residue. Such modifications may be natural or non-natural.
- a non-natural modification may include the addition of a protective or capping group on a reactive moiety, addition of a detectable label, such as antibody and/or fluorescent label, addition or modification of glycosylation, or addition of a bulking group such as PEG (pegylation) and other changes known to those skilled in the art.
- the non-natural modification may be a capping modification, such as N-terminal acetylations and C-terminal amidations.
- Exemplary protective groups that may be added to lysin polypeptides include, but are not limited to, t-Boc and Fmoc.
- fluorescent label proteins such as, but not limited to, green fluorescent protein (GFP), red fluorescent protein (RFP), cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and mCherry, are compact proteins that can be bound covalently or noncovalently to a lysin polypeptide or fused to a lysin polypeptide without interfering with normal functions of cellular proteins.
- GFP green fluorescent protein
- RFP red fluorescent protein
- CFP cyan fluorescent protein
- YFP yellow fluorescent protein
- mCherry are compact proteins that can be bound covalently or noncovalently to a lysin polypeptide or fused to a lysin polypeptide without interfering with normal functions of cellular proteins.
- a polynucleotide encoding a fluorescent protein is inserted upstream or downstream of the lysin polynucleotide sequence.
- a fusion protein e.g., Lysin Polypeptide:: GFP
- a fusion protein e.g., Lysin Polypeptide:: GFP
- PEG polyethylene glycol
- derivative encompasses lysin polypeptides chemically modified by covalent attachment of one or more PEG molecules. It is anticipated that pegylated lysin polypeptides will exhibit prolonged circulation half-life compared to the unpegylated lysin polypeptides, while retaining biological and therapeutic activity.
- Another example is the use of “artilysins”, whereby a short polycationic and amphipathic alpha helices are appended to the N- or C-termini of a lysin polypeptide to improve in vitro antibacterial activity, such as a streptococcal lysin to improve in vitro anti-streptococcal activity.
- Percent amino acid sequence identity refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, such as a lysin polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as a part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for example, using publicly available software such as BLAST or software available commercially for example from DNASTAR. Two or more polypeptide sequences can be anywhere from 0-100% identical, or any integer value there between.
- two polypeptides are “substantially identical” when at least 80% of the amino acid residues (preferably at least about 85%, at least about 90%, and preferably at least about 95%, at least about 98%, or at least 99%) are identical.
- the term “percent (%) amino acid sequence identity” as described herein applies to peptides as well.
- substantially identical will encompass mutated, truncated, fused, or otherwise sequence-modified variants of isolated polypeptides and peptides, such as those described herein, and active fragments thereof, as well as polypeptides with substantial sequence identity (e.g., at least 80%, at least 85%, at least 90%, at least 95% identity, at least 98% identity, or at least 99% identity as measured for example by one or more methods referenced above) as compared to the reference (wild type or other intact) polypeptide.
- substantial sequence identity e.g., at least 80%, at least 85%, at least 90%, at least 95% identity, at least 98% identity, or at least 99% identity as measured for example by one or more methods referenced above
- Two amino acid sequences are “substantially homologous” when at least about 80% of the amino acid residues (preferably at least about 85%, at least about 90%, at least about 95%, at least about 98% identity, or at least about 99% identity) are identical, or represent conservative substitutions.
- sequences of polypeptides of the present disclosure are substantially homologous when one or more, or several, or up to 10%, or up to 15%, or up to 20% of the amino acids of the polypeptide, such as the lysin and/or fusion polypeptides described herein, are substituted with a similar or conservative amino acid substitution, and wherein the resulting polypeptide, such as the lysin and/or fusion polypeptides described herein, have at least one activity, antibacterial effects, and/or bacterial specificities of the reference polypeptide, such as the lysin and/or fusion polypeptides described herein.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge. Families of amino acid residues having side chains with similar charges have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
- beta- branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- “Inhalable composition” refers to pharmaceutical compositions of the present disclosure that are formulated for direct delivery to the respiratory tract during or in conjunction with routine or assisted respiration (e.g., by intratracheobronchial, pulmonary, and/or nasal administration), including, but not limited to, atomized, nebulized, dry powder, and/or aerosolized formulations.
- Biofilm refers to bacteria that attach to surfaces and aggregate in a hydrated polymeric matrix that may be comprised of bacterial- and/or host-derived components.
- a biofilm is an aggregate of microorganisms in which cells adhere to each other on a biotic or abiotic surface. These adherent cells are frequently embedded within a matrix comprised of, but not limited to, extracellular polymeric substance (EPS).
- EPS extracellular polymeric substance
- Biofilm EPS which is also referred to as slime (although not everything described as slime is a biofilm) or plaque, is a polymeric conglomeration generally composed of extracellular DNA, proteins, and polysaccharides.
- the biofilm may contain Staphylococcus and/or Streptococcus bacteria.
- Suitable in the context of an antibiotic being suitable for use against certain bacteria refers to an antibiotic that was found to be effective against those bacteria even if resistance subsequently developed.
- Wild -type PlySs2 lysin and “PlySs2 lysin,” refer to a polypeptide having the amino acid sequence:
- Modified lysin polypeptide or “variant” in reference to SEQ ID NO: 1 or SEQ ID NO: 18 as used herein are used interchangeably to refer to a non-naturally occurring variant (or active fragment thereof) of the wild-type PlySs2 lysin (SEQ ID NO: 1) or the wild-type PlySs2 lysin, wherein the initial methionine residue is removed (SEQ ID NO: 18).
- the modified lysin polypeptide or variant of SEQ ID NO: 1 or SEQ ID NO: 18 has at least one amino acid substitution in the CHAP domain and/or the SH3b domain, and inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as S. aureus.
- the modified lysin polypeptide or variant has at least 80% identity, such as 90%, such as 95%, such as 99%, such as 99.5% identity to SEQ ID NO: 1 or SEQ ID NO: 18.
- Immunogenic means predicted to be immunogenic or to have immunogenicity by establishing (for example, through computationally guided in silico methods) the existence of one or more T-cell epitopes.
- Immunogenicity of a modified lysin polypeptide as disclosed herein can be measured by TCE score, using any available in silico computationally guided method for obtaining such score and compared to the similarly derived TCE score of a wild-type PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1.
- immunogenicity of a modified lysin polypeptide as disclosed herein can be measured by an in vitro T cell response.
- “less immunogenic,” “reduced immunogenicity,” or the like means predicted to be less immunogenic or to have reduced immunogenicity by depletion (which includes elimination or attenuation by amino acid replacement) of one or more T-cell epitopes (i.e., have a lower TCE score as compared to a reference polypeptide) or that the modified lysin polypeptide as disclosed herein elicits a reduced T cell response.
- a modified lysin polypeptide is “less immunogenic,” or has “reduced immunogenicity,” or the like if the modified lysin polypeptide has either 1) a lower TCE score than a wild-type PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1 or 2) a reduced T cell response.
- “Reduced T cell response” means that the modified lysin polypeptide induces less T cell activation than a wild-type PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1, as measured by an in vitro T cell proliferation ( 3 ⁇ H] -thymidine incorporation) assay using CD8+ depleted, human peripheral blood mononuclear cells in which the human peripheral blood mononuclear cells are exposed to fluorescein isothiocyanate-labeled anti-cytokine antibodies and the response measured.
- “Substantially” used in the context of lytic activity (antimicrobial activity) of a modified lysin polypeptide of the present disclosure means at least a considerable portion of the antibacterial activity of the wild-type PlySs2 lysin, such that, on the basis of such activity, the modified lysin polypeptide would be useful alone or together with other antimicrobial agents, such as one or more antibiotics and/or lysostaphin, to inhibit, combat, or eliminate Staphylococcal or Streptococcal bacterial infection by killing these bacteria.
- antimicrobial agents such as one or more antibiotics and/or lysostaphin
- Nonlimiting examples of such substantial activity compared to the wild-type PlySs2 lysin include no more than about 5, such as no more than about 4, no more than about 3, or no more than about 2, times the MIC of the wild-type lysin.
- Other measures of activity can be, for example, minimum biofilm eliminating concentration (MBEC) or in vivo efficacy using, for example, an animal model, such as the mouse neutropenic thigh infection model (MNTI).
- Still other measures can be the ability to synergize with antibiotics, such as vancomycin, daptomycin or oxacillin, or the ability to ameliorate, prevent, or delay development of, bacterial resistance of antibiotics, such as vancomycin, daptomycin or oxacillin, similar to the wild-type PlySs2 lysin.
- antibiotics such as vancomycin, daptomycin or oxacillin
- substantially used in the context of reduced immunogenicity means having at most 65%, such as at most 50%, at most 40%, at most 30%, or at most 25% of the immunogenicity of the wild- type PlySs2 lysin, as measured for example by a TCE score [19].
- the lysin polypeptides as described herein comprising the PlySs2 lysins of SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof) are capable of inhibiting the growth, reducing the population, or killing a multidrug -resistant MDR pathogen, such as at least one species, e,gNeill at least one strain or isolate of at least one species, of a Gram-positive bacteria, which is multidrug-resistant.
- a multidrug -resistant MDR pathogen such as at least one species, e,gNeill at least one strain or isolate of at least one species, of a Gram-positive bacteria, which is multidrug-resistant.
- MDR multidrug-resistant pathogen
- a “multidrug-resistant” (“MDR”) pathogen such as multidrug-resistant Gram-positive bacteria, is one that has developed resistance or become non-susceptible to at least two antimicrobial drugs (in some embodiment, of different class), each used as a monotherapy.
- susceptibility, non-susceptibility and resistance are determined by breakpoints (interpretive criteria).
- Drugs such as antibiotics, may have susceptible only breakpoints (S); resistance only breakpoints (R); S, intermediate (I) and R breakpoints; or more typically, S and R breakpoints.
- susceptibility may be determined using Antimicrobial susceptibility testing (AST), which involves laboratory testing on microbes, including bacteria, to determine susceptibility or resistance to one or more drugs. Results of antimicrobial susceptibility testing show if, e.g., bacteria are susceptible (can be treated with drug), intermediate (may be treatable with drug, but may require a higher dosage), or resistant (cannot be treated with drug).
- AST Antimicrobial susceptibility testing
- multidrug-resistant Gram-positive bacteria are those that have a developed resistance or become non-susceptible to at least two, such as at least three, antimicrobial drugs, optionally in addition to oxacillin and/or methicillin, typically in addition to oxacillin.
- the multidrug-resistant Gram-positive bacteria such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non- susceptible to at least two, such as at least three, such as at least four, such as at least five antibiotics, wherein each of the at least two, at least three or at least four antibiotics are from different antibiotic classes, such as those selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and a sulfonamide/trimethoprim.
- the multidrug-resistant Gram-positive bacteria of the present disclosure are resistant and/or non-susceptible to at least two, such as at least three antibiotics, wherein each antibiotic is from a different antibiotic class, such as an antibiotic class selected from a macrolide, an aminoglycoside, a fluoroquinolone, a ketolide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- a different antibiotic class such as an antibiotic class selected from a macrolide, an aminoglycoside, a fluoroquinolone, a ketolide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
- the multidrug-resistant bacteria such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to a beta lactam, such as oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
- a beta lactam such as oxacillin and/or methicillin
- the multidrug-resistant bacteria such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to all beta lactams including penicillins, carbapenems and first to fourth generation cephalosporins, but not to the fifth generation anti-MRSA cephalosporins (for example ceftaroline).
- the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from erythoromycin, levofloxacin, ceftaroline, linezolid and vancomycin. In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and methicillin, selected from erythromycin, levofloxacin and ceftaroline.
- the multidrug-resistant Gram-positive bacteria of the present disclosure are bacteria that have developed resistance or became non-susceptible to antimicrobial drugs, such as a Staphylococcus aureus, that is resistant and/or non-susceptible to two or more, in some embodiments, three or more antibiotics, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
- antimicrobial drugs such as a Staphylococcus aureus
- the multidrug- resistant Gram-positive bacteria is Staphylococcus aureus resistant and/or non-susceptible to three or more antibiotics, e.g., selected from ceftaroline, clindamycin, doxycycline, erythromycin, levofloxacin.
- the multidrug-resistant Gram-positive bacteria of the present disclosure have additionally developed resistance or are non-susceptible to oxacillin.
- the multidrug-resistant bacteria are MSSA. In some embodiments, the multidrug-resistant bacteria are MRSA. In some embodiments of all aspects of the disclosure, the multidrug-resistant bacteria do not include MRSA. In other embodiments of all aspects of the disclosure, the multidrug-resistant bacteria include MRSA strain that are also resistant and/or non-susceptible to two or more, in some embodiments, three or more antibiotics, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin. PlySs2
- PlySs2 or a fragment or variant thereof thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as multidrug-resistant bacteria, such as at least one isolate or at least one strain of at least one species of Gram-positive bacteria, which multidrug-resistant as described herein.
- Gram-positive bacteria such as multidrug-resistant bacteria, such as at least one isolate or at least one strain of at least one species of Gram-positive bacteria, which multidrug-resistant as described herein.
- PlySs2 As used herein, the terms “PlySs2”, “PlySs2 lysin”, “PlySs2 lysins”, “PlySs2” “CF- 301” and “exebacase” are used interchangeably and encompass PlySs2, set forth herein as SEQ ID NO: 1 (with or without the initial methionine residue or SEQ ID NO: 18).
- PlySs2 which was identified as an anti-staphylococcal lysin encoded within a prophage of the Streptococcus suis genome, exhibits bacteriocidal and bacteriostatic activity against the following exemplified bacteria.
- MSSA resistance phenotype
- MRSA resistance phenotype
- Surveillance data as presented herein further support PlySs2, i.e., exebacase, as an option for the treatment of Staphylococcus aureus, including those caused by MDR MRSA isolates.
- the PlySs2 lysin of SEQ ID NO: 1 has a domain arrangement characteristic of most bacteriophage lysins, defined by a catalytic N-terminal domain linked to a cell wall-binding C-terminal domain.
- the N-terminal domain belongs to the cysteine-histidine-dependent amidohydrolases/peptidases (CHAP) family common among lysins and other bacterial cell wall-modifying enzymes.
- CHAP domain cysteine-histidine-dependent amidohydrolases/peptidases
- the C-terminal domain belongs to the SH3b family that typically forms the cell wall-binding element of lysins.
- the italicized amino acids indicate the CHAP domain (amino acids 1 to 146) and the dotted underline indicates the SH3b domain (amino acids 157 to 245).
- the naturally occurring linker between the two domains is PPGTVAQSAP (SEQ ID NO: 2).
- PlySs2 or a fragment or variant thereof suitable for use with the present methods includes an isolated polypeptide sequence having at least 70%, such as at least 80%, such as at least 85%, such as at least 90%, such as at least 95%, such as at least 98%, such as at least 99% sequence, such as at least 99.5% identity with SEQ ID NO: 1 or SEQ ID NO: 18, wherein the PlySs2 or a fragment or variant thereof retains one or more biological activities, e.g., catalytic activity, ability to bind to bacterial cell walls, such as Staphylococcus or Streptococcus, bacteriocidal or bacteriostatic activity, including the ability to kill Gram-positive bacteria in biofilm, such as Staphylococcus and/or Streptococcus of the PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1 described herein.
- biological activities e.g., catalytic activity, ability to bind to bacterial cell walls, such as Staphy
- a modified lysin polypeptide may be formed by any method known in the art as described herein and as described in WO 2013/170015, which is herein incorporated by reference in its entirety, e.g., by modifying the PlySs2 lysin of SEQ ID NO: 1 or SEQ ID NO: 18 through site-directed mutagenesis or via mutations in hosts that produce the PlySs2 lysin of SEQ ID NO: 1 or SEQ ID NO: 18, and which retain one or more of the biological functions as described herein.
- substitutions or replacements can be made with either or both of the CHAP and/or SH3b domain sequences or with the PlySs2 lysin full amino acid sequence of SEQ ID NO: 1, for instance, to identify amino acids for substitution.
- a mutant or variant having an alanine replaced for valine at valine amino acid residue 19 in the PlySs2 amino acid sequence of SEQ ID NO: 1 is active and capable of killing Gram-positive bacteria in a manner similar to and as effective as the SEQ ID NO: 1 PlySs2 lysin.
- the CHAP domain contains conserved cysteine and histidine amino acid sequences (the first cysteine and histidine in the CHAP domain) which are characteristic and conserved in CHAP domains of different polypeptides. It is reasonable to predict, for example, that the conserved cysteine and histidine residues should be maintained in a mutant or variant of PlySs2 so as to maintain activity or capability. Accordingly, particularly desirable residues to retain in a lysin variant of the present disclosure include active-site residues Cys26, Hisl02, Glull8, and Asnl20 in the CHAP domain of SEQ ID NO: 1.
- substitutions include: Lys for Arg and vice versa such that a positive charge may be maintained, Glu for Asp and vice versa such that a negative charge may be maintained, Ser for Thr such that a free -OH can be maintained and Gin for Asn such that a free NH2 can be maintained.
- Other suitable variants include substitutions in SEQ ID NO: 1 in the CHAP and/or SH3 domain regions that are not shared between other known lysins, such as between the CHAP domain of instant SEQ ID NO: 1 and the CHAP domain of PlyC as shown in for example, in Schmitz, 2011, “Expanding the Horizons of Enzybiotic Identification” Student Theses and Dissertations, paper 138, which is herein incorporated by reference in its entirety. Suitable modified lysins are also described herein.
- the present method includes administering an active fragment of a lysin to a subject in need thereof.
- Suitable active fragments include those that retain a biologically active portion of a protein or peptide fragment of the embodiments, as described herein.
- modified lysin polypeptides include polypeptides comprising amino acid sequences that include fewer amino acids than the full length protein of the lysin protein and exhibit at least one activity of the corresponding full-length protein.
- biologically active portions comprise a domain or motif with at least one activity of the corresponding protein.
- a biologically active portion of a protein or protein fragment of the disclosure can be a polypeptide which is, for example, 10, 25, 50, 100 amino acids in length.
- Other biologically active portions, in which other regions of the protein are deleted can be prepared by recombinant techniques and evaluated for one or more of the functional activities of the native form of a polypeptide of the embodiments.
- suitable active fragments include those having at least 70%, such as at least 80%, such as at least 85%, such as at least 90%, such as at least 95%, such as at least 98% or such as at least 99% sequence identity with the active fragments described herein including the CHAP and/or the SH3b domain, wherein the active fragment thereof retains at least one activity of CHAP and/or the SH3b domain.
- a lysin or active fragment thereof or modified lysin polypeptide as described herein for use in the present method may be produced by a bacterial organism after being infected with a particular bacteriophage or may be produced or prepared recombinantly or synthetically, e.g., chemically synthesized or prepared using a cell free synthesis system.
- the present lysins may be produced via the isolated gene for the lysin from the phage genome, putting the gene into a transfer vector, and cloning said transfer vector into an expression system, using standard methods of the art, as described for example in WO 2013/170015, which is herein incorporated by reference in its entirety.
- the present modified lysin polypeptides may be truncated, chimeric, shuffled or “natural,” and may be in combination as described, for example, in U. S. Patent No. 5,604,109, which is incorporated herein in its entirety by reference.
- Mutations can be made in the amino acid sequences, or in the nucleic acid sequences encoding the polypeptides and lysins described herein, including in the lysin sequence set forth in SEQ ID NO: 1, SEQ ID NO: 18 or in active fragments or truncations thereof, such that a particular codon is changed to a codon which codes for a different amino acid to obtain a sequence with a substituted amino acid, or one or more amino acids are deleted or added.
- Such a mutation is generally made by making the fewest nucleotide changes possible.
- a substitution mutation of this sort can be made to change an amino acid in the resulting protein in a non-conservative manner (for example, by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to another grouping) or in a conservative manner (for example, by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to the same grouping).
- a conservative change generally leads to less change in the structure and function of the resulting protein.
- a non-conservative change is more likely to alter the structure, activity or function of the resulting protein.
- the present disclosure should be considered to include sequences containing conservative changes which do not significantly alter the activity or binding characteristics of the resulting protein.
- amino acid changes or substitutions in the lysin polypeptide sequence can be made to replace or substitute one or more, one or a few, one or several, one to five, one to ten, or such other number of amino acids in the sequence of the lysin(s) provided herein to generate mutants or modified lysin polypeptides thereof.
- mutants or modified lysin polypeptide thereof may be predicted for function or tested for function or capability for anti-bacterial activity as described herein against, e.g., Staphylococcal, Streptococcal, or Enterococcal bacteria, and/or for having comparable activity to the lysin(s) as described and particularly provided herein.
- changes made to the sequence of lysin, and mutants or modified lysin polypeptide described herein can be tested using the assays and methods known in the art and described herein.
- the present disclosure is directed to methods of using a modified lysin polypeptide having lytic activity and reduced immunogenicity as compared to a wild-type PlySs2 lysin against multidrug-resistant Gram-positive bacteria.
- lytic activity encompasses the ability of a lysin to kill bacteria, reduce the population of bacteria or inhibit bacterial growth. Lytic activity also encompasses the ability to remove or reduce a biofilm and/or the ability to reduce the minimum inhibitory concentration (MIC) of an antibiotic.
- the present modified lysin polypeptides are capable of degrading peptidoglycan, a major structural component of the bacterial cell wall, resulting in cell lysis.
- the modified lysin polypeptides are further capable of reducing immunogenicity and/or reducing inflammatory response-related toxicity compared to a wild-type PlySs2 lysin.
- a MIC value i.e., the minimum concentration of peptide sufficient to suppress at least 80% of the bacterial growth compared to control
- a MIC value may be determined for a modified lysin polypeptide and compared to, e.g., a wild-type PlySs2 lysin or inactive compound.
- MIC values for a modified lysin polypeptide may be determined against e.g., laboratory Staphylococcus aureus strains, in e.g., Mueller- Hinton broth or Mueller-Hinton broth supplemented with serum, such as horse serum.
- the present modified lysin polypeptides are capable of reducing a biofilm.
- Methods for assessing the Minimal Biofilm Eradicating Concentration (MBEC) of a modified lysin polypeptide may be determined using a variation of the broth microdilution MIC method with modifications (See Ceri et al. 1999. J. Clin Microbial. 37 : 1771- 1776, which is herein incorporated by reference in its entirety and Schuch et al., 2017, Antimicrob. Agents Chemother. 61, pages 1-18, which is herein incorporated by reference in its entirety.) In this method, colonies of bacteria, e.g., Staphylococcus aureus such as methicillin- resistant S.
- MRSA methicillin-susceptible S. aureus
- MSSA methicillin-susceptible S. aureus
- medium e.g., phosphate buffer solution (PBS) diluted e.g., 1:100 in TSBg (tryptic soy broth supplemented with 0.2% glucose), added as e.g., 0.15 ml aliquots, to a Calgary Biofilm Device (96-well plate with a lid bearing 96 polycarbonate pegs; lnnovotech Inc.) and incubated e.g., 24 hours at 37°C.
- PBS phosphate buffer solution
- TSBg tryptic soy broth supplemented with 0.2% glucose
- Biofilms are then washed and treated with e.g., a 2-fold dilution series of the lysin in TSBg at e.g., 37°C for 24 hours. After treatment, wells are washed, air-dried at e.g., 37°C and stained with e.g., 0.05% crystal violet for 10 minutes. After staining, the biofilms are destained in e.g., 33% acetic acid and the OD600 of e.g., extracted crystal violet is determined. The MB EC of each sample is the minimum lysin concentration required to remove >95% of the biofilm biomass assessed by crystal violet quantitation.
- the present modified lysin polypeptides reduce the minimum inhibitory concentration (MIC) of an antibiotic. Any known method to assess MIC may be used.
- a checkerboard assay is used to determine the effect of a lysin on antibiotic concentration. The checkerboard assay is based on a modification of the CLSI method for MIC determination by broth microdilution (See Clinical and Laboratory Standards Institute (CLSI), CLSI. 2015. Methods for Dilution Antimicrobial Susceptibility Tests for Bacteria That Grow Aerobically; Approved Standard-lOth Edition. Clinical and Laboratory Standards Institute, Wayne, PA, which is herein incorporated by reference in its entirety and Ceri et al. 1999. J. Clin. Microbiol. 37: 1771-1776, which is also herein incorporated by reference in its entirety).
- Checkerboards are constructed by first preparing columns of e.g., a 96-well polypropylene microtiter plate, wherein each well has the same amount of antibiotic diluted 2- fold along the horizontal axis. In a separate plate, comparable rows are prepared in which each well has the same amount of lysin diluted e.g., 2-fold along the vertical axis. The lysin and antibiotic dilutions are then combined, so that each column has a constant amount of antibiotic and doubling dilutions of lysin, while each row has a constant amount of lysin and doubling dilutions of antibiotic. Each well thus has a unique combination of lysin and antibiotic.
- Bacteria are added to the drug combinations at a given concentration.
- the MIC of each drug, alone and in combination, is then recorded after e.g., 16 hours at 37°C in ambient air.
- Summation fractional inhibitory concentrations ( ⁇ FICs) are calculated for each drug and the minimum ⁇ LIC value ( ⁇ FICmin) is used to determine the effect of the lysin/antibiotic combination.
- the lysin polypeptides disclosed herein have been modified from a wild-type PlySs2 lysin.
- wild-type PlySs2 comprises both a CHAP domain and a SH3b domain, each of which in turn comprises multiple T-cell epitopes (TCE).
- TCE 1 corresponds to amino acid residues 32-45 of SEQ ID NO: 1.
- TCE 2 corresponds to amino acid residues 84-98 of SEQ ID NO: 1.
- TCE 3 corresponds to amino acid residues 100-112 of SEQ ID NO: 1.
- TCE 4 corresponds to amino acid residues 128-145 of SEQ ID NO: 1.
- TCE 5 corresponds to amino acid residues 164-170 of SEQ ID NO: 1.
- TCE 6 corresponds to amino acid residues 172-187 of SEQ ID NO: 1.
- TCE 7 corresponds to amino acid residues 189-201 of SEQ ID NO: 1, and TCE 8 corresponds to amino acid residues 204-221 of SEQ ID NO: 1.
