WO2024049232A1 - 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 - Google Patents

막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 Download PDF

Info

Publication number
WO2024049232A1
WO2024049232A1 PCT/KR2023/012962 KR2023012962W WO2024049232A1 WO 2024049232 A1 WO2024049232 A1 WO 2024049232A1 KR 2023012962 W KR2023012962 W KR 2023012962W WO 2024049232 A1 WO2024049232 A1 WO 2024049232A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
amino acids
peptide
antibacterial
terminus
Prior art date
Application number
PCT/KR2023/012962
Other languages
English (en)
French (fr)
Inventor
이소라
유영도
Original Assignee
주식회사 안단테에프엠
고려대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020230114740A external-priority patent/KR20240032667A/ko
Application filed by 주식회사 안단테에프엠, 고려대학교 산학협력단 filed Critical 주식회사 안단테에프엠
Publication of WO2024049232A1 publication Critical patent/WO2024049232A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N37/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
    • A01N37/44—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton by a single or double bond, this nitrogen atom not being a member of a derivative or of a thio analogue of a carboxylic group, e.g. amino-carboxylic acids
    • A01N37/46—N-acyl derivatives
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof

Definitions

  • the present invention relates to an antibacterial peptide consisting of a peptide domain (transmembrane domain) that penetrates the membrane of a membrane protein located in the cell membrane and the membrane of intracellular organelles and basic or polar (uncharged) amino acids at both ends of the domain, and specifically relates to such an antibacterial peptide.
  • a peptide domain transmembrane domain
  • the aim is to provide each peptide and an antibacterial composition containing each peptide.
  • the World Health Organization estimates that among the numerous multidrug-resistant bacteria, the bacteria at critical priority include carbapenem-resistant Acinetobacter baumannii and carbapenem-resistant Pseudomonas aeruginosa . , and carbapenem-resistant Enterobacteriaceae sp. species were selected, and it was announced that Gram-negative superbacteria, which are resistant to carbapenem antibiotics, known as the antibiotics of last resort, should be addressed as a top priority.
  • magainin an antibacterial peptide developed in the United States in 1999, requested FDA approval after phase 3 clinical trials, but approval was rejected because its efficacy was not superior to that of conventional antibiotics.
  • daptomycin in 2003 and oritavancin in 2014 were approved by the U.S. Food and Drug Administration, but both peptides showed antibacterial activity only against Gram-positive bacteria and could only be applied to skin infectious diseases.
  • a peptide (KU-5878, AMPR-11) containing the second transmembrane domain of the Romo1 protein located in the inner mitochondrial membrane has antibacterial activity in Gram-positive, Gram-negative, and multidrug-resistant bacteria. After confirming that it can be applied to the treatment of a wide range of bacterial infectious diseases, a patent was applied and a paper was published. However, in the case of KU-5878, although it contained a transmembrane peptide domain, its antibacterial activity was not excellent because it contained one basic amino acid at each end of the domain.
  • a peptide consisting of a peptide domain (transmembrane domain) that penetrates the membrane in a membrane protein and a total of 3 or more basic amino acids and some polar (non-charged) amino acids at both ends of the domain was found to have better antibacterial properties than previous inventions. It was discovered that it was active, and it showed antibacterial activity against Gram-positive, Gram-negative, and multidrug-resistant bacteria, confirming that it could be applied to the treatment of a wide range of bacterial infectious diseases, and the present invention was completed.
  • the technical problem to be achieved by the present invention is an antibacterial peptide consisting of a peptide domain (transmembrane domain) that penetrates the membrane in cells and a total of 3 or more basic amino acids and some polar amino acids at both ends of the domain ( Figure 1), with 15 to 30 amino acids.
  • a polypeptide containing a transmembrane domain (TMD) consisting of and at least one terminal amino acid containing a total of at least three amino acids at both ends bound to each of the C-terminus and N-terminus of the polypeptide.
  • the present invention aims to provide an antibiotic containing the antibacterial peptide as an active ingredient, a food and feed additive, a cosmetic composition, a biological pesticide, and an antibacterial quasi-drug composition containing the antibacterial peptide.
  • TMD transmembrane domain
  • Another aspect of the present invention provides an antibacterial polypeptide comprising the fusion polypeptide.
  • Another aspect of the present invention provides antibiotics, food and feed additives, cosmetic compositions, biological pesticides, and antibacterial quasi-drug compositions containing the polypeptide.