- the modified lysin polypeptide comprises at least one substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the at least one substitution is in one or more of TCE 1, TCE 2, TCE 3, or TCE 4, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- the modified lysin polypeptide comprises at least one substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the at least one substitution is in one or more of TCE 5, TCE 6, TCE 7, or TCE 8, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- the modified lysin polypeptide comprises at least a first substitution and at least a second substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the at least the first substitution is in one or more of TCE 1, TCE 2, TCE 3, or TCE 4 and at least the second substitution is in one or more of TCE 5, TCE 6, TCE 7, or TCE 8, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- the modified lysin polypeptide has reduced immunogenicity as compared to a wild-type PlySs2 having the amino acid sequence of SEQ ID NO: 1.
- the modified lysin polypeptide comprises at least two substitutions as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1) or SEQ ID NO: 18, wherein the at least two substitutions are in TCE 4.
- the modified lysin polypeptide comprises at least four substitutions as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1) or SEQ ID NO: 18, wherein at least one substitution is in TCE 2, at least one substitution is in TCE 3, and at least two substitutions are in TCE 4.
- a modified lysin polypeptide as disclosed herein may result from modifying the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 18 by an amino acid substitution in the CHAP domain in at least one position selected from amino acid residue 35, 92, 104, 128, and 137 and/or an amino acid substitution in the SH3b domain in at least one position selected from amino acid residue 164, 184, 195, 198, 204, 206, 212, and 214.
- a modified lysin polypeptide having at least one amino acid substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1) wherein the modified lysin polypeptide comprises at least one amino acid substitution in the CHAP domain in at least one position selected from amino acid residue 35, 92, 104, 128, and 137 of SEQ ID NO: 1 or SEQ ID NO: 18 and/or at least one amino acid substitution in SH3b domain in at least one position selected from amino acid residue 164, 184, 195, 198, 204, 206, 212, and 214 of SEQ ID NO: 1 or SEQ ID NO: 18, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- the modified lysin polypeptide comprises an amino acid substitution in amino acid residues of 92, 104, 128, and 137 of SEQ ID NO: 1 or SEQ ID NO: 18. In certain embodiments, the modified lysin polypeptide comprises an amino acid substitution in amino acid residues 92, 104, 128, 137, 164, 184, and 198 of SEQ ID NO: 1 or SEQ ID NO: 18. Typically, the modified lysin polypeptide has reduced immunogenicity as compared to a wild-type PlySs2 having the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 18.
- the modified lysin polypeptide may contain at least 3 amino acid substitutions, such as at least 4, at least 5, at least 6, at least 7, at least 8, or at least 9 amino acid substitutions. In certain embodiments, the modified lysin polypeptide may contain 3-9 amino acid substitutions, such as 4-9, 5-9, 6-9, 7-9, 8-9, or 9 amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18.
- the modified lysin polypeptide may comprise at least two, such as at least three or at least four, amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18 in the CHAP domain, and in certain embodiments, the modified lysin polypeptide may comprise at least two, such as at least three or at least four, amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18in the SH3b domain.
- the modified lysin polypeptide may consist of two, three or four amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18 in the CHAP domain, and in certain embodiments, the modified lysin polypeptide may consist of two, three, or four amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18in the SH3b domain.
- the modified lysin polypeptide comprises one or more of the following amino acid substitutions relative to SEQ ID NO: 1: R35E, L92W, V104S, V128T, Y137S, Y164N, Y164K, N184D, R195E, S198H, S198Q, V204K, V204A, 1206E, V212E, V212A, and V214G.
- the modified lysin polypeptide comprises one or more of the following amino acid substitutions located in the CHAP domain: R35E, L92W, V104S, V128T and Y137S, and/or one or more of the following amino acid substitutions located in the SH3b domain: Y164N, Y164K, N184D, R195E, S198H, S198Q, V204K, V204A, I206E, V212A, V212E, and V214G, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
- corresponding modifications are obtained in reference to SEQ ID NO: 18.
- the modified lysin polypeptide has reduced immunogenicity as compared to a wild-type PlySs2 having the amino acid sequence of SEQ ID NO: 1.
- substitutions herein are designated using the one-letter amino acid code of the original amino acid in SEQ ID NO: 1 that is replaced, followed by the amino acid position in SEQ ID NO: 1, followed by the amino acid that is substituted into the sequence to result in the modified lysin polypeptide. Accordingly, by way of example, R35E indicates a substitution wherein the arginine at amino acid number 35 of SEQ ID NO: 1 is replaced with glutamic acid.
- Exemplary modified lysin polypeptides are disclosed herein as pp55, pp61, pp65, pp296, pp324, pp325, pp341, pp338, pp388, pp400, pp616, pp619, pp628, pp632, and pp642.
- the exemplary modified lysin polypeptides comprise the amino acid substitutions relative to the amino acid sequence of SEQ ID NO:l as shown below in Table 1.
- the modified lysin polypeptide is pp55 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQID NO: 1: L92W, V104S, V128T, and Y137S. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 3.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 3, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 3.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 3.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 3.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 3.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 3.
- the modified lysin polypeptide is pp61 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, S198H, and I206E.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 4, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 4.
- the modified lysin polypeptide thereof is pp65 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, S198Q, V204A, and V212A.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 5.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 5, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 5.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 5.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 5.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 5. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 5.1n certain embodiments disclosed herein, the modified lysin polypeptide is pp296 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, N184D, and S198Q, such that the amino acid sequence is
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 6, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 6.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 6.
- the modified lysin polypeptide is pp324 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, and N184D. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 7.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 7, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 7.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 7.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 7.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 7.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 7.
- the modified lysin polypeptide is pp325 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164N, and R195E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 8.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 8, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 8.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 8.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 8.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 8.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 8.
- the modified lysin polypeptide is pp381 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, N184D, and S198H.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 9.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 9, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 9.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 9.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 9.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 9. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 9. [00123] In certain embodiments disclosed herein, the modified lysin polypeptide is pp341 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, N184D, V204A, and V212A.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 10, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 10.
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 10.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 10.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 10.
- the modified lysin polypeptide is pp388 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: Y164N, N184D, R195E, V204K, and V212E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 11.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 11, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 11.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 11.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 11.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 11.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 11.
- the modified lysin polypeptide is pp400 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: R35E, L92W, V104S, V128T, and Y137S. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 12.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 12, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 12.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 12.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 12.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 12.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 12.
- the modified lysin polypeptide is pp616 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: V128T, Y137S, and Y164K.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 13.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 13, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 13.
- the modified lysin polypeptide is pp619 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, and Y164K. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 14.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 14, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 14.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 14.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 14.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 14.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 14.
- the modified lysin polypeptide is pp628 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, V204K, and V212E.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 15.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 15, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 15.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 15.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 15.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 15.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 15.
- the modified lysin polypeptide is pp632 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, N184D, S198Q, V204K, and V212E.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 16.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 16, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 16.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 16.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 16.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 16.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 16.
- the modified lysin polypeptide is pp642 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, I206E, and V214G.
- the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 17.
- the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 17, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1).
- the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 17.
- the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 17.
- the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 17.
- the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 17.
- the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 17.
- the modified lysin polypeptides can also include one or more amino acid insertions and/or deletions, provided those modifications do not interfere with the lytic activity and/or reduced immunogenicity of the modified lysin polypeptide.
- Chimeric lysin polypeptides are known in the art.
- ClyF is a chimeric lysin that combines the catalytic domain of Plyl87 lysin (the N-terminal 157 amino acid residues) with the binding domain of PlySs2 (the C-terminal 99 residues) [10].
- the chimeric lysin polypeptide comprises a modified PlySs2 CHAP domain, as disclosed herein, and the binding domain of another lysin.
- the chimeric lysin polypeptide comprises the catalytic domain of another lysin and a modified PlySs2 SH3b domain, as disclosed herein.
- an active fragment of the modified lysin polypeptide is obtained.
- the term “active fragment” refers to a portion of a full-length lysin, which retains one or more biological activities of the reference lysin.
- an active fragment of a modified lysin polypeptides inhibits the growth, or reduces the population, or kills at least one Gram-positive bacterial species.
- Nucleic acids encoding PlySs2 or the modified lysin polypeptides disclosed herein can be introduced into an appropriate vector for expressing the modified lysin polypeptides.
- any system or vector suitable to maintain, propagate or express a polypeptide in a host may be used for expression of the modified lysin polypeptides disclosed herein or fragments thereof or PlySs2 or fragments thereof.
- “recombinant expression vectors” or “expression vectors,” can direct the expression of genes to which they are operatively linked.
- DNA/polynucleotide sequence may be inserted into the expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et al., eds., Molecular Cloning: A Laboratory Manual (3rd Ed.), Vols. 1-3, Cold Spring Harbor Laboratory (2001).
- tags can also be added to the modified lysin polypeptides of the present disclosure or PlySs2 to provide convenient methods of isolation, e.g., c-myc, biotin, poly-His, etc. Kits for such expression systems are commercially available.
- a wide variety of host/expression vector combinations may be employed in expressing the polynucleotide sequences encoding the present modified lysin polypeptides or PlySs2.
- suitable vectors are known to those of skill in the art, and are commercially available. Examples of suitable vectors are provided, e.g., in Sambrook et al, eds., Molecular Cloning: A Laboratory Manual (3rd Ed.), Vols. 1-3, Cold Spring Harbor Laboratory (2001).
- Such vectors include, among others, chromosomal, episomal and vims derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids.
- vectors include, among others, chromosomal, episomal and vims derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as bac
- the vectors may provide for the constitutive or inducible expression of PlySs2 or the modified lysin polypeptides of the present disclosure.
- Suitable vectors include but are not limited to derivatives of SV40 and known bacterial plasmids, e.g., E.
- vectors may comprise various regulatory elements (including promoter, ribosome binding site, terminator, enhancer, various cis-elements for controlling the expression level) wherein the vector is constructed in accordance with the host cell.
- Any of a wide variety of expression control sequences may be used in these vectors to express the polynucleotide sequences encoding PlySs2 or the modified lysin polypeptides of the present disclosure.
- Useful control sequences include, but are not limited to: the early or late promoters of SV40, CMV, vaccinia, polyoma or adenovirus, the lac system, the trp system, the TAC system, the TRC system, the LTR system, the major operator and promoter regions of phage A, the control regions of fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase (e.g., Pho5), the promoters of the yeast mating factors, E. coli promoter for expression in bacteria, and other promoter sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- the early or late promoters of SV40, CMV, vaccinia, polyoma or adenovirus the lac system, the trp system, the TAC system, the TRC system, the LTR system, the major operator and
- the polynucleotide sequences encoding the or PlySs2 polypeptides are operatively linked to a heterologous promoter or regulatory element.
- a polynucleotide sequence is “operatively linked” when it is placed into a functional relationship with another nucleotide sequence.
- a promoter or regulatory DNA sequence is said to be “operatively linked” to a DNA sequence that codes for an RNA and/or a protein if the two sequences are operatively linked, or situated such that the promoter or regulatory DNA sequence affects the expression level of the coding or structural DNA sequence.
- Operatively linked DNA sequences are typically, but not necessarily, contiguous.
- Non-limiting examples of host cells suitable for expression of the present polypeptides include well known eukaryotic and prokaryotic hosts, such as strains of E. coli, Pseudomonas, Bacillus, Streptomyces, fungi such as yeasts, and animal cells, such as CHO, Rl.l, B-W and L-M cells, African Green Monkey kidney cells (e.g., COS 1, COS 7, BSC1, BSC40, and BMT10), insect cells (e.g., Sf9), and human cells and plant cells in tissue culture.
- eukaryotic and prokaryotic hosts such as strains of E. coli, Pseudomonas, Bacillus, Streptomyces, fungi such as yeasts
- animal cells such as CHO, Rl.l, B-W and L-M cells, African Green Monkey kidney cells (e.g., COS 1, COS 7, BSC1, BSC40, and BMT10), insect cells (e.g.,
- the expression host may be any known expression host cell, in a typical embodiment the expression host is one of the strains of E. coli. These include, but are not limited to commercially available E. coli strains such as ToplO (ThermoFisher Scientific, Inc.), DH5a (Thermo Fisher Scientific, Inc.), XLI-Blue (Agilent Technologies, Inc.), SCSllO (Agilent Technologies, Inc.), JM109 (Promega, Inc.), LMG194 (ATCC), and BL21 (Thermo Fisher Scientific, Inc.). There are several advantages of using E.
- ToplO ThermoFisher Scientific, Inc.
- DH5a Thermo Fisher Scientific, Inc.
- XLI-Blue Agilent Technologies, Inc.
- SCSllO Agilent Technologies, Inc.
- JM109 Promega, Inc.
- LMG194 ATCC
- BL21 Thermo Fisher Scientific, Inc.
- E. coli as a host system including: fast growth kinetics, where under the optimal environmental conditions, its doubling time is about 20 min (Sezonov et ah, J. Bacterial. 1898746-8749 (2007)), easily achieved high density cultures, easy and fast transformation with exogenous DNA, etc. Details regarding protein expression in E. coli, including plasmid selection as well as strain selection are discussed in details by Rosano, G. and Ceccarelli, E., Front Microbial., 5: 172 (2014).
- Efficient expression of the present modified lysin polypeptides or PlySs2 depends on a variety of factors such as optimal expression signals (both at the level of transcription and translation), correct protein folding, and cell growth characteristics.
- optimal expression signals both at the level of transcription and translation
- correct protein folding and cell growth characteristics.
- methods for constructing the vector and methods for transducing the constructed recombinant vector into the host cell conventional methods known in the art can be utilized.
- PlySs2 and the modified lysin polypeptides of the present disclosure can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, and lectin chromatography. High performance liquid chromatography can also employed for lysin polypeptide purification.
- the vector system used for the production of the modified lysin polypeptides of the present disclosure or PlySs2 may be a cell-free expression system. Various cell-free expression systems are commercially available, including, but are not limited to those available from Promega, LifeTechnologies, Clonetech, etc.
- compositions comprising PlySs2 or the Modified Lysin Polypeptides
- PlySs2 and/or the modified lysin polypeptides disclosed herein may be incorporated into antimicrobial and bactericidal compositions and unit dosage forms thereof alone or with one or more conventional antibiotics and other bactericidal agents.
- the compositions contain PlySs2 and/or the modified lysin polypeptide as disclosed herein in an amount effective for killing Gram-positive bacteria selected from the group consisting of Staphylococcus aureus, Listeria monocytogenes, a coagulase negative staphylococcus such as from the Staphylococcus epidermidis group, the Staphylococcus saprophyticus group, the Staphylococcus simulans group, the Staphylococcus intermedius group, the Staphylococcus sciuri group, and the Staphylococcus hyicus group; Streptococcus suis, Streptococcus pyogenes, Streptococcus agalactiac, Streptococcus dysgalactiae, Streptococcus pneumoniae, species included in the viridans streptococci group such as the Streptococcus anginosis group, Streptococcus mitis group, Streptococcus
- compositions disclosed herein can take the form of solutions, suspensions, emulsions, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained- release formulations, suppositories, tampon applications, aerosols, sprays, lozenges, troches, candies, injectables, chewing gums, ointments, smears, time-release patches, liquid- absorbed wipes, and combinations thereof.
- compositions can be employed as solids, such as tablets, lyophilized powders for reconstitution, liposomes or micelles, or the compositions can be employed as liquids, such as solutions, suspensions, gargles, emulsions, or capsules filled solids or liquids, such as for oral use.
- the compositions can be in the form of suppositories or capsules for rectal administration or in the form of sterile injectable or inhalable solutions or suspensions for parenteral (including, for example, intravenous or subcutaneous) or topical, such as dermal, nasal, pharyngeal or pulmonary, use.
- Such compositions include pharmaceutical compositions, and unit dosage forms thereof may comprise conventional or new ingredients in conventional or special proportions, with or without additional active compounds or principles.
- Such unit dosage forms may contain any suitable effective amount of the active ingredient commensurate with the intended daily dosage range to be employed.
- Carriers and excipients can be selected from a great variety of substances acceptable for human or veterinary use.
- Non-limiting examples of pharmaceutically acceptable carriers or excipients include any of the standard pharmaceutical carriers, such as phosphate buffered saline solutions, water, polyols, disaccharides or polysaccharides, and emulsions such as oil/water emulsions and microemulsions.
- Other stabilizing excipients include proprietary blends of stabilizing and protecting solutions (SPS), cyclodextrins and recombinant human albumin (rHSA).
- Other excipients may include bulking agents, buffering agents, tonicity modifiers (e.g.
- suitable pharmaceutically acceptable excipients include, but are not limited to, starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents, and the like.
- suitable pharmaceutically acceptable excipients may include, but are not limited to, water, glycols, oils, alcohols, flavoring agents, preservatives, and the like.
- suitable excipients may include, but are not limited to a cream, a cellulosic, or an oily base, emulsifying agents, stiffening agents, rheology modifiers or thickeners, surfactants, emollients, preservatives, humectants, alkalizing or buffering agents, and solvents.
- PlySs2 and/or the modified lysin polypeptides disclosed herein can be combined with buffers that maintain the pH of a liquid suspension, solution, or emulsion within a range that does not substantially affect the activity of the PlySs2 or modified lysin polypeptide.
- a desirable pH range of the composition or of the environment wherein the active ingredient is found upon administration may be between about 4.0 and about 9.0, for example between about 4.5 and about 8.5.
- a stabilizing buffer may be optionally included to permit the modified lysin polypeptide or PlySs2 to exert its activity in an optimized fashion.
- the buffer may contain a reducing reagent, such as dithiothreitol.
- the stabilizing buffer may also be or include a metal chelating reagent, such as ethylenediaminetetracetic acid disodium salt, or it may contain a phosphate or citrate-phosphate buffer, or any other buffering agent, such as Tris or succinate.
- a mild surfactant can be included in a pharmaceutical composition in an amount effective to potentiate the therapeutic effect of the modified lysin polypeptides or PlySs2 used in the composition.
- Suitable mild surfactants may include, inter alia, esters of polyoxyethylene sorbitan and fatty acids (such as the Tween series), octylphenoxy polyethoxy ethanol (such as the Triton-X series), n-Octyl-fl-D-glucopyranoside, n-Octyl-fl-D-thioglucopyranoside, n- Decyl-f3-D-glucopyranoside, n-Dodecyl-f3-D-glucopyranoside, poloxamer, polysorbate 20, polysorbate 80, polyethylene glycol, and biologically occurring surfactants, e.g., fatty acids, glycerides, monoglycerides, deoxycholate, and esters of deoxycholate.
- surfactants e.g., fatty acids, glycerides, monoglycerides, deoxycholate, and esters of deoxycholate.
- Preservatives may also be used in the compositions disclosed herein, and may, for example, comprise about 0.05% to about 0.5% by weight of the total composition.
- the use of preservatives may assure that if the product is microbially-contaminated, the formulation will prevent or diminish microorganism growth (or attenuate the potency of the formulation).
- Exemplary preservatives include methylparaben, propylparaben, butylparaben, chloroxylenol, sodium benzoate, DMDM Hydantoin, 3-Iodo-2-Propylbutyl carbamate, potassium sorbate, chlorhexidine digluconate, or a combination thereof.
- Plyss2 and/or the modified lysin polypeptides disclosed herein can be formulated into solid or liquid preparations, for example tablets, capsules, powders, solutions, suspensions, and dispersions.
- the active ingredient may be combined with one or more pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose); fillers (e.g., lactose, sucrose, glucose, mannitol, sorbitol, other reducing and non-reducing sugars, microcrystalline cellulose, calcium sulfate, or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc, silica, steric acid, sodium stearyl fumarate, glyceryl behenate, calcium stearate, and the like); disintegrants (e.g.
- binding agents e.g., pregelatinized maize starch, poly
- wetting agents e.g. , sodium lauryl sulphate
- coloring and flavoring agents e.g., coloring and flavoring agents, gelatin, sweeteners, natural and synthetic gums (such as acacia, tragacanth or alginates), buffer salts, carboxymethylcellulose, polyethyleneglycol, waxes, and the like.
- the drug components can be combined with non-toxic, pharmaceutically acceptable inert carriers (e.g., ethanol, glycerol, water), suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats), emulsifying agents (e.g., lecithin or acacia), non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol or fractionated vegetable oils), preservatives (e.g., methyl or propyl-p- hydroxybenzoates or sorbic acid), and the like.
- Stabilizing agents such as antioxidants (e.g., BHA, BHT, propyl gallate, sodium ascorbate, or citric acid) can also be added to stabilize the dosage forms.
- the tablets can be coated by methods well-known in the art.
- the compositions disclosed herein can be also introduced in microspheres or microcapsules, e.g. , fabricated from poly glycolic acid/lactic acid (PGLA).
- PGLA poly glycolic acid/lactic acid
- Liquid preparations for oral administration can take the form of, for example, solutions, syrups, emulsions, or suspensions, or they can be presented as a dry product for reconstitution with water or other suitable vehicle before use. Preparations for oral administration can be suitably formulated to give controlled or postponed release of the active compound.
- the active agents can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles, and multilamellar vesicles.
- Liposomes can be formed from a variety of phospholipids, such as cholesterol, stearylamine, or phosphatidylcholines, as is well known.
- a modified lysin polypeptide as disclosed herein or PlySs2 as also herein disclosed may be mixed with a pharmaceutical excipient to form a solid preformulation composition.
- tablets may be sugar coated or enteric coated by standard techniques.
- the tablets or pills may be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged or delayed action.
- the tablet or pill can include an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
- the two components can be separated by an enteric layer, which serves to resist disintegration in the stomach and permit the inner component to pass intact into the duodenum or to be further delayed in release.
- Topical compositions as disclosed herein may further comprise a pharmaceutically or physiologically acceptable carrier, such as a dermatologically or an otically acceptable carrier.
- Such carriers in the case of dermatologically acceptable carriers, may be compatible with skin, nails, mucous membranes, tissues, and/or hair, and can include any conventionally used dermatological carrier meeting these requirements.
- the carrier In the case of otically acceptable carriers, the carrier may be compatible with all parts of the ear.
- Carriers for topical administration of the compounds disclosed herein include, but are not limited to, mineral oil, liquid petroleum, white petroleum, propylene glycol, polyoxyethylene and/or polyoxypropylene compounds, emulsifying wax, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2- octyldodecanol, benzyl alcohol, and water.
- the active components of the present disclosure may be formulated in an oleaginous hydrocarbon base, an anhydrous absorption base, a water-in-oil absorption base, an oil-in-water water-removable base, and/or a water-soluble base.
- the active components of the present disclosure may be formulated in an aqueous polymeric suspension including such carriers as dextrans, polyethylene glycols, polyvinylpyrrolidone, polysaccharide gels, Gelrite®, cellulosic polymers like hydroxypropyl methylcellulose, and carboxy-containing polymers such as polymers or copolymers of acrylic acid, as well as other polymeric demulcents.
- compositions as disclosed herein may be in any form suitable for topical application, including aqueous, aqueous-alcoholic or oily solutions; lotion or serum dispersions; aqueous, anhydrous or oily gels; emulsions obtained by dispersion of a fatty phase in an aqueous phase (O/W or oil in water) or, conversely, dispersion of an aqueous phase in a fatty phase (W/O or water in oil), microemulsions or alternatively microcapsules, microparticles or lipid vesicle dispersions of ionic and/or nonionic type, creams, lotions, gels, foams (which may use a pressurized canister, a suitable applicator, an emulsifier, and an inert propellant), essences, milks, suspensions, or patches.
- aqueous, aqueous-alcoholic or oily solutions including lotion or serum dispersions; aqueous, anhydrous or oily gels;
- Topical compositions disclosed herein may also contain adjuvants such as hydrophilic or lipophilic gelling agents, hydrophilic or lipophilic active agents, preserving agents, antioxidants, solvents, fragrances, fillers, sunscreens, odor- absorbers, and dyestuffs.
- the topical compositions disclosed herein may be administered in conjunction with devices such as transdermal patches, dressings, pads, wraps, matrices and bandages capable of being adhered or otherwise associated with the skin or other tissue or organ of a subject, being capable of delivering a therapeutically-effective amount of one or more modified lysin polypeptides and/or PlySs2 as disclosed herein.
- the topical compositions disclosed herein additionally comprise one or more components used to treat topical bums.
- Such components may include, but are not limited to, a propylene glycol hydrogel; a combination of a glycol, a cellulose derivative and a water-soluble aluminum salt; an antiseptic; an antibiotic; and a corticosteroid.
- Humectants such as solid or liquid wax esters
- absorption promoters such as hydrophilic clays, or starches
- viscosity building agents such as skin-protecting agents
- Topical formulations may be in the form of rinses such as mouthwash. See, e.g. ,W02004/004650.
- PlySs2 and/or the modified lysin polypeptides disclosed herein may also be administered by injection of a therapeutic agent comprising the appropriate amount of a PlySs2 or modified lysin polypeptide and a carrier.
- a therapeutic agent comprising the appropriate amount of a PlySs2 or modified lysin polypeptide and a carrier.
- the PlySs2 or modified lysin polypeptides can be administered intramuscularly, intracerebrovetricularly, intrathecally, subdermally, subcutaneously, intreaperitoneally, intravenously, or by direct injection or continuous infusion to treat infections by bacteria, such as gram-positive bacteria.
- the carrier may be comprised of distilled water, a saline solution, albumin, a serum, or any combinations thereof.
- compositions of parenteral injections can comprise pharmaceutically-acceptable aqueous or nonaqueous solutions of plySs2 or modified lysin polypeptides in addition to one or more of the following: pH buffered solutions, adjuvants (e.g. , preservatives, wetting agents, emulsifying agents, stabilizing agents, and dispersing agents), liposomal formulations, nanoparticles, dispersions, suspensions, and emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
- adjuvants e.g. , preservatives, wetting agents, emulsifying agents, stabilizing agents, and dispersing agents
- liposomal formulations nanoparticles, dispersions, suspensions, and emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
- formulations for injection can be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, and in certain embodiments may include an added preservative.
- the compositions can take such forms as excipients, suspensions, solutions, or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing, bulking, and/or dispersing agents.
- the active ingredient can be in powder form for reconstitution with a suitable vehicle, e.g. , sterile pyrogen-free water, before use.
- buffering agents may include histidine, Tris, phosphate, succinate citrate, methionine, cystine, glycine, mild surfactants, calcium, and magnesium.
- a reducing agent such as dithiothreitol can also be included.
- an isotonic formulation may be used.
- additives for isotonicity can include sodium chloride, dextrose, sucrose, glucose, trehalose, mannitol, sorbitol, and lactose.
- isotonic solutions such as phosphate buffered saline may be used.