  • the peptide of the present invention and its variants have higher antibiotic activity against various types of bacteria than existing antibiotics and prior invention peptides.
  • the peptide of the present invention exhibits high antibacterial activity against antibiotic-resistant bacteria, exceeding the limitations of existing antibiotic applications, and can be provided as a preventive or therapeutic agent for infectious diseases caused by multidrug-resistant bacteria. Therefore, this antibacterial peptide is expected to be used in various fields such as for medicinal purposes, for external use in pharmaceuticals, for food and feed additions, and for pesticides and cosmetics for the purpose of preventing or treating a wide range of bacterial infectious diseases.
  • FIG. 1 provides an illustration of an antibacterial peptide consisting of a transmembrane domain (TMD) that penetrates the membrane and basic or polar (uncharged) amino acids at both ends of the domain.
  • TMD transmembrane domain
  • This diagram shows that the peptide kills bacteria by forming pores in the cell membrane of Gram-positive, Gram-negative, and multidrug-resistant bacteria.
  • One aspect of the present invention is a polypeptide containing a transmembrane domain (TMD) consisting of 15 to 30 amino acids, and at least one polypeptide at each of the C-terminus and N-terminus of the polypeptide, for a total of three or more polypeptides.
  • TMD transmembrane domain
  • fusion polypeptide containing amino acids linked to terminal amino acids.
  • the transmembrane domain may be any one of SEQ ID NOs: 39, 41, 54, 73 to 78.
  • the terminal amino acid may be one in which 2 to 6 amino acids are bonded to each of the C-terminus and N-terminus.
  • the terminal amino acid may be selected from the group consisting of basic amino acids and polar amino acids.
  • the terminal amino acid may be any one of lysine, arginine, histidine, serine, threonine cysteine, glutamine, arparagine, and tyrosine.
  • the fusion polypeptide has SEQ ID NO: 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65 , 66, 71, and 72.
  • Another aspect of the present invention provides an antibacterial polypeptide comprising the fusion polypeptide.
  • the polypeptide has PEGylation, acetylation, carboxylation, lipidation, or amidation at the N-terminus or C-terminus. ) may further include.
  • the polypeptide may have antibacterial activity against one or more bacteria selected from the group consisting of gram-positive bacteria, gram-negative bacteria, and multidrug-resistant bacteria.
  • Another aspect of the present invention provides antibiotics, food additives, feed additives, cosmetic compositions, antibacterial biological pesticide preparations, and antibacterial quasi-drug compositions containing the polypeptide as an active ingredient.
  • TMD transmembrane domain
  • transmembrane domain is a peptide sequence region with membrane penetrating ability
  • a peptide with membrane penetrating ability is a peptide that penetrates the lipid bilayer membrane of an organelle existing within a cell.
  • the domain that penetrates the lipid membrane (transmembrane domain, TMD) consists of approximately 22 amino acids, including hydrophobic amino acids and some hydrophilic amino acids. There may be one or multiple transmembrane domains.
  • transmembrane protein sequence information was obtained from UniProt (www.uniprot.org).
  • the inventors of the present invention synthesized peptides of various lengths consisting of a transmembrane domain and a total of 3 or more basic amino acids and some polar amino acids at both ends based on information obtained by searching on Unipro, confirmed the antibacterial activity of the peptides, and confirmed the antibacterial activity of the peptides.
  • the present invention was completed by confirming the antibacterial activity of the mutant (see Examples 1 and 2).
  • the present inventors synthesize peptides of various lengths existing in nature, which are composed of a transmembrane domain of human proteins and a total of three or more basic amino acids and polar amino acids at both ends, as described above,
  • the antibacterial activity of each peptide against Pseudomonas aeruginosa and Staphylococcus aureus was confirmed using the minimum bacterial sterilization concentration measurement method.
  • it was confirmed that all synthesized peptides had superior antibacterial activity than the previously invented KU-5878 (see Example 2).
  • the present inventors confirmed the antibacterial activity of a synthetic peptide with artificially repeated basic amino acids attached to both ends of the cell membrane penetrating domain. As a result, it was found that a group of peptides synthesized by attaching a total of three or more lysines (K) or arginines (R) to both sides of the cell membrane penetrating domain exhibited excellent antibacterial activity (see Example 4).
  • the present inventors claim that the fusion polypeptide of the present invention is effective against Enterococcus faecium, Escherichia coli, Acinetobacter baumannii, multidrug-resistant Pseudomonas aeruginosa, multidrug-resistant Staphylococcus aureus, multidrug-resistant Enterococcus faecium and multidrug-resistant acines.
  • the antibacterial activity of the peptide against Tobacter baumannii was confirmed. As a result, it was found that all representative peptides exhibited a broad spectrum of antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and multidrug-resistant bacteria (see Examples 5 and 6).
  • the present inventors synthesized a peptide consisting of a transmembrane domain of a species other than human and a basic amino acid and a polar amino acid at both ends of the domain, and confirmed the antibacterial activity. As a result, It was found that the above peptides, which have common characteristics regardless of species, exhibit antibacterial activity (see Example 7).
  • the present inventors confirmed that the amino acid sequence bound to both ends exhibits excellent antibacterial activity even when bound to another transmembrane peptide (see Example 8).
  • peptide refers to a linear molecule formed by linking amino acid residues together through peptide bonds. It can be prepared according to chemical synthesis methods known in the art, especially solid-phase synthesis techniques or liquid-phase synthesis techniques.
  • the transmembrane domain may be composed of 17 to 25 amino acids, and more specifically, may be any one of SEQ ID NOs: 39, 41, 54, 73 to 78.
  • the terminal amino acid is bound to the C-terminus and N-terminus of the transmembrane peptide domain, and contains at least one amino acid at each end, a total of 3 or more amino acids, specifically, 3 to 6 amino acids at each of the C-terminus and N-terminus. Amino acids may be included, with at least 1 and up to 6 amino acids bound to both ends.
  • the terminal amino acid is selected from basic amino acids and polar amino acids, and the terminal amino acid may be any one of lysine, arginine, histidine, serine, threonine cysteine, glutamine, arparagine, and tyrosine.
  • terminal amino acids bound to the C-terminus and N-terminus it is sufficient for the terminal amino acids bound to the C-terminus and N-terminus to be at least 1 at each end, and the total number of amino acids at both ends to be at least 3, and each amino acid is independent of each other, and the C-terminus and N-terminus are -Even if the peptides bound to the terminal have different amino acid compositions and different lengths, they are included in the present invention.
  • An example of the terminal amino acid may be one amino acid bound to one end of the transmembrane domain, and two or more amino acids bound to the other end.
  • the fusion polypeptide is SEQ ID NO: 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65 , 66, 71, and 72.
  • the polypeptide may be PEGylation, acetylation, carboxylation, lipidation, or amidation, and may be more specifically
  • the amino terminus can be bound to protective groups such as acetyl group, fluorenyl methoxy carbonyl group, formyl group, palmitoyl group, myristyl group, stearyl group, and polyethylene glycol (PEG), and the carboxy terminus of the peptide can be bound to a hydroxy group ( -OH), amino group (-NH2), azide (-NHNH2), etc.
  • fatty acids oligosaccharides chains, all nanoparticles (gold particles, liposomes, heparin, hydrogel, etc.), amino acids, carriers are added to the terminal of the peptide of the present invention or the R-group of the amino acid. It can bind proteins (carrier proteins), etc.
  • the amino acids constituting the peptide may each independently be an L-type or D-type amino acid, and may be radioactive or fluorescently labeled amino acid analogs.
  • the peptide may have antibacterial activity against one or more bacteria selected from the group consisting of Gram-positive bacteria, Gram-negative bacteria, and multidrug-resistant bacteria.
  • Another aspect of the present invention provides an antibacterial polypeptide comprising the fusion polypeptide.
  • the fusion polypeptide further contains a transmembrane peptide domain and amino acid residues at both ends, thereby penetrating the cell membrane and eluting bacteria to exert an antibacterial effect. Accordingly, the present invention provides an antibacterial effect comprising the fusion polypeptide.
  • a polypeptide having can be provided.
  • the polypeptide has PEGylation, acetylation, carboxylation, lipidation, or amidation at the N-terminus or C-terminus.
  • the carboxy terminus of the peptide can be modified into a hydroxy group (-OH), amino group (-NH2), azide (-NHNH2), etc.
  • fatty acids oligosaccharides chains, all nanoparticles (gold particles, liposomes, heparin, hydrogel, etc.), amino acids, carriers are added to the terminal of the peptide of the present invention or the R-group of the amino acid. It can bind proteins (carrier proteins), etc.