- Stabilizers can include histidine, methionine, glycine, arginine, gelatin, and albumin, such as human or bovine serum albumin.
- compositions disclosed herein can be provided sterile and pyrogen-free.
- compositions disclosed herein may be dry inhalable powders or other inhalable compositions, such as aerosols or sprays.
- the inhalable compositions disclosed herein can further comprise a pharmaceutically acceptable carrier.
- PlySs2 and/or the modified lysin polypeptides may be conveniently delivered in the form of an aerosol spray presentation from such devices as inhalers, pressurized aerosol dispensers, or nebulizers, with the use of a suitable propellant, e.g.
- the dosage unit can be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of, e.g., gelatin for use in an inhaler or insufflator can be formulated containing a powder mix of the active ingredient and a suitable powder base such as lactose or starch.
- PlySs2 and/or the modified lysin polypeptides disclosed herein may be formulated as a dry, inhalable powder or as an aerosol or spray.
- PlySs2 and/or the modified lysin polypeptide inhalation solution may further be formulated with a propellant for aerosol delivery.
- solutions may be nebulized.
- Many dispensing devices are available in the art for delivery of pharmaceutical compositions, including polypeptides, by inhalation. These include nebulizers, pressurized aerosol dispensers, and inhalers.
- a surfactant can be added to an inhalable pharmaceutical composition as disclosed herein in order to lower the surface and interfacial tension between the medicaments and the propellant.
- a surfactant may or may not be required.
- a surfactant may or may not be necessary, depending in part on the solubility of the particular medicament and excipient.
- the surfactant may be any suitable, non-toxic compound that is non-reactive with the medicament and that reduces the surface tension between the medicament, the excipient, and the propellant and/or acts as a valve lubricant.
- Suitable surfactants include, but are not limited to: oleic acid; sorbitan trioleate; cetyl pyridinium chloride; soya lecithin; polyoxyethylene(20) sorbitan monolaurate; polyoxyethylene (10) stearyl ether; polyoxyethylene (2) oleyl ether; poly oxypropylene-polyoxy ethylene ethylene diamine block copolymers; polyoxyethylene(20) sorbitan monostearate; polyoxyethylene(20) sorbitan monooleate; polyoxypropylene- polyoxy ethylene block copolymers; castor oil ethoxylate; and combinations thereof.
- suitable propellants include, but are not limited to: dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane, and carbon dioxide.
- excipients for use in inhalable compositions include, but are not limited to: lactose, starch, propylene glycol diesters of medium chain fatty acids; triglyceride esters of medium chain fatty acids, short chains, or long chains, or any combination thereof; perfluorodimethylcyclobutane; perfluorocyclobutane; polyethylene glycol; menthol; lauroglycol; diethylene glycol monoethylether; polyglycolized glycerides of medium chain fatty acids; alcohols; eucalyptus oil; short chain fatty acids; and combinations thereof.
- compositions disclosed herein comprise nasal applications.
- Nasal applications include, for instance, nasal sprays, nasal drops, nasal ointments, nasal washes, nasal injections, nasal packings, bronchial sprays and inhalers, or indirectly through use of throat lozenges, mouthwashes or gargles, or through the use of ointments applied to the nasal nares, or the face or any combination of these and similar methods of application.
- Compositions disclosed herein can also be formulated for rectal administration, e.g., as suppositories or retention enemas (e.g. , containing conventional suppository bases such as cocoa butter or other glycerides).
- compositions disclosed herein may further comprise at least one antibiotic, such as at least one antibiotic effective to inhibit the growth, reduce the population, or kill at least one species of Gram-positive bacteria.
- the at least one antibiotic is effective against one or more of Staphylococcus aureus, Listeria monocytogenes, a coagulase negative staphylococcus such as from the Staphylococcus epidermidis group, the Staphylococcus saprophyticus group, the Staphylococcus simulans group, the Staphylococcus intermedius group, the Staphylococcus sciuri group, and the Staphylococcus hyicus group; Streptococcus suis, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus dysgalactiac, Streptococcus pneumoniae, species included in the viridans streptococci group such as the Streptococc
- the PlySs2 and/or the modified lysin polypeptide in combination with the at least one antibiotic may exhibit synergism, for example synergism in the PlySs2 and/or the modified lysin polypeptide’s or the antibiotic’s ability to inhibit the growth, reduce the population, or kill at least one species of Gram-positive bacteria.
- Synergy may refer to the inhibitory activity of a combination of two active agents, wherein the fractional inhibitory concentration (FIC) index for the combination is less than 1, and for strong synergy, less than or equal to 0.5.
- FIC fractional inhibitory concentration
- the FIC of an agent is the minimum concentration of that agent that kills bacteria when used in combination with another agent divided by the concentration of the first agent that has the same effect when the first agent is used alone.
- the FIC index for the combination of A and B is the sum of their individual FIC values.
- Synergy may be evaluated in a checkerboard assay (and can be validated by time-kill curves). Each checkerboard assay generates many different combinations, and, by convention, the FIC values of the most effective combination are used in calculating the FIC index.
- the FIC index defines the nature of the interaction. Antimicrobial agents with additive interactions have a FIC index of 1; an FIC index of ⁇ 1 defines synergistic interactions; combinations with an FIC index >1 are antagonistic. The lower the FIC index, the more synergistic a combination. See, e.g., Singh, P.K. et al, Am J Physiol Lung Cell Mol Physiol 279: L799-L805, 2000.
- Synergy has implications for an efficacious, new general anti-infective strategy based on the co-administration of PlySs2 and/or modified lysin polypeptides and antibiotics.
- each and both PlySs2 and/or modified lysin polypeptides and antibiotics may be administered at reduced doses and amounts, with enhanced bactericidal and bacteriostatic activity and with reduced risk of resistance development.
- the benefits of synergy are not only realized when one or both agents are used at sub-MIC concentrations, although the existence of synergy may be revealed by testing with sub-MIC concentrations of each agent.
- PlySs2 and/or a modified lysin polypeptide as disclosed herein may be administered to a subject in need thereof, e.g., a living animal (including a human) for the treatment, alleviation, or amelioration, palliation, or elimination of an indication or condition which is susceptible thereto.
- the present disclosure is directed to a method of preventing or treating a multidrug-resistant bacterial infection caused by a multi-drug resistant bacteria as described herein comprising co-administering to a subject diagnosed with, at risk for, or exhibiting symptoms of a bacterial infection, a combination of a first effective amount of the composition containing an effective amount of PlySs2 and/or a modified lysin polypeptide as described herein, and a second effective amount of an antibiotic suitable for the treatment of Gram-positive bacterial infection.
- PlySs2 and/or the modified lysin polypeptides of the present disclosure can be co-administered with standard care antibiotics or with antibiotics of last resort, individually or in various combinations as within the skill of the art.
- Traditional antibiotics used against Gram positive bacteria are described herein and may include, for example, antibiotics of different types and classes, such a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbapenem (e.g.
- a macrolide e.g. erythromycin, azithromycin
- an aminoglycoside e.g. gentamicin, tobramycin, amikacin
- a glycopeptide e.g., vancomycin, teicoplanin
- oxazolidinones e.g., linezolid and tedizolid
- a fluoroquinolone e.g., levofloxacin
- ketolides e.g., telithromycin
- a lipopeptide such as cyclic lipopeptides (e.g.
- the antibiotic is daptomycin.
- the antibiotic is vancomycin and daptomycin.
- the antibiotic is oxacillin.
- Combining PlySs2 and/or the modified lysin polypeptides of the present disclosure with antibiotics provides an efficacious antibacterial regimen.
- co-administration of PlySs2 and/or the modified lysin polypeptides of the present disclosure with one or more antibiotics may be carried out at reduced doses and amounts of either PlySs2 and/or the modified lysin polypeptides or the antibiotic or both, and/or reduced frequency and/or duration of treatment with augmented bactericidal and bacteriostatic activity, reduced risk of antibiotic resistance and with reduced risk of deleterious neurological or renal side effects (such as those associated with colistin or polymyxin B use).
- the term “reduced dose” refers to the dose of one active ingredient in the combination compared to monotherapy with the same active ingredient.
- the dose of PlySs2 and/or the modified lysin polypeptide or the antibiotic in a combination may be suboptimal or even subthreshold compared to the respective monotherapy.
- the present disclosure provides a method of augmenting antibiotic activity of one or more antibiotics against Gram-positive bacteria including multidrug-resistant Gram-positive bacteria as described herein compared to the activity of said antibiotics used alone by administering to a subject one or more modified lysin polypeptides and/or PlySs2 disclosed herein together with an antibiotic of interest.
- the combination is effective against the bacteria and permits resistance against the antibiotic to be overcome and/or the antibiotic to be employed at lower doses, decreasing undesirable side effects.
- the present disclosure provides any methods disclosed herein wherein:
- the effective amount of the PlySs2-type lysin, e.g. exebacase, is 0.25 mg/kg administered as a one-time intravenous infusion;
- the effective amount of the PlySs2-type lysin, e.g. exebacase, is 18 mg administered as a one-time intravenous infusion;
- the patient has normal renal function (e.g., creatinine clearance [CrCl*] >60 mL/min) or mild renal impairment, and the effective amount of the PlySs2-type lysin, e.g. exebacase, is 18 mg administered as a one-time intravenous infusion;
- the patient has moderate or severe renal impairment (e.g., CrCl* of 15 to ⁇ 60 mL/min), and the effective amount of the PlySs2-type lysin, e.g. exebacase, is 12 mg administered as a one-time intravenous infusion;
- moderate or severe renal impairment e.g., CrCl* of 15 to ⁇ 60 mL/min
- the effective amount of the PlySs2-type lysin e.g. exebacase
- the patient has end-stage renal disease (ESRD; e.g. CrCl* ⁇ 15 mL/min) and/or is on hemodialysis, and the effective amount of the PlySs2-type lysin, e.g. exebacase, is 8 mg administered as a one-time intravenous infusion; or
- the patient is a child less than two years of age and the effective amount of the PlySs2- type lysin, e.g. exebacase, is 0.5 mg/kg to 1.5 mg/kg, e.g., about 1 mg/kg, administered as a one-time intravenous infusion.
- the effective amount of the PlySs2- type lysin e.g. exebacase
- infection and “bacterial infection” are meant to include respiratory tract infections (RTIs), such as respiratory tract infections in patients having cystic fibrosis (CF), lower respiratory tract infections, such as acute exacerbation of chronic bronchitis (ACEB), acute sinusitis, community- acquired pneumonia (CAP), hospital- acquired pneumonia (HAP) and nosocomial respiratory tract infections; sexually transmitted diseases, such as gonococcal cervicitis and gonococcal urethritis; urinary tract infections; acute otitis media; sepsis including neonatal septisemia and catheter-related sepsis; and osteomyelitis including acute, chronic and haematogenous osteomyelitis.
- RTIs respiratory tract infections
- CF cystic fibrosis
- CAP community- acquired pneumonia
- HAP hospital- acquired pneumonia
- nosocomial respiratory tract infections sexually transmitted diseases, such as gonococcal cervicitis and gonococcal urethritis
- urinary tract infections acute otitis media
- Non- limiting examples of infections caused by Gram-positive bacterial may include: A) Nosocomial infections: 1. Respiratory tract infections especially in cystic fibrosis patients and mechanically-ventilated patients; 2. bacteremia and sepsis; 3. Wound infections, particularly those of burn victims; 4. Urinary tract infections; 5. Post-surgery infections on invasive devises; 6. Endocarditis including prosthetic valve endocarditis, cardiac device infection and right-sided endocarditis and endocarditis due to intravenous administration of contaminated drug solutions; 7. Infections in patients with acquired immunodeficiency syndrome, cancer chemotherapy, steroid therapy, hematological malignancies, organ transplantation, renal replacement therapy, and other conditions with severe neutropenia.
- the lysins of the present methods are used to treat a joint infection.
- Infected joints may include infected hip, knee, ankle, shoulder, elbow or wrist joints.
- the infected joint is a knee joint or a hip joint.
- the infected joint is a native joint.
- Infection of a native joint (also referred to herein as septic arthritis of a native joint) may occur when a penetrating injury, such as a puncture wound, occurs near or above a joint, allowing bacteria to directly enter the joint.
- the joint infection occurs when bacteria from a distant infection spreads through the bloodstream to the native joint.
- the infected joint is a prosthetic joint, including, for example, septic arthritis of a prosthetic joint).
- the prosthetic joints may include hip, knee, shoulder, elbow, and ankle prostheses.
- the prosthetic joint is a prosthetic hip or knee.
- the one or more species of Gram-positive bacteria of the present methods may include any of the species of Gram-positive bacteria as described herein or known in the art.
- the species of Gram-positive bacteria may include Listeria monocytogenes, Staphylococcus aureus, coagulase negative staphylococci (including at least 40 recognized species including, but not limited to, the Staphylococcus epidermidis group, the Staphylococcus saprophyticus group, the Staphylococcus simulans group, the Staphylococcus intermedius group, the Staphylococcus sciuri group, the Staphylococcus hyicus group, and any isolates referred to as from the “unspecified species group”), Streptococcus suis, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus dysgalactiae, Streptococcus pneumoniae, any additional species included in the viridans streptococci group (including, but not limited to, all species and strains included in the Streptococcus anginosis group, Streptococcus mit
- Gram-positive bacteria include but are not limited to the genera Actinomyces, Bacillus, Lactococcus, Mycobacterium, Corynebacterium, and Clostridium.
- co-administering the PlySs2 and/or the present modified lysin polypeptides and an antibiotic of interest may be used for the prevention, control, disruption, and treatment of bacterial biofilm formed by Gram positive bacteria.
- Biofilm formation occurs when microbial cells adhere to each other and are embedded in a matrix of extracellular polymeric substance (EPS) on a surface.
- EPS extracellular polymeric substance
- Biofilm may develop in any supporting environment including living and nonliving surfaces such as the mucus plugs of the CF lung, contaminated catheters, implants, contact lenses, etc (Sharma et al. Biologicals, 42(1): 1-7 (2014), which is herein incorporated by reference in its entirety).
- biofilms protect the bacteria, they are often more resistant to traditional antimicrobial treatments, making them a serious health risk, which is evidenced by more than one million cases of catheter-associated urinary tract infections (CAUTI) reported each year, many of which can be attributed to biofilm-associated bacteria (Donlan, RM (2001) Emerg Infect DA7(2):277-281; Maki D and Tambyah P (2001) Emerg Infect Dis 7(2):342-347).
- CAUTI catheter-associated urinary tract infections
- PlySs2 and/or the modified lysin polypeptides of the present disclosure are co-administered with an antibiotic of interest and used for the prevention, control, disruption, and treatment of bacterial infections due to Gram-positive bacteria when the Gram-positive bacteria are protected by a bacterial biofilm.
- inhibiting the growth, or reducing the population, or killing at least one species of Gram-positive bacteria comprises contacting bacteria with PlySs2 and/or the modified lysin polypeptides as described herein and an antibiotic of interest, wherein the bacteria are present on a surface of e.g., medical devices, floors, stairs, walls and countertops in hospitals and other health related or public use buildings and surfaces of equipment in operating rooms, emergency rooms, hospital rooms, clinics, and bathrooms and the like.
- Examples of medical devices that can be protected using PlySs2 and/or the modified lysin polypeptides described herein include but are not limited to tubing and other surface medical devices, such as urinary catheters, mucous extraction catheters, suction catheters, umbilical cannulae, contact lenses, intrauterine devices, intravaginal and intraintestinal devices, endotracheal tubes, bronchoscopes, dental prostheses and orthodontic devices, surgical instruments, dental instruments, tubings, dental water lines, fabrics, paper, indicator strips (e.g., paper indicator strips or plastic indicator strips), adhesives (e.g., hydrogel adhesives, hot-melt adhesives, or solvent-based adhesives), bandages, tissue dressings or healing devices and occlusive patches, and any other surface devices used in the medical field.
- tubing and other surface medical devices such as urinary catheters, mucous extraction catheters, suction catheters, umbilical cannulae, contact lenses, intrauterine devices, intravaginal and intraintestinal devices,
- the devices may include electrodes, external prostheses, fixation tapes, compression bandages, and monitors of various types.
- Medical devices can also include any device which can be placed at the insertion or implantation site such as the skin near the insertion or implantation site, and which can include at least one surface which is susceptible to colonization by Gram-positive bacteria.
- inhibiting the growth, or reducing the population, or killing at least one species of Gram-positive bacteria comprises contacting bacteria with PlySs2 and/or the modified lysin polypeptides as described herein and optionally an antibiotic of interest, wherein the Gram-positive bacteria is a multidrug-resistant bacteria.
- the Gram-positive bacteria is resistant to at least two antibiotics, such as at least three antibiotics, such as at least four antibiotics.
- the Gram-positive bacteria comprises Staphylococcus aureus, such as MRSA or MSSA, typically MRSA.
- the at least two, such as the at least three, such as the at least four antibiotics to which the Gram-positive bacteria are resistant are selected from two or more, such as three or more, such as four or more of a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbapenem (e.g. imipenem and entapenem); a macrolide (e.g. erythromycin, azithromycin), an aminoglycoside (e.g.
- a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbape
- gentamicin tobramycin, amikacin
- a glycopeptide e.g., vancomycin, teicoplanin
- oxazolidinones e.g., linezolid and tedizolid
- a fluoroquinolone e.g., levofloxacin
- ketolides e.g., telithromycin
- a lipopeptide such as cyclic lipopeptides (e.g.
- daptomycin, mupirocin, and lysostaphin a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline ) a sulfonamide (e.g. sulfamethoxazole), trimethoprim and combinations thereof, e.g. trimethoprim/sulfamethoxazole.
- Dosages administered depend on a number of factors such as the activity of infection being treated; the age, health and general physical condition of the subject to be treated; the activity of PlySs2 or a particular modified lysin polypeptide; the nature and activity of the antibiotic if any with which a PlySs2 or a modified lysin polypeptide according to the present disclosure is being paired; and the combined effect of such pairing.
- effective amounts of the PlySs2 or the modified lysin polypeptide to be administered may fall within the range of about 0.1-100 mg/kg (or 1 to 100 mcg/ml), such as from 0.5 mg/kg to 30 mg/kg.
- the PlySs2 or the modified lysin polypeptide may be administered 1-4 times daily for a period ranging from 1 to 14 days.
- the antibiotic if one is also used, may be administered at standard dosing regimens or in lower amounts in view of any synergism. All such dosages and regimens, however, (whether of PlySs2, the modified lysin polypeptide or any antibiotic administered in conjunction therewith) are subject to optimization. Optimal dosages can be determined by performing in vitro and in vivo pilot efficacy experiments as is within the skill of the art but taking the present disclosure into account.
- PlySs2 and/or the modified lysin polypeptides disclosed herein may provide a rapid bactericidal and, when used in sub-MIC amounts, may provide a bacteriostatic effect. It is further contemplated that PlySs2 and/or the modified lysin polypeptides disclosed herein may be active against a range of antibiotic -resistant bacteria or multidrug resistant bacteria. Based on the present disclosure, in a clinical setting, PlySs2 and the present modified lysin polypeptides may be a potent alternative (or additive) for treating infections arising from drug- and multidrug-resistant bacteria alone or together with antibiotics (including antibiotics to which resistance has developed).
- time exposure to PlySs2 and/or the modified lysin polypeptides disclosed herein may influence the desired concentration of active polypeptide units per ml.
- Carriers that are classified as “long” or “slow” release carriers such as, for example, certain nasal sprays or lozenges
- a “short” or “fast” release carrier such as, for example, a gargle
- a high concentration of polypeptide units (meg) per ml but over a shorter period of time There are circumstances where it may be desirable to have a higher unit/ml dosage or a lower unit/ml dosage.
- the therapeutically effective dose may be estimated initially either in cell culture assays or in animal models, usually mice, rabbits, dogs, or pigs.
- the animal model can also be used to achieve a desirable concentration range and route of administration ⁇ Obtained information can then be used to determine the effective doses, as well as routes of administration, in humans. Dosage and administration can be further adjusted to provide sufficient levels of the active ingredient or to maintain the desired effect.
- Additional factors that may be taken into account include the severity of the disease state; age, weight and gender of the patient; diet; desired duration of treatment; method of administration; time and frequency of administration; drug combinations; reaction sensitivities; tolerance/response to therapy; and the judgment of a treating physician.
- a treatment regimen can entail daily administration (e.g. , once, twice, thrice, etc. daily), every other day (e.g., once, twice, thrice, etc. every other day), semi- weekly, weekly, once every two weeks, once a month, etc.
- treatment can be given as a continuous infusion.
- Unit doses can be administered on multiple occasions. Intervals can also be irregular as indicated by monitoring clinical symptoms.
- the unit dose can be administered as a sustained release formulation, in which case less frequent administration may be used. Dosage and frequency may vary depending on the patient.
- the isolates were confirmed at the species level using matrix assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF, Bruker Daltonics, Inc., Bremen, Germany).
- 38.6% of the S. aureus isolates were MRSA isolates (FIG. 2).
- Twenty (20) of the S. aureus isolates were the causative pathogen in those patients with infective endocarditis, eight of which were MRSA.
- MICs Minimal inhibitory concentrations (MICs) of PlySs2 against Staphylococcus aureus were determined by broth microdilution (BMD) using a nonstandard antimicrobial susceptibility testing (AST) medium comprised of cation-adjusted Mueller Hinton broth (caMHB) supplemented with donor herd horse serum and DL-dithiothreitol to final concentrations of 25% and 0.5 mM, respectively.
- This medium referred to as caMHB-HSD, is approved for use with PlySs2 by the Clinical and Laboratory Standards Institute (CLSI). See Performance Standards for Antimicrobial Susceptibility Testing, 31st Edition. CLSI guideline M100. Wayne, PA: Clinical and Laboratory Standards Institute; 2021).
- MRS A isolates were defined as methicillin-resistant based on an oxacillin- resistant phenotype. Such isolates are usually defined as multidrug-resistant (MDR) using standard phenotypic classifications.
- MDR multidrug-resistant
- the MRSA isolates were further characterized as MDR, when, in addition to oxacillin, the non-susceptible phenotypes were observed for two or more of ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
- PlySs2 inhibited all Staphylococcus aureus isolates at MIC values of ⁇ 1 pg/mL (MIC range 0.06-1 pg/mL).
- MICso, MIC90 and modal MIC values were 0.5 pg/mL.
- MIC50/90 values against methicillin-susceptible Staphylococcus aureus (MSSA) and methicillin-resistant Staphylococcus aureus (MRSA) were 0.5/0.5 pg/mL.
- the PlySs2 in vitro activity was uniform when tested against Staphylococcus aureus clinical isolates responsible for BSI, including infective endocarditis, isolated from patients in the United States in 2020. Further, the PlySs2 activity was consistent, regardless of resistance phenotype (MSSA, MRSA, including MDR isolates).
- MSSA resistance phenotype
- MRSA resistance phenotype
- MDR isolates a total of 62.3% of all MRSA isolates were categorized as MDR isolates.
- PlySs2 demonstrated equal MIC 50 and MIC 90 results against the MDR isolates (MIC 50/90 , 0.5/0.5 pg/mL) and non-MDR isolates (0.5/0.5 pg/mL).
- Daptomycin and vancomycin also were active (100% susceptible) against MDR MRSA isolates. Tables 1 and 3.
- the data presented here support the use of PlySs2 for the treatment of bacterial infections, such as bacteremia and infective endocarditis, including those caused by multidrug-resistant MRSA isolates.
- Table 2 MIC distribution of exebacase against S. aureus isolated from patients with BSI, including IE, in U.S. hospitals in 2020.
- Methicillin-susceptible (409) 0.5 0.5
- Isolates were defined as methicillin-resistant based on an oxacillin resistance phenotype.
- a multi-drug resistance (MDR) phenotype was defined among methecillin-resistant Staphylococcus aureus (MRSA) isolates when non-susceptible phenotypes were observed for oxacillin and 2 or more of the following agents: ceftarolne, erythromycin, clindamycin, doxycycline, levofloxacin, gentamicin, linezolid, trimethoprim-sulfamethoxazole, daptomycin and vancomycin.
- MDR methecillin-resistant Staphylococcus aureus
- Levofloxacin 4 >4 ⁇ _0.06 to >4 34.2 1.2 65.6
- Vancomycin 1 1 0.5 to 2 100.0 0.0 0.0 aCriteria as published by CLSI (2021); breakpoint not available.
- b Data for tetracycline not shown c “S” sensitive; “I” intermediate; “R” resistant d Intermediate may be interpreted as susceptible-dose dependent.
- e Isolates were defined as methicillin-resistant based on an oxacillin resistance phenotype.
- Multi-drug resistance (MDR) phenotype was defined among MRS A isolates when non-susceptible phenotypes were observed for oxacillin and 2 or more of the following agents: ceftaroline, erythromycin, clindamycin, doxycycline, levofloxacin, gentamicin, linezolid, trimethoprim-sulfamethoxazole, daptomycin and vancomycin.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Polymers & Plastics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Food Science & Technology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Animal Husbandry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Communicable Diseases (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Nutrition Science (AREA)
- Physiology (AREA)
- Biotechnology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Disclosed herein are methods of inhibiting the growth, reducing the population, or killing multidrug-resistant Gram-positive bacteria, the method comprising contacting the multidrug-resistant Gram-positive bacteria with a lysin polypeptide comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof having at least 80% identity to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills the multidrug-resistant Gram-positive bacteria, wherein the multidrug- resistant Gram-positive bacteria are resistant and/or non-susceptible to, for example, at least three antibiotics each from a different class. Methods of preventing or treating a bacterial infection caused by multidrug-resistant Gram-positive bacteria are also disclosed as well as methods of augmenting the efficacy of an antibiotic. Combinations of lysin polypeptides and antibiotics, which are capable of synergistically inhibiting the growth, reducing the population, or killing multidrug-resistant Gram-positive bacteria are also disclosed.
Description
PlvSs2 LYSINS AND VARIANTS THEREOF FOR USE AGAINST MULTIDRUG RESISTANT GRAM-POSITIVE BACTERIA
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of, and relies on the filing date of, U.S. provisional patent application number 63/208,959, filed 9 June 2021 and U.S. provisional patent application number 63/247,068, filed 22 September 2021, the entire disclosures of which are incorporated herein by reference.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on 8 June 2022 is named 0341_0031-00-304_ST25.txt and is 38 kilobytes in size.
FIELD OF THE DISCLOSURE
[0003] The present disclosure relates generally to antibacterial agents and more specifically to PlySs2 and to modified, non-naturally occurring lysin polypeptides, notably, modified PlySs2 lytic enzymes, and the use of these polypeptides alone or in combination with antibiotics in killing multidrug-resistant Gram-positive bacteria and combating bacterial infection and contamination·
BACKGROUND OF THE INVENTION
[0004] Antibiotic resistance is one of the biggest public health challenges of our time. Each year in the U.S. at least 2.8 million people get an antibiotic -resistant infection, and more than 35,000 people die. Accordingly, there is an ongoing need in the art for agents and methods that are capable of effectively treating bacterial infections including those caused by antibiotic- resistant bacteria, particularly multidrug-resistant bacteria.
SUMMARY OF THE DISCLOSURE
[0005] In one aspect, the disclosure provides a method for inhibiting the growth, reducing the population, or killing at least one species of multi-drug resistant Gram-positive bacteria, comprising contacting the bacteria with a lysin polypeptide comprising SEQ ID NO: 1 (wild type PlySs2) or SEQ ID NO: 18 (having a deletion of the N terminal methionine of SEQ ID NO: 1), and/or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as multidrug-resistant Gram-positive bacteria. In one embodiment, a method is provided for inhibiting the growth, reducing the population, or killing at least one species of multi-drug resistant Gram-positive bacteria, comprising contacting the bacteria with a lysin polypeptide, particularly PlySs2 and/or a modified lysin polypeptide having at least one amino acid substitution relative to a counterpart wild-type PlySs2 lysin disclosed herein.
[0006] In some embodiments, the method further comprises contacting the bacteria with one or more antibiotic(s).
[0007] In another aspect, a method is provided for preventing or treating a bacterial infection, including bloodstream infection such as bacteremia or infective endocarditis, caused by at least one species of multi-drug resistant Gram-positive bacteria, the method comprising administering a therapeutically effective amount of a lysin polypeptide to a subject comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity, to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as a multidrug-resistant Gram-positive bacteria. In an embodiment, the method comprising administering to a subject diagnosed with, at risk for, or exhibiting symptoms of the bacterial infection an amount of PlySs2 and/or a modified lysin polypeptide having at least one amino acid substitution relative to a counterpart wild-type PlySs2 lysin. In a further embodiment, the method further comprises co-administering to said subject, an amount of an antibiotic suitable for the treatment of a Gram positive bacterial infection. In some embodiments, the subject is diagnosed with, at risk for, or exhibits symptoms of a bacterial infection, such as bacteremia or infective endocarditis, bone and/or joint infection, and/or other bacterial infections disclosed herein.
[0008] In another aspect, a method is provided for augmenting the efficacy of an antibiotic suitable for the treatment of a multi-drug resistant Gram-positive bacteria or bacterial infection, comprising co- administering the antibiotic with a lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity, to SEQ ID NO: 1 or SEQ ID NO: 18, wherein co-administration is more effective in inhibiting the growth, or reducing the population, or killing the multidrug-resistant Gram-positive bacteria, than administration of either the one or more antibiotic(s) or the variant thereof individually. In another embodiment, a method is provided for augmenting the efficacy of an antibiotic suitable for the treatment of a multi-drug resistant Gram-positive bacterial infection, comprising co-administering the antibiotic in combination with PlySs2 and/or a modified lysin polypeptide having at least one amino acid substitution relative to a counterpart wild-type PlySs2 lysin, wherein co-administration is more effective in inhibiting the growth, or reducing the population, or killing the multi-drug resistant Gram-positive bacteria than administration of either the antibiotic or the modified lysin polypeptide individually.
[0009] In another aspect, a combination is provided, wherein the combination comprises a lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18, and/or a variant thereof having at least 80% identity, such as 90% identity, such as 95% identity, such as 99%, such as 99.5% identity to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits growth, reduces a population, or kills at least one species of multidrug-resistant Gram-positive bacteria and one or more antibiotic(s), wherein the combination is capable of synergistically inhibiting the growth, reducing the population, or killing at least one species of multidrug-resistant Gram positive bacteria. In some embodiments of all aspects of the disclosure, the amount of lysin polypeptide or the variant thereof used in the foregoing methods may be below that which would result in a concentration equal to the minimal inhibitory concentration (MIC) of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof when used in the absence of antibiotic (/.<?., a “sub- MIC lysin amount”); alternatively or additionally, the amount of antibiotic used in the foregoing methods may be below that which corresponds to the MIC for the antibiotic when used in the absence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof (/.<?., a “sub-MIC antibiotic amount”).
[0010] In another embodiment, a combination is provided, wherein the combination comprises PlySs2 or a modified lysin polypeptide and an antibiotic. In certain embodiments, the minimum amount of the modified lysin polypeptide, the antibiotic, or both or PlySs2, the antibiotic or
both that is effective in the combination is below the respective MIC amount of the modified lysin polypeptide and/or the antibiotic or PlySs2 and/or the antibiotics. In some embodiments, the PlySs2 and the antibiotic or the modified lysin polypeptide and the antibiotic are provided in the same composition, and in certain embodiments, the PlySs2 and the antibiotic or the modified lysin polypeptide and the antibiotic are provided in different compositions [0011] In some embodiments of all aspects of the disclosure, the one or more antibiotic(s) is one or more of a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbapenem (e.g. imipenem and entapenem); a macrolide (e.g. erythromycin, azithromycin), an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), ketolides (e.g., telithromycin), a glycopeptide (e.g., vancomycin, teicoplanin), oxazolidinones (e.g., linezolid and tedizolid), a fluoroquinolone (e.g., levofloxacin), a lipopeptide, such as cyclic lipopeptides (e.g. daptomycin, mupirocin, and lysostaphin), a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline ) a sulfonamide (e.g. sulfamethoxazole), trimethoprim and/or combinations thereof, e.g. trimethoprim/sulfamethoxazole. In certain embodiments, the antibiotic is one or more of vancomycin and daptomycin. In other embodiments, the antibiotic is oxacillin.
[0012] In certain embodiments, the multidrug-resistant Gram-positive bacteria comprise Staphylococcus aureus, such as methicillin-resistant Staphylococcus aureus (MRSA) or methicillin sensitive Staphylococcus aureus (MSSA).
[0013] In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and a sulfonamide/trimethoprim.
[0014] In certain embodiments, the multidrug -resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
[0015] In some embodiments of all aspects of the disclosure, the multidrug -resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to at least two, such as at least three, such as at least four antibiotics, wherein the at least two, such as the at least three, such as the at least four antibiotics, are each from a different antibiotic class.
[0016] In certain embodiments of all aspects of the disclosure, the multidrug-resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, wherein each antibiotic is from at least two different antibiotic classes, such as at least three different antibiotic classes, selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
[0017] In certain embodiments of all aspects of the disclosure, the multidrug-resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least three antibiotics, wherein each antibiotic is from at least three different antibiotic classes selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim. [0018] In certain embodiments of all aspects of the disclosure, the multidrug-resistant Gram positive bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to at least four antibiotics, wherein each antibiotic is from a different class selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
[0019] In certain embodiments of all aspects of the disclosure, the multidrug-resistant Gram positive bacteria are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, wherein each antibiotic is from a different antibiotic class selected from a macrolide, an aminoglycoside, a fluoroquinolone, a ketolide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
[0020] In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
[0021] In certain embodiments, the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to a beta lactam, such as oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
[0022] In certain embodiments, the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to a beta lactam, such as oxacillin and/or methicillin, selected from ceftaroline, clindamycin, doxycycline, erythromycin, gentamicin, levofloxacin, and/or trimethoprim/sulfamethoxazole. [0023] In certain embodiment of all aspects of the disclosure, the multidrug-resistant bacteria, such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to all beta lactams including penicillins, carbapenems and first to fourth generation cephalosporins, but not to the fifth generation anti-MRSA cephalosporins (for example ceftaroline).
[0024] In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected from erythoromycin, levofloxacin, ceftaroline, linezolid and vancomycin. In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected erythromycin, levofloxacin and ceftaroline.
[0025] In certain embodiments of all aspects of the disclosure, the multidrug-resistant bacteriacomprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin, selected from erythoromycin, levofloxacin, ceftaroline, linezolid and/or vancomycin.
[0026] In certain embodiments of all aspects of the disclosure, the multidrug-resistant bacteriacomprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or oxacillin, selected from erythromycin, levofloxacin and/or ceftaroline. In certain embodiments of all aspects of the disclosure, the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of
Gram-positive bacteria that are resistant to methicillin and are non-susceptible to oxacillin and at least two antibiotics, such as at least three antibiotics selected from ceftaroline, erythromycin, clindamycin, doxycycline, levofloxacin, gentamicin, linezolid, trimethoprim- sulfamethoxazole, daptomycin and vancomycin.
[0027] In certain embodiments of all aspects of the disclosure, the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant to methicillin and are non-susceptible to oxacillin and at least two or three antibiotics selected from erythromycin, levofloxacin, clindamycin, ceftarolin and doxycycline, in another embodiment, erythromycin, levofloxacin and clindamycin, in still another embodiment, erythromycin, levofloxacin and clindamycin and in still another embodiment, erythromycin and levofloxacin.
[0028] In another embodiments of all aspects of the disclosure, the multidrug-resistant bacteria comprise at least one isolate or strain of at least one species of Gram-positive bacteria that are resistant and/or non-susceptible to at least three antibiotics from at least three different antibiotic classes wherein at least one of the three antibiotics is selected from a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) a carbapenem (e.g. imipenem and entapenem); an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), a ketolide (e.g., telithromycin), a fluoroquinolone (e.g., levofloxacin), a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline), a sulfonamide (e.g. sulfamethoxazole), trimethoprim and combinations thereof (e.g. trimethoprim/sulfamethoxazole). In a further embodiment, the multidrug resistant bacteria are also resistant and/or non-susceptible to methicillin, oxacillin, daptomycin and/or vancomycin. [0029] In some embodiments of all aspects of the disclosure, the amount of PlySs2 or the modified lysin polypeptide used in the foregoing methods may be below that which would result in a concentration equal to the MIC of the PlySs2 or the modified lysin polypeptide when used in the absence of antibiotic (/.<?., a “sub-MIC lysin amount”); alternatively or additionally, the amount of antibiotic used in the foregoing methods may be below that which corresponds, /.<?., which would result in, a concentration equal to the MIC for the antibiotic when used in the absence of PlySs2 or the modified lysin polypeptide (/.<?., a “sub-MIC antibiotic amount”). [0030] In another embodiment, the variant of SEQ ID NO: 1 or SEQ ID NO: 18 (/.<?., a “sub- MIC antibiotic amount”), such as the modified lysin polypeptide has reduced immunogenicity as compared to the counterpart wild-type PlySs2 lysin. The wild-type PlySs2 lysin (SEQ ID NO: 1) or SEQ ID NO: 18 has a cysteine, histidine-dependent amidohydrolase/peptidase
(CHAP) endopeptidase domain, which is the enzymatically active domain (EAD) of the PlySs2 polypeptide, and a C-terminal SH3b_5 (SH3b) cell wall-binding domain (CBD). In certain embodiments of all aspects of the disclosure, the variant of SEQ ID NO: 1 or SEQ ID NO: 18 such as the modified lysin polypeptides comprise at least one amino acid substitutions in the CHAP and/or one or more amino acid substitutions in the SH3b domain(s), wherein the variant inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria.
[0031] In certain embodiments of all aspects of the disclosure, the modified lysin polypeptide comprises at least one amino acid substitution as compared to a wild-type PlySs2 lysin polypeptide, wherein the wild-type PlySs2 lysin polypeptide has an amino acid sequence of SEQ ID NO: 1, a cysteine, histidine-dependent amidohydrolase/peptidase (CHAP) domain, and a cell wall binding (SH3b) domain, and wherein the at least one amino acid substitution is in the CHAP domain and/or the SH3b domain, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria. [0032] In certain embodiments of all aspects of the disclosure, the variant lysin polypeptide comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, N184D, and S198Q (pp296).
[0033] Also disclosed are active fragments of PlySs2 (SEQ ID NO: 1 or SEQ ID NO: 18, e.g., the CHAP domain and the SH3b domain as well as active fragments of the lysin polypeptide variants disclosed herein, wherein the active fragments of the variants include one or more amino acid substitutions in the CHAP domain and/or the SH3b domain.
[0034] In certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the United States (in 2020). Typically, the activity of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is consistent, regardless of resistance phenotype (methicillin- sensitive Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), including multidrug-resistant (MDR) isolates). As described herein, a PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide
comprising SEQ ID NO: 18, may be used for the treatment of Staphylococcus aureus bacteremia, including those caused by MDR MRSA isolates
[0035] In certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure is administered or formulated as a one-time intravenous infusion.
[0036] In certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is administered or formulated in an effective amount of 0.25 mg/kg administered or formulated as a one-time intravenous infusion.
[0037] In certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is administered or formulated in an effective amount of 18 mg and administered or formulated as a one-time intravenous infusion.
[0038] In certain embodiments of any of the foregoing methods, the subject has normal renal function (e.g., creatinine clearance [CrCl*] >60 mL/minute) or mild renal impairment, and the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 18 mg administered as a one-time intravenous infusion.
[0039] In certain embodiments of any of the foregoing methods, the subject has moderate or severe renal impairment (e.g., creatinine clearance [CrCl*] of 15 to <60 mL/minute) and the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 12 mg administered as a one-time intravenous infusion.
[0040] In certain embodiments of any of the foregoing methods, the subject has end-stage renal disease (ESRD; e.g. CrCl* <15 mL/minute) and/or is on hemodialysis, and the effective amount of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, is 18 mg administered as a one-time intravenous infusion.In certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the United States in
2020. Typically, the activity of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is consistent, regardless of resistance phenotype (methicillin-sensitive Staphylococcus aureus (MSSA), methicillin- resistant Staphylococcus aureus (MRSA), including multidrug-resistant (MDR) isolates). [0041] As described herein, a PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, may be used for the treatment of Staphylococcus aureus bacteremia, including those caused by MDR MRSA isolatesln certain embodiments of all aspects of the disclosure, the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the United States in 2020. Typically, the activity of the PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, is consistent, regardless of resistance phenotype (methicillin- sensitive Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), including multidrug-resistant (MDR) isolates). As described herein, a PlySs2 lysin polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof, such as the modified lysin polypeptide of the present disclosure, such as the PlySs2 lysin polypeptide comprising SEQ ID NO: 18, may be used for the treatment of Staphylococcus aureus bacteremia, including those caused by MDR MRSA isolates
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 depicts the prevalence of Staphylococcus aureus and methicillin-resistant Staphylococcus aureus (MRSA) among all causative pathogens of blood stream infections in U.S. hospitals over a 5-year period as described in the Examples.
FIG. 2 depicts the proportion of a methicillin-resistant phenotype among Staphylococcus aureus isolates from patients with blood stream infections, including infective endocarditis, in U.S. hospitals over a 5-year period as described in the Examples.
DETAILED DESCRIPTION
Definitions
[0042] As used herein, the following terms and cognates thereof shall have the following meanings unless the context clearly indicates otherwise:
[0043] “Carrier,” refers to a solvent, additive, excipient, dispersion medium, solubilizing agent, coating, preservative, isotonic and absorption delaying agent, surfactant, propellant, diluent, vehicle and the like with which an active compound is administered. Such carriers can be sterile liquids, such as water, saline solutions, aqueous dextrose solutions, aqueous glycerol solutions, and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like.
[0044] “Pharmaceutically acceptable carrier” refers to any and all solvents, additives, excipients, dispersion media, solubilizing agents, coatings, preservatives, isotonic and absorption delaying agents, surfactants, propellants, diluents, vehicles and the like that are physiologically compatible. The carrier(s) must be “acceptable” in the sense of not being deleterious to the subject to be treated in amounts typically used in medicaments. Pharmaceutically acceptable carriers are compatible with the other ingredients of the composition without rendering the composition unsuitable for its intended purpose. Furthermore, pharmaceutically acceptable carriers are suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response). Side effects are “undue” when their risk outweighs the benefit provided by the composition. Non-limiting examples of pharmaceutically acceptable carriers or excipients include any of the standard pharmaceutical carriers such as phosphate buffered saline solutions, water, and emulsions such as oil/water emulsions and microemulsions. Suitable pharmaceutical carriers are described, for example, in Remington's Pharmaceutical Sciences by E.W. Martin, 18th Edition.
[0045] “Bactericidal” refers to the property of causing the death of bacteria or capable of killing bacteria to an extent of at least a 3-log 10 (99.9%) or better reduction among an initial population of bacteria over an 18-24 hour period.
[0046] “Bacteriostatic” refer to the property of inhibiting bacterial growth, including inhibiting growing bacterial cells, thus causing a 2-loglO (99%) or better and up to just under a 3-log reduction among an initial population of bacteria over an 18-24 hour period.
[0047] “Antibacterial” refers to both bacteriostatic and bactericidal agents.
[0048] “Antibiotic” refers to a compound having properties that have a negative effect on bacteria, such as lethality or reduction of growth. An antibiotic can have a negative effect on Gram-positive bacteria, Gram-negative bacteria, or both. By way of example, an antibiotic can affect cell wall peptidoglycan biosynthesis, cell membrane integrity, or DNA or protein synthesis in bacteria. Nonlimiting examples of antibiotics active against Gram-positive bacteria include methicillin, oxacillin, vancomycin, daptomycin, mupirocin, lysostaphin, penicillins, cloxacillin, erythromycin, carbapenems, cephalosporins, gly copeptides, lincosamides, azithromycin, clarithromycin, roxithromycin, telithromycin, spiramycin, and fidaxomicin. [0049] “Drug resistant” generally refers to a bacterium that is resistant to the antibacterial activity of a drug. When used in certain ways, drug resistance may specifically refer to antibiotic resistance. In some cases, a bacterium that is generally susceptible to a particular antibiotic can develop resistance to the antibiotic, thereby becoming a drug resistant microbe or strain.
[0050] “Effective amount” refers to an amount which, when applied or administered in an appropriate frequency or dosing regimen, is sufficient to prevent, reduce, inhibit, or eliminate bacterial growth or bacterial burden or to prevent, reduce, or ameliorate the onset, severity, duration, or progression of the disorder being treated (for example, bacterial pathogen growth or infection), prevent the advancement of the disorder being treated, cause the regression of the disorder being treated, or enhance or improve the prophylactic or therapeutic effect(s) of another therapy, such as antibiotic or bacteriostatic therapy.
[0051] “Co-administer” is intended to embrace separate administration of two agents, such as a lysin polypeptide and an antibiotic or any other antibacterial agent in a sequential manner as well as administration of these agents in a substantially simultaneous manner, such as in a single mixture/composition or in doses given separately, but nonetheless administered substantially simultaneously to the subject, for example at different times in the same day or 24-hour period. Such co-administration of lysin polypeptides with one or more additional antibacterial agents can be provided as a continuous treatment lasting up to days, weeks, or months. Additionally, depending on the use, the co-administration need not be continuous or coextensive. For example, if the use were as a topical antibacterial agent to treat, e.g., a bacterial ulcer or an infected diabetic ulcer, the lysin polypeptide could be administered only initially within 24 hours of the first antibiotic use, and then the antibiotic use may continue without further administration of the lysin polypeptide.
[0052] “Subject” refers to a mammal, a plant, a lower animal, a single cell organism, or a cell culture. For example, the term “subject” is intended to include organisms, e.g., prokaryotes and
eukaryotes, which are susceptible to or afflicted with bacterial infections, for example Gram positive or Gram-negative bacterial infections. Examples of subjects include mammals, e.g., humans, dogs, cows, horses, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non human animals. In certain embodiments, the subject is a human, e.g., a human suffering from, at risk of suffering from, or susceptible to infection by Gram-positive bacteria, whether such infection be systemic, topical or otherwise concentrated or confined to a particular organ or tissue.
[0053] “Polypeptide” is used interchangeably with the term “protein,” “peptide,” and refers to a polymer made from amino acid residues. In certain embodiments, the polypeptide has at least about 30 amino acid residues. The term may include not only polypeptides in isolated form, but also active fragments and derivatives thereof. The term “polypeptide” also encompasses fusion proteins or fusion polypeptides comprising PlySs2, an active fragment thereof, and a modified lysin polypeptide as described herein, which maintains the lysin function. Depending on context, a polypeptide can be a naturally-occurring polypeptide or a recombinant, engineered, or synthetically-produced polypeptide. A particular lysin polypeptide can be, for example, derived or removed from a native protein by enzymatic or chemical cleavage, or can be prepared using conventional peptide synthesis techniques (e.g., solid phase synthesis) or molecular biology techniques (such as those disclosed in Sambrook, J. et ak, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989)) or can be strategically truncated or segmented yielding active fragments, maintaining lytic activity against the same or at least one common target bacterium.
[0054] “Fusion polypeptide” refers to an expression product resulting from the fusion of two or more nucleic acid segments, resulting in a fused expression product typically having two or more domains or segments with different properties or functionality. In certain embodiments, the term “fusion polypeptide” also refers to a polypeptide or peptide comprising two or more heterologous polypeptides or peptides covalently linked, either directly or via an amino acid or peptide linker. The polypeptides forming the fusion polypeptide are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N- terminus, or N-terminus to C-terminus. The term “fusion polypeptide” can be used interchangeably with the term “fusion protein.” Thus, the open-ended expression “a polypeptide comprising” a certain structure includes larger molecules than the recited structure such as fusion polypeptides or constructs. The constructs referred to herein can be made as fusion polypeptides or as conjugates (by linking two or more moieties).
[0055] “Heterologous” refers to nucleotide, peptide, or polypeptide sequences that are not naturally contiguous. For example, in the context of the present disclosure, the term “heterologous” can be used to describe a combination or fusion of two or more peptides and/or polypeptides wherein the fusion peptide or polypeptide is not normally found in nature, such as for example a modified lysin polypeptide and a cationic and/or a polycationic peptide, an amphipathic peptide, a sushi peptide (Ding et al. Cell Mol Life Sci., 65(7-8): 1202-19 (2008)), a defensin peptide (Ganz, T. Nature Reviews Immunology 3, 710-720 (2003)), a hydrophobic peptide, and/or an antimicrobial peptide which may have enhanced lytic activity or fusion polypeptide comprising a PlySs2 CHAP and/or Sh3b domain fused to another lysins. Included in this definition are two or more lysin polypeptides or active fragments thereof. These can be used to make a fusion polypeptide with lytic activity.
[0056] “Active fragment” refers to a portion of a polypeptide that retains one or more functions or biological activities of the isolated polypeptide from which the fragment was taken. As used herein, an active fragment of a modified lysin polypeptide or PlySs2 inhibits the growth, or reduces the population, or kills at least one Gram-positive bacterial species, such as S. aureus. [0057] “Amphipathic peptide” refers to a peptide having both hydrophilic and hydrophobic functional groups. In certain embodiments, secondary structure places hydrophobic and hydrophilic amino acid residues at opposite sides (e.g. , inner side vs outer side when the peptide is in a solvent, such as water) of an amphipathic peptide. These peptides may in certain embodiments adopt a helical secondary structure, such as an alpha-helical secondary structure. [0058] “Cationic peptide” refers to a peptide having a high percentage of positively charged amino acid residues. In certain embodiments, a cationic peptide has a pKa-value of 8.0 or greater. The term “cationic peptide” in the context of the present disclosure also encompasses polycationic peptides which are synthetically produced peptides composed of mostly positively charged amino acid residues, such as lysine and/or arginine residues. The amino acid residues that are not positively charged can be neutrally charged amino acid residues, negatively charged amino acid residues, and/or hydrophobic amino acid residues.
[0059] “Hydrophobic group” refers to a chemical group such as an amino acid side chain which has low or no affinity for water molecules but higher affinity for oil molecules. Hydrophobic substances tend to have low or no solubility in water or aqueous phases and are typically apolar but tend to have higher solubility in oil phases. Examples of hydrophobic amino acids include glycine (Gly), alanine (Ala), valine (Val), Leucine (Leu), isoleucine (lie), proline (Pro), phenylalanine (Phe), methionine (Met), and tryptophan (Trp).
[0060] “Augmenting” as used herein refers to a degree of activity of an agent, such as antimicrobial activity, that is higher than it would be otherwise. “Augmenting” encompasses additive as well as synergistic (superadditive) effects.
[0061] “Synergistic” or “superadditive” refers to a beneficial effect brought about by two substances in combination that exceeds the sum of the effects of the two agents working independently. In certain embodiments the synergistic or superadditive effect significantly, /.<?., statistically significantly, exceeds the sum of the effects of the two agents working independently. One or both active ingredients may be employed at a subthreshold level, /.<?., a level at which if the active substance is employed individually produces no or a very limited effect. The effect can be measured by assays such as a checkerboard assay, described here. [0062] “Treatment” refers to any process, action, application, therapy, or the like, wherein a subject, including a human being, is subjected to medical aid with the object of curing a disorder, eradicating a pathogen, or improving the subject's condition, directly or indirectly. Treatment also refers to reducing incidence, alleviating symptoms, eliminating recurrence, preventing recurrence, preventing incidence, reducing the risk of incidence, improving symptoms, improving prognosis, or combinations thereof. “Treatment” may further encompass reducing the population, growth rate, or virulence of the bacteria in the subject and thereby controlling or reducing a bacterial infection in a subject or bacterial contamination of an organ, tissue, or environment. Thus “treatment” that reduces incidence is effective to inhibit growth of at least one Gram-positive bacterium in a particular milieu, whether it be a subject or an environment. On the other hand, “treatment” of an already established infection refers to reducing the population, killing, inhibiting the growth, and/or eradicating the Gram-positive bacteria responsible for an infection or contamination·
[0063] The term “preventing” and includes the prevention of the incidence, recurrence, spread, onset, or establishment of a disorder such as a bacterial infection. It is not intended that the present disclosure be limited to complete prevention or to prevention of establishment of an infection. In some embodiments, the onset is delayed, or the severity of a subsequently contracted disease or the chance of contracting it is reduced, and such constitute examples of prevention. With specific reference to biofilm prevention, the term includes prevention of the formation of biofilm, for example by interfering with the adherence of bacteria on a surface of interest, such as the surface of a medical device (e.g., inhaler, catheter, intubation, valve, or other prosthesis).