  • the polypeptide may have antibacterial activity against one or more bacteria selected from the group consisting of gram-positive bacteria, gram-negative bacteria, and multidrug-resistant bacteria.
  • the Gram-positive bacteria include Staphylococcus sp. , Bacillus sp. , Enterococcus sp. , Streptomyces sp. , and It may be a bacterium belonging to a genus selected from the group consisting of Streptococcus sp.
  • the gram-positive bacteria include Staphylococcus aureus , Bacillus subtilis , and Enterococcus faecalis. It may be one or more bacteria selected from the group consisting of Enterococcus faecium , Streptomyces Sindenensis, Enterococcus faecalis , and Streptococcus pneumoniae .
  • the gram-negative bacteria include Escherichia sp. , Klebsiella sp. , Acinetobacter sp. , Pseudomonas sp. , It may be a bacterium belonging to one genus selected from the group consisting of Enterobacter sp ., and preferably the gram-negative bacteria are Escherichia coli, Klebsiella pneumoniae . , Acinetobacter baumannii , Pseudomonas aeruginosa , and Enterobacter aerogenes.
  • the multi-drug resistant bacteria include penicillins, carbapenems, cephalosporins, quinolones, macrolides, and tetracyclines. (tetracyclins), or Gram-positive or Gram-negative bacteria resistant to one or more antibiotics belonging to the glycopeptides family, preferably the multi-drug resistant bacteria are methicillin-resistant Staphylococcus sp. , multidrug-resistant Pseudomonas sp. , vancomycin-resistant Enterococcus sp. , multidrug-resistant Klebsiella sp. , multidrug-resistant Acinetobacter genus. It may be a bacterium belonging to a genus selected from the group consisting of (multidrug-resistant Acinetobacter sp. ), and vancomycin-resistant Staphylococcus sp .
  • the multidrug-resistant bacteria include methicillin-resistant Staphylococcus aureus , multidrug-resistant P. aeruginosa , and multidrug-resistant Acinetobacter baumannii. resistant A. baumannii ), multidrug-resistant K. pneumoniae , vancomycin-resistant E. faecium , and vancomycin-resistant Staphylococcus aureus (vancomycin-resistant S. aureus ) may be one or more bacteria selected from the group consisting of
  • the multi-drug resistant Pseudomonas aeruginosa is treated with piperacillin, piperacillin-tazobactam, ceftazidime, imipenem, meropenem, It may have resistance to one or more antibiotics selected from the group consisting of gentamicin, amikacin, and ciprofloxacin, and the multidrug-resistant Acinetobacter baumannii may include piperacillin, It may have resistance to one or more antibiotics selected from the group consisting of piperacillin tazobactam, ceftazidime, imipenem, meropenem, gentamicin, amikacin, ciprofloxacin, and cefepime, and the above Multidrug-resistant Klebsiella pneumoniae may be resistant to one or more antibiotics selected from the group consisting of piperacillintazobactam, ceftazidime, cefepime, imipenem,
  • the vancomycin-resistant Enterococcus faecium is a group consisting of rifampin, tetracycline, gentamicin, erythromycin, streptomycin, and ampicillin in addition to vancomycin. It may additionally have resistance to one or more antibiotics selected from the group consisting of vancomycin-resistant Staphylococcus aureus, including oxacillin, benzylpenicillin, ampicillin, and cefazolin, in addition to vancomycin. It may additionally have resistance to one or more selected antibiotics.
  • Another aspect of the present invention provides an antibiotic comprising the polypeptide as an active ingredient.
  • the present invention provides a pharmaceutical composition for preventing or treating bacterial infectious diseases containing the antibacterial peptide as an active ingredient.
  • prevention refers to any action that delays infection by the gram-positive bacteria, gram-negative bacteria, and/or multidrug-resistant bacteria or delays the onset of disease caused by the infection by administering the pharmaceutical composition according to the invention.
  • treatment means any action in which symptoms due to the bacterial infection are improved or beneficially changed by administration of the pharmaceutical composition according to the present invention.
  • the pharmaceutical composition may further include one or more known antibiotics in addition to the fusion polypeptide or antibacterial polypeptide, and suitable carriers, excipients, and other substances commonly used in the production of pharmaceutical compositions. It may further contain a diluent.
  • carrier is also called a vehicle and refers to a compound that facilitates the addition of proteins or peptides into cells or tissues.