[0064] “Contracted disease” refers to a disease manifesting with clinical or subclinical symptoms, such as the detection of fever, sepsis, or bacteremia, as well as disease that may be detected by growth of a bacterial pathogen (e.g., in culture) when symptoms associated with such pathology are not yet manifest. With respect to medical devices, in particular, a contracted disease shall include a biofilm containing bacteria, such as Staphylococcus or Streptococcus bacteria, and forming when such a device is in use.
[0065] The term “derivative” in the context of a peptide or polypeptide (which as stated herein includes an active fragment) is intended to encompass, for example, a polypeptide modified to contain one or more chemical moieties other than an amino acid that do not substantially adversely impact or destroy the polypeptides ’s activity, such as lytic activity. The chemical moiety can be linked covalently to the peptide, e.g., via an amino terminal amino acid residue, a carboxy terminal amino acid residue, or at an internal amino acid residue. Such modifications may be natural or non-natural. In certain embodiments, a non-natural modification may include the addition of a protective or capping group on a reactive moiety, addition of a detectable label, such as antibody and/or fluorescent label, addition or modification of glycosylation, or addition of a bulking group such as PEG (pegylation) and other changes known to those skilled in the art. In certain embodiments, the non-natural modification may be a capping modification, such as N-terminal acetylations and C-terminal amidations. Exemplary protective groups that may be added to lysin polypeptides include, but are not limited to, t-Boc and Fmoc. Commonly used fluorescent label proteins such as, but not limited to, green fluorescent protein (GFP), red fluorescent protein (RFP), cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and mCherry, are compact proteins that can be bound covalently or noncovalently to a lysin polypeptide or fused to a lysin polypeptide without interfering with normal functions of cellular proteins. In certain embodiments, a polynucleotide encoding a fluorescent protein is inserted upstream or downstream of the lysin polynucleotide sequence. This will produce a fusion protein (e.g., Lysin Polypeptide:: GFP) that does not interfere with cellular function or function of a lysin polypeptide to which it is attached. Polyethylene glycol (PEG) conjugation to proteins has been used as a method for extending the circulating half-life of many pharmaceutical proteins. Thus, in the context of lysin polypeptide derivatives, the term “derivative” encompasses lysin polypeptides chemically modified by covalent attachment of one or more PEG molecules. It is anticipated that pegylated lysin polypeptides will exhibit prolonged circulation half-life compared to the unpegylated lysin polypeptides, while retaining biological and therapeutic activity. Another example is the use of “artilysins”, whereby a short
polycationic and amphipathic alpha helices are appended to the N- or C-termini of a lysin polypeptide to improve in vitro antibacterial activity, such as a streptococcal lysin to improve in vitro anti-streptococcal activity.
[0066] “Percent amino acid sequence identity” refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, such as a lysin polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as a part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for example, using publicly available software such as BLAST or software available commercially for example from DNASTAR. Two or more polypeptide sequences can be anywhere from 0-100% identical, or any integer value there between. In the context of the present disclosure, two polypeptides are “substantially identical” when at least 80% of the amino acid residues (preferably at least about 85%, at least about 90%, and preferably at least about 95%, at least about 98%, or at least 99%) are identical. The term “percent (%) amino acid sequence identity” as described herein applies to peptides as well. Thus, the term “Substantially identical” will encompass mutated, truncated, fused, or otherwise sequence-modified variants of isolated polypeptides and peptides, such as those described herein, and active fragments thereof, as well as polypeptides with substantial sequence identity (e.g., at least 80%, at least 85%, at least 90%, at least 95% identity, at least 98% identity, or at least 99% identity as measured for example by one or more methods referenced above) as compared to the reference (wild type or other intact) polypeptide. Two amino acid sequences are “substantially homologous” when at least about 80% of the amino acid residues (preferably at least about 85%, at least about 90%, at least about 95%, at least about 98% identity, or at least about 99% identity) are identical, or represent conservative substitutions. The sequences of polypeptides of the present disclosure, are substantially homologous when one or more, or several, or up to 10%, or up to 15%, or up to 20% of the amino acids of the polypeptide, such as the lysin and/or fusion polypeptides described herein, are substituted with a similar or conservative amino acid substitution, and wherein the resulting polypeptide, such as the lysin and/or fusion polypeptides described herein, have at least one activity, antibacterial effects, and/or bacterial specificities of the reference polypeptide, such as the lysin and/or fusion polypeptides described herein.
[0067] As used herein, a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge. Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0068] “Inhalable composition” refers to pharmaceutical compositions of the present disclosure that are formulated for direct delivery to the respiratory tract during or in conjunction with routine or assisted respiration (e.g., by intratracheobronchial, pulmonary, and/or nasal administration), including, but not limited to, atomized, nebulized, dry powder, and/or aerosolized formulations.
[0069] “Biofilm” refers to bacteria that attach to surfaces and aggregate in a hydrated polymeric matrix that may be comprised of bacterial- and/or host-derived components. A biofilm is an aggregate of microorganisms in which cells adhere to each other on a biotic or abiotic surface. These adherent cells are frequently embedded within a matrix comprised of, but not limited to, extracellular polymeric substance (EPS). Biofilm EPS, which is also referred to as slime (although not everything described as slime is a biofilm) or plaque, is a polymeric conglomeration generally composed of extracellular DNA, proteins, and polysaccharides. In certain embodiments, the biofilm may contain Staphylococcus and/or Streptococcus bacteria. [0070] “Suitable” in the context of an antibiotic being suitable for use against certain bacteria refers to an antibiotic that was found to be effective against those bacteria even if resistance subsequently developed.
[0071] “Wild -type PlySs2 lysin” and “PlySs2 lysin,” refer to a polypeptide having the amino acid sequence:
[0072] MTTVNE ALNN VR AQ V GS G VS VGNGEC Y AL AS W YERMIS PD ATV GLG AG V G WV S G AIGDTIS AKNIGS S YNW QAN GWT VSTS GPFKAGQIVTLG ATPGNPY GH WIVE AVDGDRLTILEQNYGGKRYPVRNYYSAASYRQQVVHYITPPGTVAQSAPNLAGSRS YRETGTMTVTVDALNVRRAPNTSGEIVAVYKRGESFDYDTVIIDVNGYVWVSYIGGS GKRNYVATGATKDGKRFGNAWGTFK (SEQ ID NO: 1; 245 amino acid residues including the initial methionine residue which is removed during post-translational processing, leaving a
244-amino acid peptide as set forth in SEQ ID NO: 18). Accordingly, “Wild-type PlySs2 lysin” and “PlySs2 lysin,”refers to a polypeptide having the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 18.
[0073] “Modified lysin polypeptide” or “variant” in reference to SEQ ID NO: 1 or SEQ ID NO: 18 as used herein are used interchangeably to refer to a non-naturally occurring variant (or active fragment thereof) of the wild-type PlySs2 lysin (SEQ ID NO: 1) or the wild-type PlySs2 lysin, wherein the initial methionine residue is removed (SEQ ID NO: 18). The modified lysin polypeptide or variant of SEQ ID NO: 1 or SEQ ID NO: 18 has at least one amino acid substitution in the CHAP domain and/or the SH3b domain, and inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as S. aureus. In some embodiments, the modified lysin polypeptide or variant has at least 80% identity, such as 90%, such as 95%, such as 99%, such as 99.5% identity to SEQ ID NO: 1 or SEQ ID NO: 18.
[0074] “Immunogenic” or “immunogenicity” means predicted to be immunogenic or to have immunogenicity by establishing (for example, through computationally guided in silico methods) the existence of one or more T-cell epitopes. Immunogenicity of a modified lysin polypeptide as disclosed herein can be measured by TCE score, using any available in silico computationally guided method for obtaining such score and compared to the similarly derived TCE score of a wild-type PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1. Alternatively, immunogenicity of a modified lysin polypeptide as disclosed herein can be measured by an in vitro T cell response. By extension, “less immunogenic,” “reduced immunogenicity,” or the like means predicted to be less immunogenic or to have reduced immunogenicity by depletion (which includes elimination or attenuation by amino acid replacement) of one or more T-cell epitopes (i.e., have a lower TCE score as compared to a reference polypeptide) or that the modified lysin polypeptide as disclosed herein elicits a reduced T cell response. Therefore, as used herein, a modified lysin polypeptide is “less immunogenic,” or has “reduced immunogenicity,” or the like if the modified lysin polypeptide has either 1) a lower TCE score than a wild-type PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1 or 2) a reduced T cell response.
[0075] “Reduced T cell response” means that the modified lysin polypeptide induces less T cell activation than a wild-type PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1, as measured by an in vitro T cell proliferation (3{H] -thymidine incorporation) assay using CD8+ depleted, human peripheral blood mononuclear cells in which the human peripheral
blood mononuclear cells are exposed to fluorescein isothiocyanate-labeled anti-cytokine antibodies and the response measured.
[0076] “Substantially” used in the context of lytic activity (antimicrobial activity) of a modified lysin polypeptide of the present disclosure means at least a considerable portion of the antibacterial activity of the wild-type PlySs2 lysin, such that, on the basis of such activity, the modified lysin polypeptide would be useful alone or together with other antimicrobial agents, such as one or more antibiotics and/or lysostaphin, to inhibit, combat, or eliminate Staphylococcal or Streptococcal bacterial infection by killing these bacteria. Nonlimiting examples of such substantial activity compared to the wild-type PlySs2 lysin include no more than about 5, such as no more than about 4, no more than about 3, or no more than about 2, times the MIC of the wild-type lysin. Other measures of activity can be, for example, minimum biofilm eliminating concentration (MBEC) or in vivo efficacy using, for example, an animal model, such as the mouse neutropenic thigh infection model (MNTI). Still other measures can be the ability to synergize with antibiotics, such as vancomycin, daptomycin or oxacillin, or the ability to ameliorate, prevent, or delay development of, bacterial resistance of antibiotics, such as vancomycin, daptomycin or oxacillin, similar to the wild-type PlySs2 lysin. The same term “substantially” used in the context of reduced immunogenicity means having at most 65%, such as at most 50%, at most 40%, at most 30%, or at most 25% of the immunogenicity of the wild- type PlySs2 lysin, as measured for example by a TCE score [19].
Multi-drug resistant bacteria
[0077] In some embodiments, the lysin polypeptides as described herein comprising the PlySs2 lysins of SEQ ID NO: 1 or SEQ ID NO: 18 or a variant thereof) are capable of inhibiting the growth, reducing the population, or killing a multidrug -resistant MDR pathogen, such as at least one species, e,g„ at least one strain or isolate of at least one species, of a Gram-positive bacteria, which is multidrug-resistant. As used herein, a “multidrug-resistant” (“MDR”) pathogen, such as multidrug-resistant Gram-positive bacteria, is one that has developed resistance or become non-susceptible to at least two antimicrobial drugs (in some embodiment, of different class), each used as a monotherapy.
[0078] Typically, susceptibility, non-susceptibility and resistance are determined by breakpoints (interpretive criteria). Drugs, such as antibiotics, may have susceptible only breakpoints (S); resistance only breakpoints (R); S, intermediate (I) and R breakpoints; or more typically, S and R breakpoints.
[0079] Generally, susceptibility may be determined using Antimicrobial susceptibility testing (AST), which involves laboratory testing on microbes, including bacteria, to determine susceptibility or resistance to one or more drugs. Results of antimicrobial susceptibility testing show if, e.g., bacteria are susceptible (can be treated with drug), intermediate (may be treatable with drug, but may require a higher dosage), or resistant (cannot be treated with drug). The term “non-susceptible” includes both resistant and intermediate isolates.
[0080] For example, certain strains of S. aureus have been found to be resistant to several antibiotics including methicillin and/or vancomycin (Antibiotic Resistant Threats in the United States, 2013, U.S. Department of Health and Services, Centers for Disease Control and Prevention). One skilled in the art can readily determine if a bacterium is drug resistant and/or non-susceptible using routine laboratory techniques that determine the susceptibility or resistance of a bacterium to a drug or antibiotic, such as described in the Examples.
[0081] In some embodiments, multidrug-resistant Gram-positive bacteria are those that have a developed resistance or become non-susceptible to at least two, such as at least three, antimicrobial drugs, optionally in addition to oxacillin and/or methicillin, typically in addition to oxacillin.
[0082] In some embodiments, the multidrug-resistant Gram-positive bacteria, such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non- susceptible to at least two, such as at least three, such as at least four, such as at least five antibiotics, wherein each of the at least two, at least three or at least four antibiotics are from different antibiotic classes, such as those selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and a sulfonamide/trimethoprim.
[0083] More typically, the multidrug-resistant Gram-positive bacteria of the present disclosure are resistant and/or non-susceptible to at least two, such as at least three antibiotics, wherein each antibiotic is from a different antibiotic class, such as an antibiotic class selected from a macrolide, an aminoglycoside, a fluoroquinolone, a ketolide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and/or a sulfonamide/trimethoprim.
[0084] In certain embodiments, the multidrug-resistant bacteria, such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to at least two antibiotics, such as at least three antibiotics, optionally in addition to a beta lactam, such as oxacillin and/or methicillin, selected from ceftaroline, clindamycin, daptomycin,
doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
[0085] In certain embodiments of all aspects of the disclosure, the multidrug-resistant bacteria, such as at least one isolate or strain of at least one species of Gram-positive bacteria, are resistant and/or non-susceptible to all beta lactams including penicillins, carbapenems and first to fourth generation cephalosporins, but not to the fifth generation anti-MRSA cephalosporins (for example ceftaroline).
[0086] In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and/or methicillin, selected from erythoromycin, levofloxacin, ceftaroline, linezolid and vancomycin. In certain embodiments, the multidrug-resistant bacteria are resistant to at least two antibiotics, such as at least three antibiotics, optionally in addition to oxacillin and methicillin, selected from erythromycin, levofloxacin and ceftaroline.
[0087] In some embodiments the multidrug-resistant Gram-positive bacteria of the present disclosure are bacteria that have developed resistance or became non-susceptible to antimicrobial drugs, such as a Staphylococcus aureus, that is resistant and/or non-susceptible to two or more, in some embodiments, three or more antibiotics, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin. In specific embodiments, the multidrug- resistant Gram-positive bacteria is Staphylococcus aureus resistant and/or non-susceptible to three or more antibiotics, e.g., selected from ceftaroline, clindamycin, doxycycline, erythromycin, levofloxacin. In some embodiments, the multidrug-resistant Gram-positive bacteria of the present disclosure have additionally developed resistance or are non-susceptible to oxacillin.
[0088] In some embodiments, the multidrug-resistant bacteria are MSSA. In some embodiments, the multidrug-resistant bacteria are MRSA. In some embodiments of all aspects of the disclosure, the multidrug-resistant bacteria do not include MRSA. In other embodiments of all aspects of the disclosure, the multidrug-resistant bacteria include MRSA strain that are also resistant and/or non-susceptible to two or more, in some embodiments, three or more antibiotics, selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
PlySs2
[0089] The present disclosure is directed to methods of using PlySs2. In certain embodiments, PlySs2 or a fragment or variant thereof thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria, such as multidrug-resistant bacteria, such as at least one isolate or at least one strain of at least one species of Gram-positive bacteria, which multidrug-resistant as described herein.
[0090] As used herein, the terms “PlySs2”, “PlySs2 lysin”, “PlySs2 lysins”, “PlySs2” “CF- 301” and “exebacase” are used interchangeably and encompass PlySs2, set forth herein as SEQ ID NO: 1 (with or without the initial methionine residue or SEQ ID NO: 18). PlySs2, which was identified as an anti-staphylococcal lysin encoded within a prophage of the Streptococcus suis genome, exhibits bacteriocidal and bacteriostatic activity against the following exemplified bacteria.
[0091] PlySs2, i.e., exebacase, as described in the Examples, was uniformly active against contemporary Staphylococcus aureus isolates responsible for bloodstream infections in the US in 2020. PlySs2, i.e., exebacase, activity was consistent, regardless of resistance phenotype (MSSA, MRSA, including MDR isolates). Surveillance data as presented herein further support PlySs2, i.e., exebacase, as an option for the treatment of Staphylococcus aureus, including those caused by MDR MRSA isolates.
Table i. Reduction in Growth of Different Bacteria and Relative kill with a lysin, PlySs2 (partial listing)
[0092] The PlySs2 lysin of SEQ ID NO: 1 has a domain arrangement characteristic of most bacteriophage lysins, defined by a catalytic N-terminal domain linked to a cell wall-binding C-terminal domain. The N-terminal domain belongs to the cysteine-histidine-dependent amidohydrolases/peptidases (CHAP) family common among lysins and other bacterial cell wall-modifying enzymes. The C-terminal domain belongs to the SH3b family that typically forms the cell wall-binding element of lysins. The italicized amino acids indicate the CHAP domain (amino acids 1 to 146) and the dotted underline indicates the SH3b domain (amino acids 157 to 245). The naturally occurring linker between the two domains is PPGTVAQSAP (SEQ ID NO: 2).
MTTVNEALNNVRAQVGSGVSVGNGECYALASWYERMISPDATVGLGAGVGWVSGAI GDTISAKNIGSSYNWQANGWTVSTSGPFKAGQIVTLGATPGNPYGHVVIVEAVDGDR LTILEQNYGGKR YPVRNYYSAA SYRQQWHYITPPGTV AQS A PN L AGS RS Y RETGTMT YTyDALNVRRAPNTS_GEIVAVYKRGES_FDYpTVIIDyNGYYWyS_YIGGSGKRNYVA TGATKDGKRFGNAWGTPK (SEQ ID NO: 1).
[0093] In some embodiments, PlySs2 or a fragment or variant thereof suitable for use with the present methods includes an isolated polypeptide sequence having at least 70%, such as at least
80%, such as at least 85%, such as at least 90%, such as at least 95%, such as at least 98%, such as at least 99% sequence, such as at least 99.5% identity with SEQ ID NO: 1 or SEQ ID NO: 18, wherein the PlySs2 or a fragment or variant thereof retains one or more biological activities, e.g., catalytic activity, ability to bind to bacterial cell walls, such as Staphylococcus or Streptococcus, bacteriocidal or bacteriostatic activity, including the ability to kill Gram-positive bacteria in biofilm, such as Staphylococcus and/or Streptococcus of the PlySs2 lysin having the amino acid sequence of SEQ ID NO: 1 described herein.
[0094] A modified lysin polypeptide may be formed by any method known in the art as described herein and as described in WO 2013/170015, which is herein incorporated by reference in its entirety, e.g., by modifying the PlySs2 lysin of SEQ ID NO: 1 or SEQ ID NO: 18 through site-directed mutagenesis or via mutations in hosts that produce the PlySs2 lysin of SEQ ID NO: 1 or SEQ ID NO: 18, and which retain one or more of the biological functions as described herein. For example, one of skill in the art can reasonably make and test substitutions or replacements to, e.g., the CHAP domain and/or the SH3b domain of the PlySs2 lysin of SEQ ID NO: 1. Sequence comparisons to the Genbank database can be made with either or both of the CHAP and/or SH3b domain sequences or with the PlySs2 lysin full amino acid sequence of SEQ ID NO: 1, for instance, to identify amino acids for substitution. For example, a mutant or variant having an alanine replaced for valine at valine amino acid residue 19 in the PlySs2 amino acid sequence of SEQ ID NO: 1 is active and capable of killing Gram-positive bacteria in a manner similar to and as effective as the SEQ ID NO: 1 PlySs2 lysin.
[0095] Further, the CHAP domain contains conserved cysteine and histidine amino acid sequences (the first cysteine and histidine in the CHAP domain) which are characteristic and conserved in CHAP domains of different polypeptides. It is reasonable to predict, for example, that the conserved cysteine and histidine residues should be maintained in a mutant or variant of PlySs2 so as to maintain activity or capability. Accordingly, particularly desirable residues to retain in a lysin variant of the present disclosure include active-site residues Cys26, Hisl02, Glull8, and Asnl20 in the CHAP domain of SEQ ID NO: 1. Particularly desirable substitutions include: Lys for Arg and vice versa such that a positive charge may be maintained, Glu for Asp and vice versa such that a negative charge may be maintained, Ser for Thr such that a free -OH can be maintained and Gin for Asn such that a free NH2 can be maintained. Other suitable variants include substitutions in SEQ ID NO: 1 in the CHAP and/or SH3 domain regions that are not shared between other known lysins, such as between the CHAP domain of instant SEQ ID NO: 1 and the CHAP domain of PlyC as shown in for example, in Schmitz,
2011, “Expanding the Horizons of Enzybiotic Identification” Student Theses and Dissertations, paper 138, which is herein incorporated by reference in its entirety. Suitable modified lysins are also described herein.
[0096] In some embodiments, the present method includes administering an active fragment of a lysin to a subject in need thereof. Suitable active fragments include those that retain a biologically active portion of a protein or peptide fragment of the embodiments, as described herein. Such modified lysin polypeptides include polypeptides comprising amino acid sequences that include fewer amino acids than the full length protein of the lysin protein and exhibit at least one activity of the corresponding full-length protein. Typically, biologically active portions comprise a domain or motif with at least one activity of the corresponding protein. An exemplary domain sequence for the N-terminal CHAP domain of the PlySs2 lysin described above. An exemplary domain sequence for the C terminal SH3b domain of the PlySs2 lysin is also described above. A biologically active portion of a protein or protein fragment of the disclosure can be a polypeptide which is, for example, 10, 25, 50, 100 amino acids in length. Other biologically active portions, in which other regions of the protein are deleted can be prepared by recombinant techniques and evaluated for one or more of the functional activities of the native form of a polypeptide of the embodiments.
[0097] In some embodiments, suitable active fragments include those having at least 70%, such as at least 80%, such as at least 85%, such as at least 90%, such as at least 95%, such as at least 98% or such as at least 99% sequence identity with the active fragments described herein including the CHAP and/or the SH3b domain, wherein the active fragment thereof retains at least one activity of CHAP and/or the SH3b domain.
[0098] A lysin or active fragment thereof or modified lysin polypeptide as described herein for use in the present method may be produced by a bacterial organism after being infected with a particular bacteriophage or may be produced or prepared recombinantly or synthetically, e.g., chemically synthesized or prepared using a cell free synthesis system. In as much as the lysin polypeptide sequences and nucleic acids encoding the lysin polypeptides are described and referenced herein, the present lysins may be produced via the isolated gene for the lysin from the phage genome, putting the gene into a transfer vector, and cloning said transfer vector into an expression system, using standard methods of the art, as described for example in WO 2013/170015, which is herein incorporated by reference in its entirety. The present modified lysin polypeptides may be truncated, chimeric, shuffled or “natural,” and may be in combination
as described, for example, in U. S. Patent No. 5,604,109, which is incorporated herein in its entirety by reference.
[0099] Mutations can be made in the amino acid sequences, or in the nucleic acid sequences encoding the polypeptides and lysins described herein, including in the lysin sequence set forth in SEQ ID NO: 1, SEQ ID NO: 18 or in active fragments or truncations thereof, such that a particular codon is changed to a codon which codes for a different amino acid to obtain a sequence with a substituted amino acid, or one or more amino acids are deleted or added. [00100] Such a mutation is generally made by making the fewest nucleotide changes possible. A substitution mutation of this sort can be made to change an amino acid in the resulting protein in a non-conservative manner (for example, by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to another grouping) or in a conservative manner (for example, by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to the same grouping). Such a conservative change generally leads to less change in the structure and function of the resulting protein. A non-conservative change is more likely to alter the structure, activity or function of the resulting protein. The present disclosure should be considered to include sequences containing conservative changes which do not significantly alter the activity or binding characteristics of the resulting protein. Thus, one of skill in the art, based on a review of the sequence of the PlySs2 lysin polypeptide provided herein and on their knowledge and the public information available for other lysin polypeptides, can make amino acid changes or substitutions in the lysin polypeptide sequence. Amino acid changes can be made to replace or substitute one or more, one or a few, one or several, one to five, one to ten, or such other number of amino acids in the sequence of the lysin(s) provided herein to generate mutants or modified lysin polypeptides thereof. Such mutants or modified lysin polypeptide thereof may be predicted for function or tested for function or capability for anti-bacterial activity as described herein against, e.g., Staphylococcal, Streptococcal, or Enterococcal bacteria, and/or for having comparable activity to the lysin(s) as described and particularly provided herein. Thus, changes made to the sequence of lysin, and mutants or modified lysin polypeptide described herein can be tested using the assays and methods known in the art and described herein. One of skill in the art, on the basis of the domain structure of the lysin(s) hereof can predict one or more, one or several amino acids suitable for substitution or replacement and/or one or more amino acids
which are not suitable for substitution or replacement, including reasonable conservative or non-conservative substitutions.
Modified Lysin Polypeptides
[00101] The present disclosure is directed to methods of using a modified lysin polypeptide having lytic activity and reduced immunogenicity as compared to a wild-type PlySs2 lysin against multidrug-resistant Gram-positive bacteria. As used herein “lytic activity” encompasses the ability of a lysin to kill bacteria, reduce the population of bacteria or inhibit bacterial growth. Lytic activity also encompasses the ability to remove or reduce a biofilm and/or the ability to reduce the minimum inhibitory concentration (MIC) of an antibiotic. [00102] Typically, the present modified lysin polypeptides are capable of degrading peptidoglycan, a major structural component of the bacterial cell wall, resulting in cell lysis. The modified lysin polypeptides are further capable of reducing immunogenicity and/or reducing inflammatory response-related toxicity compared to a wild-type PlySs2 lysin.
[00103] Suitable methods for assessing the activity of a modified lysin polypeptide as disclosed herein are well known in the art and described in the examples. Briefly, a MIC value (i.e., the minimum concentration of peptide sufficient to suppress at least 80% of the bacterial growth compared to control) may be determined for a modified lysin polypeptide and compared to, e.g., a wild-type PlySs2 lysin or inactive compound. For example, MIC values for a modified lysin polypeptide may be determined against e.g., laboratory Staphylococcus aureus strains, in e.g., Mueller- Hinton broth or Mueller-Hinton broth supplemented with serum, such as horse serum.
[00104] In some embodiments, the present modified lysin polypeptides are capable of reducing a biofilm. Methods for assessing the Minimal Biofilm Eradicating Concentration (MBEC) of a modified lysin polypeptide may be determined using a variation of the broth microdilution MIC method with modifications (See Ceri et al. 1999. J. Clin Microbial. 37 : 1771- 1776, which is herein incorporated by reference in its entirety and Schuch et al., 2017, Antimicrob. Agents Chemother. 61, pages 1-18, which is herein incorporated by reference in its entirety.) In this method, colonies of bacteria, e.g., Staphylococcus aureus such as methicillin- resistant S. aureus (MRSA) and methicillin-susceptible S. aureus (MSSA), are suspended in medium, e.g., phosphate buffer solution (PBS) diluted e.g., 1:100 in TSBg (tryptic soy broth supplemented with 0.2% glucose), added as e.g., 0.15 ml aliquots, to a Calgary Biofilm Device (96-well plate with a lid bearing 96 polycarbonate pegs; lnnovotech Inc.) and incubated e.g., 24
hours at 37°C. Biofilms are then washed and treated with e.g., a 2-fold dilution series of the lysin in TSBg at e.g., 37°C for 24 hours. After treatment, wells are washed, air-dried at e.g., 37°C and stained with e.g., 0.05% crystal violet for 10 minutes. After staining, the biofilms are destained in e.g., 33% acetic acid and the OD600 of e.g., extracted crystal violet is determined. The MB EC of each sample is the minimum lysin concentration required to remove >95% of the biofilm biomass assessed by crystal violet quantitation.
[00105] In some embodiments, the present modified lysin polypeptides reduce the minimum inhibitory concentration (MIC) of an antibiotic. Any known method to assess MIC may be used. In some embodiments, a checkerboard assay is used to determine the effect of a lysin on antibiotic concentration. The checkerboard assay is based on a modification of the CLSI method for MIC determination by broth microdilution (See Clinical and Laboratory Standards Institute (CLSI), CLSI. 2015. Methods for Dilution Antimicrobial Susceptibility Tests for Bacteria That Grow Aerobically; Approved Standard-lOth Edition. Clinical and Laboratory Standards Institute, Wayne, PA, which is herein incorporated by reference in its entirety and Ceri et al. 1999. J. Clin. Microbiol. 37: 1771-1776, which is also herein incorporated by reference in its entirety).
[00106] Checkerboards are constructed by first preparing columns of e.g., a 96-well polypropylene microtiter plate, wherein each well has the same amount of antibiotic diluted 2- fold along the horizontal axis. In a separate plate, comparable rows are prepared in which each well has the same amount of lysin diluted e.g., 2-fold along the vertical axis. The lysin and antibiotic dilutions are then combined, so that each column has a constant amount of antibiotic and doubling dilutions of lysin, while each row has a constant amount of lysin and doubling dilutions of antibiotic. Each well thus has a unique combination of lysin and antibiotic. Bacteria are added to the drug combinations at a given concentration. The MIC of each drug, alone and in combination, is then recorded after e.g., 16 hours at 37°C in ambient air. Summation fractional inhibitory concentrations (åFICs) are calculated for each drug and the minimum åLIC value (åFICmin) is used to determine the effect of the lysin/antibiotic combination.
[00107] In some embodiments, the lysin polypeptides disclosed herein have been modified from a wild-type PlySs2 lysin. As disclosed herein, wild-type PlySs2 comprises both a CHAP domain and a SH3b domain, each of which in turn comprises multiple T-cell epitopes (TCE). TCE 1, TCE 2, TCE 3, and TCE 4 are located in the CHAP domain, while TCE 5, TCE 6, TCE 7, and TCE 8 are located in the SH3b domain. TCE 1 corresponds to amino acid residues
32-45 of SEQ ID NO: 1. TCE 2 corresponds to amino acid residues 84-98 of SEQ ID NO: 1. TCE 3 corresponds to amino acid residues 100-112 of SEQ ID NO: 1. TCE 4 corresponds to amino acid residues 128-145 of SEQ ID NO: 1. TCE 5 corresponds to amino acid residues 164-170 of SEQ ID NO: 1. TCE 6 corresponds to amino acid residues 172-187 of SEQ ID NO: 1. TCE 7 corresponds to amino acid residues 189-201 of SEQ ID NO: 1, and TCE 8 corresponds to amino acid residues 204-221 of SEQ ID NO: 1.
[00108] In certain embodiments, the modified lysin polypeptide comprises at least one substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the at least one substitution is in one or more of TCE 1, TCE 2, TCE 3, or TCE 4, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria. In certain embodiments, the modified lysin polypeptide comprises at least one substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the at least one substitution is in one or more of TCE 5, TCE 6, TCE 7, or TCE 8, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria. In certain embodiments, the modified lysin polypeptide comprises at least a first substitution and at least a second substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the at least the first substitution is in one or more of TCE 1, TCE 2, TCE 3, or TCE 4 and at least the second substitution is in one or more of TCE 5, TCE 6, TCE 7, or TCE 8, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria. Typically, the modified lysin polypeptide has reduced immunogenicity as compared to a wild-type PlySs2 having the amino acid sequence of SEQ ID NO: 1.
[00109] In certain embodiments, the modified lysin polypeptide comprises at least two substitutions as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1) or SEQ ID NO: 18, wherein the at least two substitutions are in TCE 4. In certain embodiments, the modified lysin polypeptide comprises at least four substitutions as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1) or SEQ ID NO: 18, wherein at least one substitution is in TCE 2, at least one substitution is in TCE 3, and at least two substitutions are in TCE 4.
[00110] In certain embodiments, a modified lysin polypeptide as disclosed herein may result from modifying the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 18 by an amino acid substitution in the CHAP domain in at least one position selected from amino acid residue 35, 92, 104, 128, and 137 and/or an amino acid substitution in the SH3b domain in at
least one position selected from amino acid residue 164, 184, 195, 198, 204, 206, 212, and 214. Accordingly, in certain embodiments, disclosed herein is a modified lysin polypeptide having at least one amino acid substitution as compared to the wild-type PlySs2 polypeptide (SEQ ID NO: 1), wherein the modified lysin polypeptide comprises at least one amino acid substitution in the CHAP domain in at least one position selected from amino acid residue 35, 92, 104, 128, and 137 of SEQ ID NO: 1 or SEQ ID NO: 18 and/or at least one amino acid substitution in SH3b domain in at least one position selected from amino acid residue 164, 184, 195, 198, 204, 206, 212, and 214 of SEQ ID NO: 1 or SEQ ID NO: 18, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria. In certain embodiments, the modified lysin polypeptide comprises an amino acid substitution in amino acid residues of 92, 104, 128, and 137 of SEQ ID NO: 1 or SEQ ID NO: 18. In certain embodiments, the modified lysin polypeptide comprises an amino acid substitution in amino acid residues 92, 104, 128, 137, 164, 184, and 198 of SEQ ID NO: 1 or SEQ ID NO: 18. Typically, the modified lysin polypeptide has reduced immunogenicity as compared to a wild-type PlySs2 having the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 18.
[00111] In certain embodiments, the modified lysin polypeptide may contain at least 3 amino acid substitutions, such as at least 4, at least 5, at least 6, at least 7, at least 8, or at least 9 amino acid substitutions. In certain embodiments, the modified lysin polypeptide may contain 3-9 amino acid substitutions, such as 4-9, 5-9, 6-9, 7-9, 8-9, or 9 amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18. In certain embodiments, the modified lysin polypeptide may comprise at least two, such as at least three or at least four, amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18 in the CHAP domain, and in certain embodiments, the modified lysin polypeptide may comprise at least two, such as at least three or at least four, amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18in the SH3b domain. In certain embodiments, the modified lysin polypeptide may consist of two, three or four amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18 in the CHAP domain, and in certain embodiments, the modified lysin polypeptide may consist of two, three, or four amino acid substitutions relative to SEQ ID NO: 1 or SEQ ID NO: 18in the SH3b domain.
[00112] In certain embodiments, the modified lysin polypeptide comprises one or more of the following amino acid substitutions relative to SEQ ID NO: 1: R35E, L92W, V104S, V128T, Y137S, Y164N, Y164K, N184D, R195E, S198H, S198Q, V204K, V204A, 1206E,
V212E, V212A, and V214G. In certain embodiments, the modified lysin polypeptide comprises one or more of the following amino acid substitutions located in the CHAP domain: R35E, L92W, V104S, V128T and Y137S, and/or one or more of the following amino acid substitutions located in the SH3b domain: Y164N, Y164K, N184D, R195E, S198H, S198Q, V204K, V204A, I206E, V212A, V212E, and V214G, wherein the modified lysin polypeptide or fragment thereof inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria. In some embodiments, corresponding modifications are obtained in reference to SEQ ID NO: 18.
[00113] Typically, the modified lysin polypeptide has reduced immunogenicity as compared to a wild-type PlySs2 having the amino acid sequence of SEQ ID NO: 1.
[00114] The substitutions herein are designated using the one-letter amino acid code of the original amino acid in SEQ ID NO: 1 that is replaced, followed by the amino acid position in SEQ ID NO: 1, followed by the amino acid that is substituted into the sequence to result in the modified lysin polypeptide. Accordingly, by way of example, R35E indicates a substitution wherein the arginine at amino acid number 35 of SEQ ID NO: 1 is replaced with glutamic acid. [00115] Exemplary modified lysin polypeptides are disclosed herein as pp55, pp61, pp65, pp296, pp324, pp325, pp341, pp338, pp388, pp400, pp616, pp619, pp628, pp632, and pp642.
[00116] The exemplary modified lysin polypeptides comprise the amino acid substitutions relative to the amino acid sequence of SEQ ID NO:l as shown below in Table 1.
[00117] In certain embodiments disclosed herein, the modified lysin polypeptide is pp55 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQID NO: 1: L92W, V104S, V128T, and Y137S. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 3. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 3, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 3. In certain embodiments, the modified lysin polypeptide has at least 90% sequence
identity with SEQ ID NO: 3. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 3. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 3. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 3.
[00118] In certain embodiments disclosed herein, the modified lysin polypeptide is pp61 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, S198H, and I206E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 4, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 4. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 4.
[00119] In certain embodiments disclosed herein, the modified lysin polypeptide thereof is pp65 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, S198Q, V204A, and V212A. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 5. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 5, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 5. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 5. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 5. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 5. In certain embodiments, the modified lysin polypeptide has at
least 99% sequence identity with SEQ ID NO: 5.1n certain embodiments disclosed herein, the modified lysin polypeptide is pp296 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, N184D, and S198Q, such that the amino acid sequence is
MTTVNE ALNN VR AQ V GS G V S V GN GEC Y AL AS WYERMIS PD ATV GLGAG V GWV S G AIGDTIS AKNIGS S YN W Q ANG WT V S TS GPFKAGQIVTW G ATPGNPY GH V S IVE A VDG DRLTILEQNY GGKRYPTRNYY S AASSRQQVVHYITPPGTVAQS APNLAGSRSKRETG TMTVT VD ALN VRRAPDTS GEIV A V YKRGEQFD YDT VIID VN G Y VW V S YIGGS GKRN YV ATG ATKDGKRFGNAW GTFK (SEQ ID NO: 6). In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 6, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 6. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 6.
[00120] In certain embodiments disclosed herein, the modified lysin polypeptide is pp324 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, and N184D. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 7. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 7, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 7. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 7. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 7. In certain
embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 7. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 7.
[00121] In certain embodiments disclosed herein, the modified lysin polypeptide is pp325 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164N, and R195E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 8. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 8, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 8. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 8. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 8. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 8. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 8.
[00122] In certain embodiments disclosed herein, the modified lysin polypeptide is pp381 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, N184D, and S198H. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 9. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 9, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 9. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 9. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 9. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 9. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 9.
[00123] In certain embodiments disclosed herein, the modified lysin polypeptide is pp341 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, N184D, V204A, and V212A. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 10, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 10. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 10.
[00124] In certain embodiments disclosed herein, the modified lysin polypeptide is pp388 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: Y164N, N184D, R195E, V204K, and V212E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 11. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 11, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 11. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 11. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 11. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 11. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 11.
[00125] In certain embodiments disclosed herein, the modified lysin polypeptide is pp400 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: R35E, L92W, V104S, V128T, and Y137S. In certain embodiments, the
modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 12. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 12, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 12. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 12. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 12. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 12. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 12.
[00126] In certain embodiments disclosed herein, the modified lysin polypeptide is pp616 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: V128T, Y137S, and Y164K. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 13, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 13. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 13. [00127] In certain embodiments disclosed herein, the modified lysin polypeptide is pp619 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, and Y164K. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 14. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 14, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin
polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 14. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 14. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 14. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 14. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 14.
[00128] In certain embodiments disclosed herein, the modified lysin polypeptide is pp628 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, V204K, and V212E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 15. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 15, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 15. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 15. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 15. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 15. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 15.
[00129] In certain embodiments disclosed herein, the modified lysin polypeptide is pp632 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, N184D, S198Q, V204K, and V212E. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 16. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 16, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild-type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 16. In certain embodiments,
the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 16. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 16. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 16. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 16.
[00130] In certain embodiments disclosed herein, the modified lysin polypeptide is pp642 and comprises the following amino acid substitutions relative to the amino acid sequence of SEQ ID NO: 1: L92W, V104S, V128T, Y137S, Y164K, I206E, and V214G. In certain embodiments, the modified lysin polypeptide comprises the amino acid sequence of SEQ ID NO: 17. In certain embodiments, the modified lysin polypeptide has at least 80% sequence identity with SEQ ID NO: 17, wherein the modified lysin polypeptide inhibits the growth, reduces the population, or kills at least one species of Gram-positive bacteria and optionally wherein the modified lysin polypeptide has reduced immunogenicity as compared to the wild- type PlySs2 (SEQ ID NO: 1). In certain embodiments, the modified lysin polypeptide has at least 85% sequence identity with SEQ ID NO: 17. In certain embodiments, the modified lysin polypeptide has at least 90% sequence identity with SEQ ID NO: 17. In certain embodiments, the modified lysin polypeptide has at least 95% sequence identity with SEQ ID NO: 17. In certain embodiments, the modified lysin polypeptide has at least 98% sequence identity with SEQ ID NO: 17. In certain embodiments, the modified lysin polypeptide has at least 99% sequence identity with SEQ ID NO: 17.
[00131] In some embodiments, corresponding modifications are obtained in reference to SEQ ID NO: 18.
[00132] In addition to the at least one substitution in the CHAP and/or Sh3b domains, the modified lysin polypeptides can also include one or more amino acid insertions and/or deletions, provided those modifications do not interfere with the lytic activity and/or reduced immunogenicity of the modified lysin polypeptide.
[00133] Also disclosed are chimeric lysin polypeptides. Chimeric lysin polypeptides are known in the art. For example, ClyF is a chimeric lysin that combines the catalytic domain of Plyl87 lysin (the N-terminal 157 amino acid residues) with the binding domain of PlySs2 (the C-terminal 99 residues) [10]. In certain embodiments, the chimeric lysin polypeptide comprises a modified PlySs2 CHAP domain, as disclosed herein, and the binding domain of another lysin. In certain embodiments, the chimeric lysin polypeptide comprises the catalytic domain of another lysin and a modified PlySs2 SH3b domain, as disclosed herein.
[00134] In some embodiments, an active fragment of the modified lysin polypeptide is obtained. The term “active fragment” refers to a portion of a full-length lysin, which retains one or more biological activities of the reference lysin. Thus, as used herein, an active fragment of a modified lysin polypeptides inhibits the growth, or reduces the population, or kills at least one Gram-positive bacterial species.
Vectors and Host Cells
[00135] Nucleic acids encoding PlySs2 or the modified lysin polypeptides disclosed herein can be introduced into an appropriate vector for expressing the modified lysin polypeptides. Generally, any system or vector suitable to maintain, propagate or express a polypeptide in a host may be used for expression of the modified lysin polypeptides disclosed herein or fragments thereof or PlySs2 or fragments thereof. For example, “recombinant expression vectors” or “expression vectors,” can direct the expression of genes to which they are operatively linked. The appropriate DNA/polynucleotide sequence may be inserted into the expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et al., eds., Molecular Cloning: A Laboratory Manual (3rd Ed.), Vols. 1-3, Cold Spring Harbor Laboratory (2001). Additionally, tags can also be added to the modified lysin polypeptides of the present disclosure or PlySs2 to provide convenient methods of isolation, e.g., c-myc, biotin, poly-His, etc. Kits for such expression systems are commercially available.
[00136] A wide variety of host/expression vector combinations may be employed in expressing the polynucleotide sequences encoding the present modified lysin polypeptides or PlySs2. Large numbers of suitable vectors are known to those of skill in the art, and are commercially available. Examples of suitable vectors are provided, e.g., in Sambrook et al, eds., Molecular Cloning: A Laboratory Manual (3rd Ed.), Vols. 1-3, Cold Spring Harbor Laboratory (2001). Such vectors include, among others, chromosomal, episomal and vims derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids.
[00137] Furthermore, the vectors may provide for the constitutive or inducible expression of PlySs2 or the modified lysin polypeptides of the present disclosure. Suitable vectors include but are not limited to derivatives of SV40 and known bacterial plasmids, e.g., E. coli plasmids colEl, pCRl, pBR322, pMB9 and their derivatives, plasmids such as RP4, pBAD24 and pBAD- TOPO; phage DNAS, e.g., the numerous derivatives of phage A, e.g., NM989, and other phage DNA, e.g., M13 and filamentous single stranded phage DNA; yeast plasmids such as the 2 D plasmid or derivatives thereof; vectors useful in eukaryotic cells, such as vectors useful in insect or mammalian cells; vectors derived from combinations of plasmids and phage DNAs, such as plasmids that have been modified to employ phage DNA or other expression control sequences; and the like. Many of the vectors mentioned above are commercially available from vendors such as New England Biolabs Inc., Addgene, Takara Bio Inc., ThermoFisher Scientific Inc., etc.
[00138] Additionally, vectors may comprise various regulatory elements (including promoter, ribosome binding site, terminator, enhancer, various cis-elements for controlling the expression level) wherein the vector is constructed in accordance with the host cell. Any of a wide variety of expression control sequences (sequences that control the expression of a polynucleotide sequence operatively linked to it) may be used in these vectors to express the polynucleotide sequences encoding PlySs2 or the modified lysin polypeptides of the present disclosure. Useful control sequences include, but are not limited to: the early or late promoters of SV40, CMV, vaccinia, polyoma or adenovirus, the lac system, the trp system, the TAC system, the TRC system, the LTR system, the major operator and promoter regions of phage A, the control regions of fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase (e.g., Pho5), the promoters of the yeast mating factors, E. coli promoter for expression in bacteria, and other promoter sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof. Typically, the polynucleotide sequences encoding the or PlySs2 polypeptides are operatively linked to a heterologous promoter or regulatory element. A polynucleotide sequence is “operatively linked” when it is placed into a functional relationship with another nucleotide sequence. For example, a promoter or regulatory DNA sequence is said to be “operatively linked” to a DNA sequence that codes for an RNA and/or a protein if the two sequences are operatively linked, or situated such that the promoter or regulatory DNA sequence affects the expression level of the coding or structural DNA sequence. Operatively linked DNA sequences are typically, but not necessarily, contiguous.
[00139] A wide variety of host cells are useful in expressing the present polypeptides. Non-limiting examples of host cells suitable for expression of the present polypeptides include well known eukaryotic and prokaryotic hosts, such as strains of E. coli, Pseudomonas, Bacillus, Streptomyces, fungi such as yeasts, and animal cells, such as CHO, Rl.l, B-W and L-M cells, African Green Monkey kidney cells (e.g., COS 1, COS 7, BSC1, BSC40, and BMT10), insect cells (e.g., Sf9), and human cells and plant cells in tissue culture.
[00140] While the expression host may be any known expression host cell, in a typical embodiment the expression host is one of the strains of E. coli. These include, but are not limited to commercially available E. coli strains such as ToplO (ThermoFisher Scientific, Inc.), DH5a (Thermo Fisher Scientific, Inc.), XLI-Blue (Agilent Technologies, Inc.), SCSllO (Agilent Technologies, Inc.), JM109 (Promega, Inc.), LMG194 (ATCC), and BL21 (Thermo Fisher Scientific, Inc.). There are several advantages of using E. coli as a host system including: fast growth kinetics, where under the optimal environmental conditions, its doubling time is about 20 min (Sezonov et ah, J. Bacterial. 1898746-8749 (2007)), easily achieved high density cultures, easy and fast transformation with exogenous DNA, etc. Details regarding protein expression in E. coli, including plasmid selection as well as strain selection are discussed in details by Rosano, G. and Ceccarelli, E., Front Microbial., 5: 172 (2014).
[00141] Efficient expression of the present modified lysin polypeptides or PlySs2 depends on a variety of factors such as optimal expression signals (both at the level of transcription and translation), correct protein folding, and cell growth characteristics. Regarding methods for constructing the vector and methods for transducing the constructed recombinant vector into the host cell, conventional methods known in the art can be utilized. While it is understood that not all vectors, expression control sequences, and hosts will function equally well to express the polynucleotide sequences encoding the modified lysin polypeptides of the present disclosure or PlySs2, one skilled in the art will be able to select the proper vectors, expression control sequences, and hosts without undue experimentation to accomplish the desired expression without departing from the scope of this disclosure.
[00142] PlySs2 and the modified lysin polypeptides of the present disclosure can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, and lectin chromatography. High performance liquid chromatography can also employed for lysin polypeptide purification.
[00143] Alternatively, the vector system used for the production of the modified lysin polypeptides of the present disclosure or PlySs2 may be a cell-free expression system. Various cell-free expression systems are commercially available, including, but are not limited to those available from Promega, LifeTechnologies, Clonetech, etc.
Compositions Comprising PlySs2 or the Modified Lysin Polypeptides
[00144] PlySs2 and/or the modified lysin polypeptides disclosed herein may be incorporated into antimicrobial and bactericidal compositions and unit dosage forms thereof alone or with one or more conventional antibiotics and other bactericidal agents.
[00145] Typically, the compositions contain PlySs2 and/or the modified lysin polypeptide as disclosed herein in an amount effective for killing Gram-positive bacteria selected from the group consisting of Staphylococcus aureus, Listeria monocytogenes, a coagulase negative staphylococcus such as from the Staphylococcus epidermidis group, the Staphylococcus saprophyticus group, the Staphylococcus simulans group, the Staphylococcus intermedius group, the Staphylococcus sciuri group, and the Staphylococcus hyicus group; Streptococcus suis, Streptococcus pyogenes, Streptococcus agalactiac, Streptococcus dysgalactiae, Streptococcus pneumoniae, species included in the viridans streptococci group such as the Streptococcus anginosis group, Streptococcus mitis group, Streptococcus sanguinis group, Streptococcus bovis group, Streptococcus salivarius group, and Streptococcus mutans group; Enterococcus faecalis, and Enterococcus faecium.
[00146] The compositions disclosed herein can take the form of solutions, suspensions, emulsions, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained- release formulations, suppositories, tampon applications, aerosols, sprays, lozenges, troches, candies, injectables, chewing gums, ointments, smears, time-release patches, liquid- absorbed wipes, and combinations thereof. Hence, the compositions can be employed as solids, such as tablets, lyophilized powders for reconstitution, liposomes or micelles, or the compositions can be employed as liquids, such as solutions, suspensions, gargles, emulsions, or capsules filled solids or liquids, such as for oral use. In certain embodiments, the compositions can be in the form of suppositories or capsules for rectal administration or in the form of sterile injectable or inhalable solutions or suspensions for parenteral (including, for example, intravenous or subcutaneous) or topical, such as dermal, nasal, pharyngeal or pulmonary, use. Such compositions include pharmaceutical compositions, and unit dosage forms thereof may comprise conventional or new ingredients in conventional or special proportions, with or
without additional active compounds or principles. Such unit dosage forms may contain any suitable effective amount of the active ingredient commensurate with the intended daily dosage range to be employed.
[00147] Carriers and excipients can be selected from a great variety of substances acceptable for human or veterinary use. Non-limiting examples of pharmaceutically acceptable carriers or excipients include any of the standard pharmaceutical carriers, such as phosphate buffered saline solutions, water, polyols, disaccharides or polysaccharides, and emulsions such as oil/water emulsions and microemulsions. Other stabilizing excipients include proprietary blends of stabilizing and protecting solutions (SPS), cyclodextrins and recombinant human albumin (rHSA). Other excipients may include bulking agents, buffering agents, tonicity modifiers (e.g. , salts and amino acids), surfactants, preservatives, antioxidants, and co-solvents. For solid oral compositions comprising PlySs2 or a modified lysin polypeptide disclosed herein, suitable pharmaceutically acceptable excipients include, but are not limited to, starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents, and the like. For liquid oral compositions, suitable pharmaceutically acceptable excipients may include, but are not limited to, water, glycols, oils, alcohols, flavoring agents, preservatives, and the like. For topical solid compositions such as creams, gels, foams, ointments, or sprays, suitable excipients may include, but are not limited to a cream, a cellulosic, or an oily base, emulsifying agents, stiffening agents, rheology modifiers or thickeners, surfactants, emollients, preservatives, humectants, alkalizing or buffering agents, and solvents.
[00148] For example, PlySs2 and/or the modified lysin polypeptides disclosed herein can be combined with buffers that maintain the pH of a liquid suspension, solution, or emulsion within a range that does not substantially affect the activity of the PlySs2 or modified lysin polypeptide. For example, a desirable pH range of the composition or of the environment wherein the active ingredient is found upon administration may be between about 4.0 and about 9.0, for example between about 4.5 and about 8.5.
[00149] A stabilizing buffer may be optionally included to permit the modified lysin polypeptide or PlySs2 to exert its activity in an optimized fashion. The buffer may contain a reducing reagent, such as dithiothreitol. The stabilizing buffer may also be or include a metal chelating reagent, such as ethylenediaminetetracetic acid disodium salt, or it may contain a phosphate or citrate-phosphate buffer, or any other buffering agent, such as Tris or succinate. [00150] A mild surfactant can be included in a pharmaceutical composition in an amount effective to potentiate the therapeutic effect of the modified lysin polypeptides or PlySs2 used
in the composition. Suitable mild surfactants may include, inter alia, esters of polyoxyethylene sorbitan and fatty acids (such as the Tween series), octylphenoxy polyethoxy ethanol (such as the Triton-X series), n-Octyl-fl-D-glucopyranoside, n-Octyl-fl-D-thioglucopyranoside, n- Decyl-f3-D-glucopyranoside, n-Dodecyl-f3-D-glucopyranoside, poloxamer, polysorbate 20, polysorbate 80, polyethylene glycol, and biologically occurring surfactants, e.g., fatty acids, glycerides, monoglycerides, deoxycholate, and esters of deoxycholate.