  • DMSO dimethyl sulfoxide
  • carrier is a commonly used carrier that facilitates the introduction of many organic substances into cells or tissues.
  • “diluent” is defined as a compound diluted in water that not only stabilizes the biologically active form of the protein or peptide of interest, but also dissolves the protein or peptide.
  • Salts dissolved in buffer solutions are used as diluents in the art.
  • a commonly used buffer solution is phosphate buffered saline because it mimics the salt conditions of human solutions. Because buffer salts can control the pH of a solution at low concentrations, it is rare for buffer diluents to modify the biological activity of the compound.
  • the compounds containing azelaic acid as used herein can be administered to human patients as such, or as pharmaceutical compositions mixed with other ingredients, such as in combination therapy, or with suitable carriers or excipients.
  • the pharmaceutical composition according to the present invention can be formulated and used in the form of external preparations such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, etc., and sterile injection solutions, respectively, according to conventional methods.
  • the pharmaceutical composition of the present invention can be administered orally or parenterally (e.g., intravenously, subcutaneously, intraperitoneally, or topically) depending on the desired method, and the dosage is determined by the patient's condition and weight, and the severity of the disease. Although it varies depending on the degree, drug form, administration route and period, it can be appropriately selected by a person skilled in the art.
  • 0.001 mg to 1000 mg can be administered in the form of a mixture with a pharmaceutically acceptable carrier.
  • the pharmaceutical composition of the present invention can be administered once or several times a day as needed, and can be used alone or in combination with surgery, hormone therapy, drug therapy, and methods using biological response regulators.
  • the present invention provides a method for preventing or treating bacterial infectious diseases comprising administering the antibacterial peptide to an individual.
  • the present invention provides the use of the antibacterial peptide for the production of a medicament for preventing or treating bacterial infectious diseases.
  • the bacterial infectious disease includes skin infection, food poisoning, otitis media, cystitis, peritonitis, urinary tract infection, mastitis, pneumonia, endocarditis, conjunctivitis, arthritis, endometritis, adenocarcinoma, bacteremia, sepsis, osteomyelitis, and acne. It may be one or more diseases selected from the group consisting of, preferably pneumonia or sepsis.
  • Another aspect of the present invention provides a food additive, feed additive, cosmetic composition, antibacterial biological pesticide preparation, and antibacterial quasi-drug composition containing the polypeptide.
  • the peptide When using the peptide of the present invention as an additive to food or feed, the peptide can be added as is or used together with other food, feed, or its components, and can be used appropriately according to conventional methods.
  • the amount of active ingredients mixed can be appropriately determined depending on the purpose of use (prevention of infectious diseases, health, or therapeutic treatment by inhibiting the proliferation and growth of bacteria).
  • it is added in an amount of 15% by weight or less, preferably 10% by weight or less, based on the peptide raw material of the present invention.
  • the amount may be below the above range, and since there is no problem in terms of safety, the active ingredient may be used in an amount above the above range. There are no special restrictions on the types of food and feed.
  • Example 1 Search for peptides consisting of a transmembrane domain and at least three basic amino acids and some polar amino acids at both ends.
  • transmembrane protein sequence information was searched for in UniProt (www.uniprot.org), which contains information on protein sequences and functions. Go to the UniProt website, access the proteins UniProt knowledgebase, and then access reviewed (Swiss-Prot). Next, if you access proteins with transmembrane, 79,724 proteins are searched. In the case of human proteins, 20,422 proteins are searched, of which 5,217 proteins are transmembrane proteins. By accessing each transmembrane protein, information on each protein can be confirmed, and at the same time, the peptide sequence of the transmembrane peptide domain can be confirmed.
  • the present inventor first searched for the transmembrane domain and its surrounding sequences in 5,217 transmembrane proteins, and among them, a peptide consisting of a transmembrane domain with a structure similar to Figure 1 and a total of 3 or more basic amino acids and some polar amino acids at both ends was identified. synthesized (Table 1).
  • the present inventor synthesized 36 types of antibacterial peptides consisting of a transmembrane peptide domain discovered in UniProt and basic or polar amino acids at both ends, and measured the antibacterial activity of each peptide using minimum bactericidal concentration (MBC). It was confirmed (see Table 1 below for information on each peptide). Confirmation of the antibacterial activity of each of the above peptides using a method of measuring the minimum bacterial bactericidal concentration was performed specifically as follows.