[00151] Preservatives may also be used in the compositions disclosed herein, and may, for example, comprise about 0.05% to about 0.5% by weight of the total composition. The use of preservatives may assure that if the product is microbially-contaminated, the formulation will prevent or diminish microorganism growth (or attenuate the potency of the formulation). Exemplary preservatives include methylparaben, propylparaben, butylparaben, chloroxylenol, sodium benzoate, DMDM Hydantoin, 3-Iodo-2-Propylbutyl carbamate, potassium sorbate, chlorhexidine digluconate, or a combination thereof.
[00152] For oral administration, Plyss2 and/or the modified lysin polypeptides disclosed herein can be formulated into solid or liquid preparations, for example tablets, capsules, powders, solutions, suspensions, and dispersions. For oral administration in the form of a tablet or capsule, the active ingredient may be combined with one or more pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose); fillers (e.g., lactose, sucrose, glucose, mannitol, sorbitol, other reducing and non-reducing sugars, microcrystalline cellulose, calcium sulfate, or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc, silica, steric acid, sodium stearyl fumarate, glyceryl behenate, calcium stearate, and the like); disintegrants (e.g. , potato starch or sodium starch glycolate); wetting agents (e.g. , sodium lauryl sulphate), coloring and flavoring agents, gelatin, sweeteners, natural and synthetic gums (such as acacia, tragacanth or alginates), buffer salts, carboxymethylcellulose, polyethyleneglycol, waxes, and the like. For oral administration in liquid form, the drug components can be combined with non-toxic, pharmaceutically acceptable inert carriers (e.g., ethanol, glycerol, water), suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats), emulsifying agents (e.g., lecithin or acacia), non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol or fractionated vegetable oils), preservatives (e.g., methyl or propyl-p- hydroxybenzoates or sorbic acid), and the like. Stabilizing agents such as antioxidants (e.g.,
BHA, BHT, propyl gallate, sodium ascorbate, or citric acid) can also be added to stabilize the dosage forms.
[00153] In certain embodiments, the tablets can be coated by methods well-known in the art. The compositions disclosed herein can be also introduced in microspheres or microcapsules, e.g. , fabricated from poly glycolic acid/lactic acid (PGLA). Liquid preparations for oral administration can take the form of, for example, solutions, syrups, emulsions, or suspensions, or they can be presented as a dry product for reconstitution with water or other suitable vehicle before use. Preparations for oral administration can be suitably formulated to give controlled or postponed release of the active compound.
[00154] The active agents can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles, and multilamellar vesicles. Liposomes can be formed from a variety of phospholipids, such as cholesterol, stearylamine, or phosphatidylcholines, as is well known.
[00155] For preparing solid compositions such as tablets and pills, a modified lysin polypeptide as disclosed herein or PlySs2 as also herein disclosed may be mixed with a pharmaceutical excipient to form a solid preformulation composition. If desired, tablets may be sugar coated or enteric coated by standard techniques. The tablets or pills may be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged or delayed action. For example, the tablet or pill can include an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by an enteric layer, which serves to resist disintegration in the stomach and permit the inner component to pass intact into the duodenum or to be further delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol, and cellulose acetate. Similarly, the orally-administered medicaments may be administered in the form of a time-controlled release vehicle, including diffusion-controlled systems, osmotic devices, dissolution-controlled matrices, and erodible/degradable matrices. [00156] Topical compositions as disclosed herein may further comprise a pharmaceutically or physiologically acceptable carrier, such as a dermatologically or an otically acceptable carrier. Such carriers, in the case of dermatologically acceptable carriers, may be compatible with skin, nails, mucous membranes, tissues, and/or hair, and can include any conventionally used dermatological carrier meeting these requirements. In the case of otically acceptable carriers, the carrier may be compatible with all parts of the ear. Such carriers can be
readily selected by one of ordinary skill in the art. Carriers for topical administration of the compounds disclosed herein include, but are not limited to, mineral oil, liquid petroleum, white petroleum, propylene glycol, polyoxyethylene and/or polyoxypropylene compounds, emulsifying wax, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2- octyldodecanol, benzyl alcohol, and water. In formulating skin ointments, the active components of the present disclosure may be formulated in an oleaginous hydrocarbon base, an anhydrous absorption base, a water-in-oil absorption base, an oil-in-water water-removable base, and/or a water-soluble base. In formulating otic compositions, the active components of the present disclosure may be formulated in an aqueous polymeric suspension including such carriers as dextrans, polyethylene glycols, polyvinylpyrrolidone, polysaccharide gels, Gelrite®, cellulosic polymers like hydroxypropyl methylcellulose, and carboxy-containing polymers such as polymers or copolymers of acrylic acid, as well as other polymeric demulcents. The topical compositions as disclosed herein may be in any form suitable for topical application, including aqueous, aqueous-alcoholic or oily solutions; lotion or serum dispersions; aqueous, anhydrous or oily gels; emulsions obtained by dispersion of a fatty phase in an aqueous phase (O/W or oil in water) or, conversely, dispersion of an aqueous phase in a fatty phase (W/O or water in oil), microemulsions or alternatively microcapsules, microparticles or lipid vesicle dispersions of ionic and/or nonionic type, creams, lotions, gels, foams (which may use a pressurized canister, a suitable applicator, an emulsifier, and an inert propellant), essences, milks, suspensions, or patches. Topical compositions disclosed herein may also contain adjuvants such as hydrophilic or lipophilic gelling agents, hydrophilic or lipophilic active agents, preserving agents, antioxidants, solvents, fragrances, fillers, sunscreens, odor- absorbers, and dyestuffs. In a further aspect, the topical compositions disclosed herein may be administered in conjunction with devices such as transdermal patches, dressings, pads, wraps, matrices and bandages capable of being adhered or otherwise associated with the skin or other tissue or organ of a subject, being capable of delivering a therapeutically-effective amount of one or more modified lysin polypeptides and/or PlySs2 as disclosed herein.
[00157] In some embodiments, the topical compositions disclosed herein additionally comprise one or more components used to treat topical bums. Such components may include, but are not limited to, a propylene glycol hydrogel; a combination of a glycol, a cellulose derivative and a water-soluble aluminum salt; an antiseptic; an antibiotic; and a corticosteroid. Humectants (such as solid or liquid wax esters), absorption promoters (such as hydrophilic clays, or starches), viscosity building agents, and skin-protecting agents may also be added.
Topical formulations may be in the form of rinses such as mouthwash. See, e.g. ,W02004/004650.
[00158] PlySs2 and/or the modified lysin polypeptides disclosed herein may also be administered by injection of a therapeutic agent comprising the appropriate amount of a PlySs2 or modified lysin polypeptide and a carrier. For example, the PlySs2 or modified lysin polypeptides can be administered intramuscularly, intracerebrovetricularly, intrathecally, subdermally, subcutaneously, intreaperitoneally, intravenously, or by direct injection or continuous infusion to treat infections by bacteria, such as gram-positive bacteria. The carrier may be comprised of distilled water, a saline solution, albumin, a serum, or any combinations thereof. Additionally, pharmaceutical compositions of parenteral injections can comprise pharmaceutically-acceptable aqueous or nonaqueous solutions of plySs2 or modified lysin polypeptides in addition to one or more of the following: pH buffered solutions, adjuvants (e.g. , preservatives, wetting agents, emulsifying agents, stabilizing agents, and dispersing agents), liposomal formulations, nanoparticles, dispersions, suspensions, and emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use. [00159] In certain embodiments, formulations for injection can be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, and in certain embodiments may include an added preservative. The compositions can take such forms as excipients, suspensions, solutions, or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing, bulking, and/or dispersing agents. The active ingredient can be in powder form for reconstitution with a suitable vehicle, e.g. , sterile pyrogen-free water, before use. Examples of buffering agents may include histidine, Tris, phosphate, succinate citrate, methionine, cystine, glycine, mild surfactants, calcium, and magnesium. A reducing agent such as dithiothreitol can also be included.
[00160] In cases where parenteral injection is the chosen mode of administration, an isotonic formulation may be used. Generally, additives for isotonicity can include sodium chloride, dextrose, sucrose, glucose, trehalose, mannitol, sorbitol, and lactose. In some cases, isotonic solutions such as phosphate buffered saline may be used. Stabilizers can include histidine, methionine, glycine, arginine, gelatin, and albumin, such as human or bovine serum albumin. A person of ordinary skill will readily appreciate that many of the foregoing excipients can also be used in compositions for injection.
[00161] A vasoconstriction agent can be added to the compositions disclosed herein. In certain embodiments, the compositions may be provided sterile and pyrogen-free.
[00162] In another embodiment, the compositions disclosed herein may be dry inhalable powders or other inhalable compositions, such as aerosols or sprays. The inhalable compositions disclosed herein can further comprise a pharmaceutically acceptable carrier. For administration by inhalation, PlySs2 and/or the modified lysin polypeptides may be conveniently delivered in the form of an aerosol spray presentation from such devices as inhalers, pressurized aerosol dispensers, or nebulizers, with the use of a suitable propellant, e.g. , dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide, or other suitable gas. In the case of a pressurized aerosol, the dosage unit can be determined by providing a valve to deliver a metered amount. Capsules and cartridges of, e.g., gelatin for use in an inhaler or insufflator can be formulated containing a powder mix of the active ingredient and a suitable powder base such as lactose or starch.
[00163] In one embodiment, PlySs2 and/or the modified lysin polypeptides disclosed herein may be formulated as a dry, inhalable powder or as an aerosol or spray. In specific embodiments, PlySs2 and/or the modified lysin polypeptide inhalation solution may further be formulated with a propellant for aerosol delivery. In certain embodiments, solutions may be nebulized. Many dispensing devices are available in the art for delivery of pharmaceutical compositions, including polypeptides, by inhalation. These include nebulizers, pressurized aerosol dispensers, and inhalers.
[00164] A surfactant can be added to an inhalable pharmaceutical composition as disclosed herein in order to lower the surface and interfacial tension between the medicaments and the propellant. Where the medicaments, propellant, and excipient are to form a suspension, a surfactant may or may not be required. Where the medicaments, propellant, and excipient are to form a solution, a surfactant may or may not be necessary, depending in part on the solubility of the particular medicament and excipient. The surfactant may be any suitable, non-toxic compound that is non-reactive with the medicament and that reduces the surface tension between the medicament, the excipient, and the propellant and/or acts as a valve lubricant. [00165] Examples of suitable surfactants include, but are not limited to: oleic acid; sorbitan trioleate; cetyl pyridinium chloride; soya lecithin; polyoxyethylene(20) sorbitan monolaurate; polyoxyethylene (10) stearyl ether; polyoxyethylene (2) oleyl ether; poly oxypropylene-polyoxy ethylene ethylene diamine block copolymers; polyoxyethylene(20) sorbitan monostearate; polyoxyethylene(20) sorbitan monooleate; polyoxypropylene- polyoxy ethylene block copolymers; castor oil ethoxylate; and combinations thereof.
[00166] Examples of suitable propellants include, but are not limited to: dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane, and carbon dioxide.
[00167] Examples of suitable excipients for use in inhalable compositions include, but are not limited to: lactose, starch, propylene glycol diesters of medium chain fatty acids; triglyceride esters of medium chain fatty acids, short chains, or long chains, or any combination thereof; perfluorodimethylcyclobutane; perfluorocyclobutane; polyethylene glycol; menthol; lauroglycol; diethylene glycol monoethylether; polyglycolized glycerides of medium chain fatty acids; alcohols; eucalyptus oil; short chain fatty acids; and combinations thereof.
[00168] In some embodiments, the compositions disclosed herein comprise nasal applications. Nasal applications include, for instance, nasal sprays, nasal drops, nasal ointments, nasal washes, nasal injections, nasal packings, bronchial sprays and inhalers, or indirectly through use of throat lozenges, mouthwashes or gargles, or through the use of ointments applied to the nasal nares, or the face or any combination of these and similar methods of application. [00169] Compositions disclosed herein can also be formulated for rectal administration, e.g., as suppositories or retention enemas (e.g. , containing conventional suppository bases such as cocoa butter or other glycerides).
[00170] In certain embodiments, the compositions disclosed herein may further comprise at least one antibiotic, such as at least one antibiotic effective to inhibit the growth, reduce the population, or kill at least one species of Gram-positive bacteria. In certain embodiments, the at least one antibiotic is effective against one or more of Staphylococcus aureus, Listeria monocytogenes, a coagulase negative staphylococcus such as from the Staphylococcus epidermidis group, the Staphylococcus saprophyticus group, the Staphylococcus simulans group, the Staphylococcus intermedius group, the Staphylococcus sciuri group, and the Staphylococcus hyicus group; Streptococcus suis, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus dysgalactiac, Streptococcus pneumoniae, species included in the viridans streptococci group such as the Streptococcus anginosis group, Streptococcus mitis group, Streptococcus sanguinis group, Streptococcus bovis group, Streptococcus salivarius group, and Streptococcus mutans group; Enterococcus faecalis, and Enterococcus faecium. [00171] In certain embodiments of the compositions disclosed herein, the PlySs2 and/or the modified lysin polypeptide in combination with the at least one antibiotic may exhibit synergism, for example synergism in the PlySs2 and/or the modified lysin polypeptide’s or the antibiotic’s ability to inhibit the growth, reduce the population, or kill at least one species of
Gram-positive bacteria. Synergy may refer to the inhibitory activity of a combination of two active agents, wherein the fractional inhibitory concentration (FIC) index for the combination is less than 1, and for strong synergy, less than or equal to 0.5. The FIC of an agent is the minimum concentration of that agent that kills bacteria when used in combination with another agent divided by the concentration of the first agent that has the same effect when the first agent is used alone. The FIC index for the combination of A and B is the sum of their individual FIC values.
[00172] Synergy may be evaluated in a checkerboard assay (and can be validated by time-kill curves). Each checkerboard assay generates many different combinations, and, by convention, the FIC values of the most effective combination are used in calculating the FIC index. The FIC index defines the nature of the interaction. Antimicrobial agents with additive interactions have a FIC index of 1; an FIC index of <1 defines synergistic interactions; combinations with an FIC index >1 are antagonistic. The lower the FIC index, the more synergistic a combination. See, e.g., Singh, P.K. et al, Am J Physiol Lung Cell Mol Physiol 279: L799-L805, 2000. Synergy has implications for an efficacious, new general anti-infective strategy based on the co-administration of PlySs2 and/or modified lysin polypeptides and antibiotics. In particular each and both PlySs2 and/or modified lysin polypeptides and antibiotics may be administered at reduced doses and amounts, with enhanced bactericidal and bacteriostatic activity and with reduced risk of resistance development. In other words, the benefits of synergy are not only realized when one or both agents are used at sub-MIC concentrations, although the existence of synergy may be revealed by testing with sub-MIC concentrations of each agent.
Methods
[00173] Due to their high degree of activity and their low toxicity, together presenting a favorable therapeutic index, PlySs2 and/or a modified lysin polypeptide as disclosed herein may be administered to a subject in need thereof, e.g., a living animal (including a human) for the treatment, alleviation, or amelioration, palliation, or elimination of an indication or condition which is susceptible thereto.
[00174] In one aspect, the present disclosure is directed to a method of preventing or treating a multidrug-resistant bacterial infection caused by a multi-drug resistant bacteria as described herein comprising co-administering to a subject diagnosed with, at risk for, or exhibiting symptoms of a bacterial infection, a combination of a first effective amount of the
composition containing an effective amount of PlySs2 and/or a modified lysin polypeptide as described herein, and a second effective amount of an antibiotic suitable for the treatment of Gram-positive bacterial infection.
[00175] PlySs2 and/or the modified lysin polypeptides of the present disclosure can be co-administered with standard care antibiotics or with antibiotics of last resort, individually or in various combinations as within the skill of the art. Traditional antibiotics used against Gram positive bacteria are described herein and may include, for example, antibiotics of different types and classes, such a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbapenem (e.g. imipenem and entapenem); a macrolide (e.g. erythromycin, azithromycin), an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), a glycopeptide (e.g., vancomycin, teicoplanin), oxazolidinones (e.g., linezolid and tedizolid), a fluoroquinolone (e.g., levofloxacin), ketolides (e.g., telithromycin), a lipopeptide, such as cyclic lipopeptides (e.g. daptomycin, mupirocin, and lysostaphin), a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline ) a sulfonamide (e.g. sulfamethoxazole), trimethoprim and combinations thereof, e.g. trimethoprim/sulfamethoxazole. In certain embodiments of all aspects of the disclosure, the antibiotic is daptomycin. In certain embodiments of all aspects of the disclosure, the antibiotic is vancomycin and daptomycin. In certain embodiments of all aspects of the disclosure, the antibiotic is oxacillin.
[00176] Combining PlySs2 and/or the modified lysin polypeptides of the present disclosure with antibiotics provides an efficacious antibacterial regimen. In some embodiments, co-administration of PlySs2 and/or the modified lysin polypeptides of the present disclosure with one or more antibiotics may be carried out at reduced doses and amounts of either PlySs2 and/or the modified lysin polypeptides or the antibiotic or both, and/or reduced frequency and/or duration of treatment with augmented bactericidal and bacteriostatic activity, reduced risk of antibiotic resistance and with reduced risk of deleterious neurological or renal side effects (such as those associated with colistin or polymyxin B use). As used herein the term “reduced dose” refers to the dose of one active ingredient in the combination compared to monotherapy with the same active ingredient. In some embodiments, the dose of PlySs2 and/or the modified lysin polypeptide or the antibiotic in a combination may be suboptimal or even subthreshold compared to the respective monotherapy.
[00177] In some embodiments, the present disclosure provides a method of augmenting antibiotic activity of one or more antibiotics against Gram-positive bacteria including
multidrug-resistant Gram-positive bacteria as described herein compared to the activity of said antibiotics used alone by administering to a subject one or more modified lysin polypeptides and/or PlySs2 disclosed herein together with an antibiotic of interest. The combination is effective against the bacteria and permits resistance against the antibiotic to be overcome and/or the antibiotic to be employed at lower doses, decreasing undesirable side effects.
[00178] In some embodiments, the present disclosure provides any methods disclosed herein wherein:
(a) the PlySs2-type lysin, e.g. exebacase, is administered as a one-time intravenous infusion;
(b) the effective amount of the PlySs2-type lysin, e.g. exebacase, is 0.25 mg/kg administered as a one-time intravenous infusion;
(c) the effective amount of the PlySs2-type lysin, e.g. exebacase, is 18 mg administered as a one-time intravenous infusion;
(d) the patient has normal renal function (e.g., creatinine clearance [CrCl*] >60 mL/min) or mild renal impairment, and the effective amount of the PlySs2-type lysin, e.g. exebacase, is 18 mg administered as a one-time intravenous infusion;
(e) the patient has moderate or severe renal impairment (e.g., CrCl* of 15 to <60 mL/min), and the effective amount of the PlySs2-type lysin, e.g. exebacase, is 12 mg administered as a one-time intravenous infusion;
(f) the patient has end-stage renal disease (ESRD; e.g. CrCl* <15 mL/min) and/or is on hemodialysis, and the effective amount of the PlySs2-type lysin, e.g. exebacase, is 8 mg administered as a one-time intravenous infusion; or
(g) the patient is a child less than two years of age and the effective amount of the PlySs2- type lysin, e.g. exebacase, is 0.5 mg/kg to 1.5 mg/kg, e.g., about 1 mg/kg, administered as a one-time intravenous infusion.
[00179] The terms “infection” and “bacterial infection” are meant to include respiratory tract infections (RTIs), such as respiratory tract infections in patients having cystic fibrosis (CF), lower respiratory tract infections, such as acute exacerbation of chronic bronchitis (ACEB), acute sinusitis, community- acquired pneumonia (CAP), hospital- acquired pneumonia (HAP) and nosocomial respiratory tract infections; sexually transmitted diseases, such as gonococcal cervicitis and gonococcal urethritis; urinary tract infections; acute otitis media; sepsis including neonatal septisemia and catheter-related sepsis; and osteomyelitis including
acute, chronic and haematogenous osteomyelitis. Infections caused by drug-resistant bacteria and multidrug-resistant bacteria are also contemplated.
[00180] Non- limiting examples of infections caused by Gram-positive bacterial may include: A) Nosocomial infections: 1. Respiratory tract infections especially in cystic fibrosis patients and mechanically-ventilated patients; 2. bacteremia and sepsis; 3. Wound infections, particularly those of burn victims; 4. Urinary tract infections; 5. Post-surgery infections on invasive devises; 6. Endocarditis including prosthetic valve endocarditis, cardiac device infection and right-sided endocarditis and endocarditis due to intravenous administration of contaminated drug solutions; 7. Infections in patients with acquired immunodeficiency syndrome, cancer chemotherapy, steroid therapy, hematological malignancies, organ transplantation, renal replacement therapy, and other conditions with severe neutropenia. B) Community- acquired infections: 1. Community- acquired respiratory tract infections; 2. Meningitis; 3. Folliculitis and infections of the ear canal caused by contaminated water; 4. Malignant otitis externa in the elderly and diabetics; 5. Osteomyelitis of the caleaneus in children; 6. Eye infections commonly associated with contaminated contact lens; 7. Skin infections such as nail infections in people whose hands are frequently exposed to water; 8. Gastrointestinal tract infections; and 9. Muscoskeletal system infections.
[00181] In other embodiments, the lysins of the present methods are used to treat a joint infection. Infected joints may include infected hip, knee, ankle, shoulder, elbow or wrist joints. Typically, the infected joint is a knee joint or a hip joint.
[00182] In some embodiments, the infected joint is a native joint. Infection of a native joint (also referred to herein as septic arthritis of a native joint) may occur when a penetrating injury, such as a puncture wound, occurs near or above a joint, allowing bacteria to directly enter the joint. In other embodiments, the joint infection occurs when bacteria from a distant infection spreads through the bloodstream to the native joint.
[00183] In other embodiments, the infected joint is a prosthetic joint, including, for example, septic arthritis of a prosthetic joint). The prosthetic joints may include hip, knee, shoulder, elbow, and ankle prostheses. Typically, the prosthetic joint is a prosthetic hip or knee. [00184] The one or more species of Gram-positive bacteria of the present methods may include any of the species of Gram-positive bacteria as described herein or known in the art. Typically, the species of Gram-positive bacteria may include Listeria monocytogenes, Staphylococcus aureus, coagulase negative staphylococci (including at least 40 recognized species including, but not limited to, the Staphylococcus epidermidis group, the Staphylococcus
saprophyticus group, the Staphylococcus simulans group, the Staphylococcus intermedius group, the Staphylococcus sciuri group, the Staphylococcus hyicus group, and any isolates referred to as from the “unspecified species group”), Streptococcus suis, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus dysgalactiae, Streptococcus pneumoniae, any additional species included in the viridans streptococci group (including, but not limited to, all species and strains included in the Streptococcus anginosis group, Streptococcus mitis group, Streptococcus sanguinis group, Streptococcus bovis (now gallolyticus ) group, Streptococcus salivarius group, and Streptococcus mutans group), Enterococcus faecalis, and Enterococcus faecium. Other examples of Gram-positive bacteria include but are not limited to the genera Actinomyces, Bacillus, Lactococcus, Mycobacterium, Corynebacterium, and Clostridium. [00185] In some embodiments of all aspects of the disclosure, co-administering the PlySs2 and/or the present modified lysin polypeptides and an antibiotic of interest may be used for the prevention, control, disruption, and treatment of bacterial biofilm formed by Gram positive bacteria. Biofilm formation occurs when microbial cells adhere to each other and are embedded in a matrix of extracellular polymeric substance (EPS) on a surface. The growth of microbes in such a protected environment that is enriched with biomacromolecules (e.g. polysaccharides, nucleic acids and proteins) and nutrients allow for enhanced microbial cross talk and increased virulence. Biofilm may develop in any supporting environment including living and nonliving surfaces such as the mucus plugs of the CF lung, contaminated catheters, implants, contact lenses, etc (Sharma et al. Biologicals, 42(1): 1-7 (2014), which is herein incorporated by reference in its entirety). Because biofilms protect the bacteria, they are often more resistant to traditional antimicrobial treatments, making them a serious health risk, which is evidenced by more than one million cases of catheter-associated urinary tract infections (CAUTI) reported each year, many of which can be attributed to biofilm-associated bacteria (Donlan, RM (2001) Emerg Infect DA7(2):277-281; Maki D and Tambyah P (2001) Emerg Infect Dis 7(2):342-347).
[00186] Thus, in one embodiment of all aspects of the disclosure, PlySs2 and/or the modified lysin polypeptides of the present disclosure are co-administered with an antibiotic of interest and used for the prevention, control, disruption, and treatment of bacterial infections due to Gram-positive bacteria when the Gram-positive bacteria are protected by a bacterial biofilm.
[00187] In some embodiments of all aspects of the disclosure, inhibiting the growth, or reducing the population, or killing at least one species of Gram-positive bacteria comprises
contacting bacteria with PlySs2 and/or the modified lysin polypeptides as described herein and an antibiotic of interest, wherein the bacteria are present on a surface of e.g., medical devices, floors, stairs, walls and countertops in hospitals and other health related or public use buildings and surfaces of equipment in operating rooms, emergency rooms, hospital rooms, clinics, and bathrooms and the like.
[00188] Examples of medical devices that can be protected using PlySs2 and/or the modified lysin polypeptides described herein include but are not limited to tubing and other surface medical devices, such as urinary catheters, mucous extraction catheters, suction catheters, umbilical cannulae, contact lenses, intrauterine devices, intravaginal and intraintestinal devices, endotracheal tubes, bronchoscopes, dental prostheses and orthodontic devices, surgical instruments, dental instruments, tubings, dental water lines, fabrics, paper, indicator strips (e.g., paper indicator strips or plastic indicator strips), adhesives (e.g., hydrogel adhesives, hot-melt adhesives, or solvent-based adhesives), bandages, tissue dressings or healing devices and occlusive patches, and any other surface devices used in the medical field. The devices may include electrodes, external prostheses, fixation tapes, compression bandages, and monitors of various types. Medical devices can also include any device which can be placed at the insertion or implantation site such as the skin near the insertion or implantation site, and which can include at least one surface which is susceptible to colonization by Gram-positive bacteria.
[00189] In some embodiments and all aspects of the disclosure, inhibiting the growth, or reducing the population, or killing at least one species of Gram-positive bacteria comprises contacting bacteria with PlySs2 and/or the modified lysin polypeptides as described herein and optionally an antibiotic of interest, wherein the Gram-positive bacteria is a multidrug-resistant bacteria. In some embodiments, the Gram-positive bacteria is resistant to at least two antibiotics, such as at least three antibiotics, such as at least four antibiotics. In some embodiments, the Gram-positive bacteria comprises Staphylococcus aureus, such as MRSA or MSSA, typically MRSA. In some embodiments, the at least two, such as the at least three, such as the at least four antibiotics to which the Gram-positive bacteria are resistant are selected from two or more, such as three or more, such as four or more of a beta-lactam including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) and a carbapenem (e.g. imipenem and entapenem); a macrolide (e.g. erythromycin, azithromycin), an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), a glycopeptide (e.g., vancomycin, teicoplanin), oxazolidinones (e.g., linezolid and tedizolid), a
fluoroquinolone (e.g., levofloxacin), ketolides (e.g., telithromycin), a lipopeptide, such as cyclic lipopeptides (e.g. daptomycin, mupirocin, and lysostaphin), a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline ) a sulfonamide (e.g. sulfamethoxazole), trimethoprim and combinations thereof, e.g. trimethoprim/sulfamethoxazole.
Dosage and Administration
[00190] Dosages administered depend on a number of factors such as the activity of infection being treated; the age, health and general physical condition of the subject to be treated; the activity of PlySs2 or a particular modified lysin polypeptide; the nature and activity of the antibiotic if any with which a PlySs2 or a modified lysin polypeptide according to the present disclosure is being paired; and the combined effect of such pairing. In certain embodiments, effective amounts of the PlySs2 or the modified lysin polypeptide to be administered may fall within the range of about 0.1-100 mg/kg (or 1 to 100 mcg/ml), such as from 0.5 mg/kg to 30 mg/kg. In certain embodiments, the PlySs2 or the modified lysin polypeptide may be administered 1-4 times daily for a period ranging from 1 to 14 days. The antibiotic, if one is also used, may be administered at standard dosing regimens or in lower amounts in view of any synergism. All such dosages and regimens, however, (whether of PlySs2, the modified lysin polypeptide or any antibiotic administered in conjunction therewith) are subject to optimization. Optimal dosages can be determined by performing in vitro and in vivo pilot efficacy experiments as is within the skill of the art but taking the present disclosure into account.
[00191] It is contemplated that PlySs2 and/or the modified lysin polypeptides disclosed herein may provide a rapid bactericidal and, when used in sub-MIC amounts, may provide a bacteriostatic effect. It is further contemplated that PlySs2 and/or the modified lysin polypeptides disclosed herein may be active against a range of antibiotic -resistant bacteria or multidrug resistant bacteria. Based on the present disclosure, in a clinical setting, PlySs2 and the present modified lysin polypeptides may be a potent alternative (or additive) for treating infections arising from drug- and multidrug-resistant bacteria alone or together with antibiotics (including antibiotics to which resistance has developed).
[00192] In some embodiments, time exposure to PlySs2 and/or the modified lysin polypeptides disclosed herein may influence the desired concentration of active polypeptide units per ml. Carriers that are classified as “long” or “slow” release carriers (such as, for example, certain nasal sprays or lozenges) may possess or provide a lower concentration of
polypeptide units per ml but over a longer period of time, whereas a “short” or “fast” release carrier (such as, for example, a gargle) may possess or provide a high concentration of polypeptide units (meg) per ml but over a shorter period of time. There are circumstances where it may be desirable to have a higher unit/ml dosage or a lower unit/ml dosage.
[00193] For the wild-type PlySs2 or the modified lysin polypeptides of the present disclosure, the therapeutically effective dose may be estimated initially either in cell culture assays or in animal models, usually mice, rabbits, dogs, or pigs. The animal model can also be used to achieve a desirable concentration range and route of administration· Obtained information can then be used to determine the effective doses, as well as routes of administration, in humans. Dosage and administration can be further adjusted to provide sufficient levels of the active ingredient or to maintain the desired effect. Additional factors that may be taken into account include the severity of the disease state; age, weight and gender of the patient; diet; desired duration of treatment; method of administration; time and frequency of administration; drug combinations; reaction sensitivities; tolerance/response to therapy; and the judgment of a treating physician.
[00194] A treatment regimen can entail daily administration (e.g. , once, twice, thrice, etc. daily), every other day (e.g., once, twice, thrice, etc. every other day), semi- weekly, weekly, once every two weeks, once a month, etc. In one embodiment, treatment can be given as a continuous infusion. Unit doses can be administered on multiple occasions. Intervals can also be irregular as indicated by monitoring clinical symptoms. Alternatively, the unit dose can be administered as a sustained release formulation, in which case less frequent administration may be used. Dosage and frequency may vary depending on the patient. It will be understood by one of skill in the art that such guidelines will be adjusted for localized administration, e.g., intranasal, inhalation, rectal, etc., or for systemic administration, e.g., oral, rectal (e.g., via enema), intramuscular (i.m.), intraperitoneal (i.p.), intravenous (i.v.), subcutaneous (s.c.), transurethral, and the like.The PlySs2 or the modified lysin polypeptides described herein and their preparation, characterization, and use will be better understood in connection with the following examples, which are intended as an illustration of and not a limitation upon the scope of the present disclosure.
[00195] The present disclosure is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description.
All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference.
EXAMPLE 1. MATERIALS AND METHODS
IA. Bacterial Isolates
[00196] The in vitro activity of PlySs2 and 12 comparator antibiotics, i.e., ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, oxacillin, tetracycline, trimethoprim/sulfamethoxazole and vancomycin, were evaluated against Staphylococcus aureus isolates recovered from the blood of bacteremia patients (3% with infective endocarditis). The patients were hospitalized during 2020 in 29 U.S. medical centers located in 9 Census regions (20 states) as part of the SENTRY Antimicrobial Surveillance Program. A total of 2,849 pathogens (1 patient infection episode) were consecutively recovered from blood cultures of the patients. Among the 2,849 pathogens, 666 (23.4%) were identified as S. aureus isolates (FIG. 1). The isolates were confirmed at the species level using matrix assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF, Bruker Daltonics, Inc., Bremen, Germany). 38.6% of the S. aureus isolates were MRSA isolates (FIG. 2). Twenty (20) of the S. aureus isolates were the causative pathogen in those patients with infective endocarditis, eight of which were MRSA.
IB. Susceptibility Testing
[00197] Minimal inhibitory concentrations (MICs) of PlySs2 against Staphylococcus aureus were determined by broth microdilution (BMD) using a nonstandard antimicrobial susceptibility testing (AST) medium comprised of cation-adjusted Mueller Hinton broth (caMHB) supplemented with donor herd horse serum and DL-dithiothreitol to final concentrations of 25% and 0.5 mM, respectively. This medium, referred to as caMHB-HSD, is approved for use with PlySs2 by the Clinical and Laboratory Standards Institute (CLSI). See Performance Standards for Antimicrobial Susceptibility Testing, 31st Edition. CLSI guideline M100. Wayne, PA: Clinical and Laboratory Standards Institute; 2021).
[00198] Frozen-form broth microdilution panels containing cation-adjusted Mueller- Hinton broth (CA-MHB)) for the 12 comparator antibiotics were manufactured (JMO Laboratories (North Liberty, IA)). The comparator antibiotics were tested following the reference BMD method for each. (Methods for Dilution Antimicrobial Susceptibility Tests for Bacteria that Grow Aerobically. 11th Edition. CLSI guideline M07. Wayne, PA: Clinical and
Laboratory Standards Institute; 2018). CLSI M100 (2021) criteria were used for categorical MIC interpretations of the comparator agents. Quality assurance was performed by sterility checks, colony counts, and testing of CLSI-recornmended quality control reference strains.
1C. Multidrug-Resistance determination
[00199] MRS A isolates were defined as methicillin-resistant based on an oxacillin- resistant phenotype. Such isolates are usually defined as multidrug-resistant (MDR) using standard phenotypic classifications. Here, the MRSA isolates were further characterized as MDR, when, in addition to oxacillin, the non-susceptible phenotypes were observed for two or more of ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
EXAMPLE 2. RESULTS
[00200] As shown in FIG. 1, the predominant causative pathogen of blood stream infections (BSI) in U.S. hospitals during the last five years of surveillance was Staphylococcus aureus (24.2%). The annual prevalence of MRSA among all organisms responsible for BSI remained between 9% and 11% (FIG. 1). The second most common species was Escherichia coli (20.8%), followed by Klebsiella pneumonia (8.7%), coagulase-negative staphylococci (6.6%) and other pathogens (5.5% or less). Data not shown. The annual occurrence of a methicillin-resistant phenotype among Staphylococcus aureus was between 43.1% and 38.6% (FIG. 2).
[00201] COVID-19 appeared to have minimal impact on the etiology of blood stream infections in the United States, as Staphylococcus aureus continued to represent the main pathogen responsible for blood stream infections during the SENTRY Antimicrobial Surveillance Program for 2020. Similar to the previous 4 years, Staphylococcus aureus accounted for approximately 25% of all pathogens recovered from blood specimens, although the occurrence of a methicillin-resistant phenotype within Staphylococcus aureus causing blood stream infections in the United States were slightly lower in 2020 (38.6%) compared to the previous 4 years (39.5-43.1%).
[00202] As shown below in Tables 1 and 2, PlySs2 inhibited all Staphylococcus aureus isolates at MIC values of < 1 pg/mL (MIC range 0.06-1 pg/mL). MICso, MIC90 and modal MIC values were 0.5 pg/mL. MIC50/90 values against methicillin-susceptible Staphylococcus aureus (MSSA) and methicillin-resistant Staphylococcus aureus (MRSA) were 0.5/0.5 pg/mL.
Accordingly, the PlySs2 in vitro activity was uniform when tested against Staphylococcus aureus clinical isolates responsible for BSI, including infective endocarditis, isolated from patients in the United States in 2020. Further, the PlySs2 activity was consistent, regardless of resistance phenotype (MSSA, MRSA, including MDR isolates).
[00203] As shown in Table 3, while most of the comparators were active against MSSA (91.7%-100% susceptible), many comparators exhibited reduced susceptibility against MRSA, including ceftaroline (88.3% susceptible). However, among the drugs that are indicated for treating Staphylococcus aureus bacteremia due to MRSA, daptomycin and vancomycin were active against all isolates (100% susceptible). Tables 1 and 3.
[00204] In addition, a total of 62.3% of all MRSA isolates were categorized as MDR isolates. PlySs2 demonstrated equal MIC50 and MIC90 results against the MDR isolates (MIC50/90, 0.5/0.5 pg/mL) and non-MDR isolates (0.5/0.5 pg/mL). Daptomycin and vancomycin also were active (100% susceptible) against MDR MRSA isolates. Tables 1 and 3.
[00205] Accordingly, the data presented here support the use of PlySs2 for the treatment of bacterial infections, such as bacteremia and infective endocarditis, including those caused by multidrug-resistant MRSA isolates.
Table 1
MIC50/MIC90 in mg/L (% susceptible by CLSI
S. aureusfPhenotype Ml 00 criteria) (No. tested)
CF-301 VAN DAP
Table 2. MIC distribution of exebacase against S. aureus isolated from patients with BSI, including IE, in U.S. hospitals in 2020.
No. and cumulative % of isolates inhibited at MIC ^g/mL)
S. aureus / of:
Subset (no. of isolates) - MIC50 MIC90
<0.03 0.06 0.12 0.25 0.5 1 2
1 0 43 577 45
Alla (666) 0.5 0.5
0.2 0.2 6.6 93.2 100.0
0 29 352 28
Methicillin-susceptible (409) 0.5 0.5
0.0 7.1 93.2 100.0
1 0 14 225 17 Methicillin-resistant (257) 0.5 0.5
0.4 0.4 5.8 93.4 100.0
1 0 10 137 12 MDR (160) 0.5 0.5
(0.6) (0.6) (6.9) (92.5) (100.0)
4 88 5
Non-MDR (97) 0.5 0.5
(4.1) (94.8) (100.0)
Isolates were defined as methicillin-resistant based on an oxacillin resistance phenotype. A multi-drug resistance (MDR) phenotype was defined among methecillin-resistant Staphylococcus aureus (MRSA) isolates when non-susceptible phenotypes were observed for oxacillin and 2 or more of the following agents: ceftarolne, erythromycin, clindamycin, doxycycline, levofloxacin, gentamicin, linezolid, trimethoprim-sulfamethoxazole, daptomycin and vancomycin.
Table 3. Antimicrobial activity of exebacase and comparator agents against S. aureus isolated from patients with BSI, including IE, in U.S. hospitals in 2020
Allb (666)
Execabase 0.5 0.5 0.06 to 1
Erythromycin 8 >8 <_0.06 to >8 46.8 2.3 50.9
Levofloxacin 0.25 >4 <_0.06 to >4 69.5 0.6 29.9
Oxacillin 0.5 >8 0.12 to >8 61.4 - 38.6
Clindamycin 0.06 >2 < 0.03 to >2 87.4 0.2 12.5
Ceftaroline 0.25 1 <_0.06 to 2 95.5 4.5d 0.0
Daptomycin 0.25 0.5 <.0.12 to 1 100.0
Doxycycline <^0.06 0.5 < 0.06 to >8 98.2 1.5 0.3
Gentamicin <_1 <_1 <_1 to >8 98.0 0.2 1.8
Linezolid 1 2 <.0.12 to 4 100.0 0.0
Trimethoprim- sulfamethoxazole <_0.5 <_0.5 <_0.5 to >16 97.9 - 2.1 Vancomycin 1 1 0.25 to 2 100.0 0.0 0.0 MSSAe (409)
Execabase 0.5 0.5 0.25 to 1
Erythromycin 0.25 >8 <_0.06 to >8 67.2 3.2 29.6
Levofloxacin 0.25 0.5 <_0.06 to >4 91.7 0.2 8.1
Oxacillin 0.5 1 0.12 to 2 100.0 0.0
Clindamycin 0.06 0.12 < 0.03 to >2 95.8 0.0 4.2
Ceftaroline 0.25 0.5 < 0.06 to 1 100.0 0.0 0.0
Daptomycin 0.25 0.5 <.0.12 to 1 100.0
Doxycycline <_0.06 0.12 <_0.06 to >8 99.5 0.2 0.2
Gentamicin <_1 <_1 <_1 to >8 98.5 0.0 1.5
Linezolid 1 2 < 0.12 to 4 100.0 0.0
Trimethoprim- sulfamethoxazole <_0.5 <_0.5 <_0.5 to >16 99.8 0.2 Vancomycin 1 1 0.25 to 2 100.0 0.0 0.0 MRSAe (257)
Execabase 0.5 0.5 0.06 to 1
Erythromycin >8 >8 < 0.06 to >8 14.4 0.8 84.8
Levofloxacin 4 >4 <_0.06 to >4 34.2 1.2 65.6
Oxacillin >8 >8 4 to >8 0.0 100.0
Clindamycin 0.06 >2 < 0.03 to >2 73.9 0.4 25.7
Ceftaroline 1 2 0.12 to 2 88.3 11.7d 0.0
Daptomycin 0.25 0.5 < 0.12 to 1 100.0
Doxycycline <_0.06 1 <_0.06 to >8 96.1 3.5 0.4
Gentamicin <_1 <1 <_1 to >8 97.3 0.4 2.3
Linezolid 1 2 < 0.12 to 2 100.0 0.0
Trimethoprim- sulfamethoxazole <_0.5 <_0.5 <_0.5 to >16 94.9 5.1 Vancomycin 1 1 0.5 to 2 100.0 0.0 0.0 MDRe (160)
Execabase 0.5 0.5 0.06 to 1
Erythromycin >8 >8 0.25 to >8 1.9 0.6 97.5
Levofloxacin >4 >4 0.25 to >4 3.1 1.9 95.0
Oxacillin >8 >8 8 to >8 0.0 100.0
Clindamycin 0.06 >2 < 0.03 to >2 58.1 0.6 41.2
Ceftaroline 1 2 0.25 to 2 81.2 18.8d 0.0
Daptomycin 0.25 0.5 < 0.12 to 0.5 100.0
Doxycycline <_0.06 1 <_0.06 to >8 94.4 5.0 0.6
Gentamicin <_1 <1 <_1 to >8 96.2 0.6 3.1
Linezolid 1 2 0.25 to 2 100.0 0.0
Trimethoprim- sulfamethoxazole <_0.5 <_0.5 < 0.5 to >16 91.9 8.1
Vancomycin 1 1 0.5 to 2 100.0 0.0 0.0 aCriteria as published by CLSI (2021); breakpoint not available. b Data for tetracycline not shown c “S” sensitive; “I” intermediate; “R” resistant d Intermediate may be interpreted as susceptible-dose dependent. e Isolates were defined as methicillin-resistant based on an oxacillin resistance phenotype. Multi-drug resistance (MDR) phenotype was defined among MRS A isolates when non-susceptible phenotypes were observed for oxacillin and 2 or more of the following agents: ceftaroline, erythromycin, clindamycin, doxycycline, levofloxacin, gentamicin, linezolid, trimethoprim-sulfamethoxazole, daptomycin and vancomycin.
Claims
1. A method of inhibiting the growth, reducing the population, or killing multidrug- resistant Gram-positive bacteria, the method comprising contacting the multidrug-resistant Gram-positive bacteria with a lysin polypeptide comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof having at least 80% identity to SEQ ID NO: 1 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills the multidrug-resistant Gram-positive bacteria, wherein the multidrug-resistant Gram-positive bacteria are resistant and/or non-susceptible to at least three antibiotics, wherein each antibiotic is from a different antibiotic class.
2. A method of preventing or treating a bacterial infection caused by a multidrug-resistant Gram-positive bacteria, the method comprising administering a therapeutically effective amount of a lysin polypeptide to a subject comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 18 or a variant thereof having at least 80% identity to SEQ ID NO: 2 or SEQ ID NO: 18, wherein the variant inhibits the growth, reduces the population, or kills the multidrug-resistant Gram-positive bacteria, wherein the multidrug-resistant Gram-positive bacteria are resistant and/or non-susceptible to at least three antibiotics, wherein each antibiotic is from a different antibiotic class.
3. The method of claim 1 or claim 2, wherein the variant of SEQ ID NO: 1 or SEQ ID NO: 18 comprises at least one amino acid substitution as compared to a lysin polypeptide having the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 18, a cysteine, histidine-dependent amidohydrolase/peptidase (CHAP) domain, and a cell wall binding (SH3b) domain, wherein the at least one amino acid substitution is in the CHAP domain and/or the SH3b domain, and wherein the variant inhibits the growth, reduces the population, or kills the Gram-positive bacteria.
4. The method of claim 1 , wherein the method further comprises contacting the bacteria with one or more antibiotic(s).
5. The method of any one of claims 2 or 3, wherein the method further comprises co administering one or more antibiotic(s) to the subject.
6. The method of any one of claims 3-5, wherein the at least one amino acid substitution comprises L92W, V104S, V128T, Y137S, Y164K, N184D, and S198Q.
7. The method of any one of claims 3-6, wherein the variant comprises the amino acid sequence of SEQ ID NO: 6.
8. The method of any one of claims 4 or 5, wherein the one or more antibiotic(s) comprises a beta-lactam antibiotic including penicillins (e.g. methicillin, oxacillin), a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) a carbapenem (e.g. imipenem and entapenem); a macrolide (e.g. erythromycin, azithromycin), an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), a ketolide (e.g., telithromycin), a glycopeptide (e.g., vancomycin, teicoplanin), oxazolidinones (e.g., linezolid and tedizolid), a fluoroquinolone (e.g., levofloxacin), a lipopeptide, such as cyclic lipopeptides (e.g. daptomycin, mupirocin), a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline ), a sulfonamide (e.g. sulfamethoxazole), trimethoprim and combinations thereof (e.g. trimethoprim/sulfamethoxazole) .
9. The method of any one of claims 4 or 5, wherein the antibiotic is vancomycin, daptomycin or oxacillin.
10. The method of any one of claims 1-9, wherein the lysin polypeptide or the variant thereof is administered in an amount corresponding to a concentration below the minimal inhibitory concentration (MIC) of the lysin polypeptide or variant thereof.
11. The method of any one of claims 4-10, wherein the antibiotic is administered in an amount corresponding to a concentration below the minimal inhibitory concentration (MIC) of the antibiotic.
12. The method of any one of the preceding claims, wherein the multidrug-resistant Gram positive bacteria comprise Staphylococcus aureus.
13. The method of any one of the preceding claims, wherein the multidrug-resistant bacteria comprise methicillin-resistant Staphylococcus aureus or methicillin-sensitive Staphylococcus aureus.
14. The method of any one of the preceding claims, wherein the multidrug-resistant bacteria comprise methicillin-resistant Staphylococcus aureus.
15. The method of any one of the preceding claims, wherein the multidrug-resistant bacteria are resistant and/or non-susceptible to at least three antibiotics each selected from different antibiotic class, selected from a beta-lactam, a cephalosporin, a monobactam, a carbapenem, a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and sulfonamide/trimethoprim.
16. The method of any one of the preceding claims, wherein the multidrug-resistant bacteria are resistant and/or non-susceptible to at least three antibiotics selected from ceftaroline, clindamycin, daptomycin, doxycycline, erythromycin, gentamicin, levofloxacin, linezolid, trimethoprim/sulfamethoxazole and/or vancomycin.
17. The method of claim 15, wherein the at least three antibiotic classes are in addition to a beta-lactam antibiotic, such as oxacillin.
18. The method of any one of claims 2-18, wherein the bacterial infection comprises bacteremia and/or infective endocarditis.
19. The method of any one of claims 1-14 or 18, wherein the multidrug-resistant Gram positive bacteria are resistant and/or non-susceptible to at least three antibiotics, wherein each antibiotic is from a different class selected from a macrolide, an aminoglycoside, a glycopeptide, an oxazolidinone, a fluoroquinolone, a ketolide, a lipopeptide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and sulfonamide/trimethoprim.
20. The method of any one of claims 1-14 or 18, wherein the multidrug-resistant Gram positive bacteria are resistant and/or non-susceptible to at least three antibiotics, wherein each antibiotic is from a different class selected from a macrolide, an aminoglycoside, a fluoroquinolone, a ketolide, a lincomycin, a tetracycline, a sulfonamide, a trimethoprim and sulfonamide/trimethoprim.
21. A method of inhibiting the growth, reducing the population, or killing multidrug- resistant Gram-positive bacteria, the method comprising contacting the multidrug-resistant Gram-positive bacteria with a lysin polypeptide comprising the amino acid sequence of SEQ ID NO: 18, wherein the multidrug -resistant Gram-positive bacteria are resistant to methicillin and/or oxacillin and are non-susceptible to at least two antibiotics selected from a cephalosporin (e.g. ceftaroline, cefalexin and cefactor), a monobactam (e.g. aztreonanl) a carbapenem (e.g. imipenem and entapenem); an aminoglycoside (e.g. gentamicin, tobramycin, amikacin), a ketolide (e.g., telithromycin), a fluoroquinolone (e.g., levofloxacin), a lincomycin (e.g., clindamycin), a tetracycline (e.g., tetracycline, doxycycline ), a sulfonamide (e.g. sulfamethoxazole), trimethoprim and combinations thereof (e.g. trimethoprim/sulfamethoxazole) .
22. Any of the foregoing methods, wherein the lysin polypeptide is administered or formulated as a one-time intravenous infusion in an effective amount of 18mg, 12mg or 8mg.
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163208959P | 2021-06-09 | 2021-06-09 | |
US63/208,959 | 2021-06-09 | ||
US202163247068P | 2021-09-22 | 2021-09-22 | |
US63/247,068 | 2021-09-22 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022261360A1 true WO2022261360A1 (en) | 2022-12-15 |
Family
ID=84426291
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2022/032883 WO2022261360A1 (en) | 2021-06-09 | 2022-06-09 | Plyss2 lysins and variants thereof for use against multidrug resistant gram-positive bacteria |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2022261360A1 (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20150290299A1 (en) * | 2012-05-09 | 2015-10-15 | Contrafect Corporation | Bacteriophage lysin and antibiotic combinations against gram positive bacteria |
WO2019246552A1 (en) * | 2018-06-22 | 2019-12-26 | Contrafect Corporation | Lysins and derivatives thereof resensitize staphylococcus aureus and gram-positive bacteria to antibiotics |
-
2022
- 2022-06-09 WO PCT/US2022/032883 patent/WO2022261360A1/en active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20150290299A1 (en) * | 2012-05-09 | 2015-10-15 | Contrafect Corporation | Bacteriophage lysin and antibiotic combinations against gram positive bacteria |
WO2019246552A1 (en) * | 2018-06-22 | 2019-12-26 | Contrafect Corporation | Lysins and derivatives thereof resensitize staphylococcus aureus and gram-positive bacteria to antibiotics |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10744189B2 (en) | Lysin polypeptides active against Gram-negative bacteria | |
US11773140B2 (en) | Gram-negative lysin-antimicrobial peptide (AMP) polypeptide constructs, lysins, isolated polynucleotides encoding same and uses thereof in human serum | |
US20210260070A1 (en) | Lysin cf-301 resensitizes methicillin-resistant staphylococcus aureua (mrsa) to penicillin derivatives and first generation cephalosporins | |
US20210032294A1 (en) | MODIFIED PlySs2 LYSINS AND USES THEREOF | |
CA3085644A1 (en) | Identification of lysins and derivatives thereof with bacterial activity against pseudomonas aeruginosa | |
US20220160842A1 (en) | Method of treating infective endocarditis | |
WO2022261360A1 (en) | Plyss2 lysins and variants thereof for use against multidrug resistant gram-positive bacteria | |
US20220193186A1 (en) | Method of treating and preventing bone and joint infections | |
EP4157306A1 (en) | Modified plyss2 lysins and antibiotic combinations for use against gram-positive bacteria | |
CA3136126A1 (en) | Lysins and derivatives thereof with bactericidal activity against pseudomonas aeruginosa, in the presence of human serum |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22821056 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 22821056 Country of ref document: EP Kind code of ref document: A1 |