  • Pseudomonas aeruginosa ATCC 27853
  • Staphylococcus aureus NCCP 15872
  • LB 1% tryptone, 0.5% yeast extract, 1% sodium chloride
  • TSB Teryptic Soy Broth
  • each peptide was dispensed at different concentrations (final concentration: 0 ⁇ g/ml - 200 ⁇ g/ml peptide) into each well of a 96-well microplate, and 100 ⁇ l of the prepared strain solution was added and mixed 37 The reaction was performed in a thermostat at °C for 1 hour.
  • LB or TS agar prepared by dissolving 25 g/L of LB or 30 g/L of TS (Tryptic Soy) and 15 g/L of agar in distilled water, sterilizing it, pouring 20 mL into a 100 mm circular plate, and solidifying at room temperature for more than a day. 10 ⁇ l of the reaction solution of the peptide and the strain was spread onto the plate at a constant size, cultured in a thermostat at 37°C for 18 hours, and colony formation was confirmed on the plate. The minimum concentration of bacterial sterilization was defined as the minimum concentration of peptide at which not a single colony was generated, and the experimental results are shown in Table 1 below.
  • the peptide discovered in the present invention had 1.25 to 100 times better antibacterial activity against Pseudomonas aeruginosa and 1.25 to 25 times better antibacterial activity against Staphylococcus aureus than KU-5878.
  • COX20-1 peptide was selected as a representative among the synthetic peptides shown in Table 1 above and its antibacterial activity against Pseudomonas aeruginosa and Staphylococcus aureus was tested. It was measured using the minimum bacterial sterilization concentration measurement method. The method for measuring the minimum bacterial sterilization concentration was the same as the method in Example 2 above.
  • Example 4 Confirmation of antibacterial activity of a peptide synthesized by artificially attaching basic amino acids to both ends of the transmembrane domain.
  • an antibacterial peptide group consisting of a transmembrane peptide domain and basic or polar amino acids at both ends exhibits superior antibacterial activity than KU-5878 invented in a previous study (Example 2 above).
  • These antibacterial peptide groups are peptides containing amino acid sequences that exist in nature.
  • peptides composed of amino acid sequences that have similar characteristics to these antibacterial peptide groups and do not exist in nature were synthesized, and the antibacterial activity of each peptide was compared and confirmed through a bacterial sterilization minimum concentration measurement method (information on each peptide is in the table below) 3).
  • the transmembrane domain corresponds to amino acids 58 to 77.
  • the antibacterial activity of a peptide consisting of three or more basic amino acids and some polar amino acids on both sides of the transmembrane domain was confirmed. As shown in Table 3, the antibacterial activity of peptides synthesized by artificially attaching 1 to 5 lysines (K) or arginines (R) to the transmembrane domains of HIG1A and COX20 proteins was measured.
  • peptides without basic or polar amino acids at both ends of the cell membrane penetrating domain had low antibacterial activity and could not be measured using the minimum bacterial bactericidal concentration measurement method.
  • lysine it was found that a group of peptides synthesized by artificially attaching two or more arginines each showed superior antibacterial activity than KU-5878.
  • transmembrane domains for SEQ ID NOs: 54, 58, 60, 62, 64, 65, and 66 were additionally synthesized, and peptides were synthesized by artificially attaching from 1 to 4 lysines (K) to both ends of the domain.
  • K lysines
  • Example 5 Confirmation of antibacterial activity against various bacteria of representative peptides among the antibacterial peptides identified in Tables 1 and 3
  • each bacterium was cultured overnight at 37°C and 200 rpm in 3% (w/v) TSB (Tryptic Soy Broth) liquid medium, and then cultured again for a second time under the same conditions for 2 hours.
  • a strain solution was prepared by diluting with 10 mM sodium phosphate solution so that the final concentration of each secondary cultured strain was 5 ⁇ 10 5 CFU/ml.
  • each peptide was dispensed at different concentrations (final concentration: 0 ⁇ g/ml - 200 ⁇ g/ml peptide) into each well of a 96-well microplate, and 100 ⁇ l of the prepared strain solution was added and mixed in a thermostat at 37°C. It was reacted for 1 hour.
  • TS Tryptic Soy
  • 15 g/L of agar were dissolved in distilled water and sterilized, then 20 mL was poured into a 100 mm circular plate and solidified at room temperature for more than a day to prepare the reaction between the peptide and the strain.
  • 10 ⁇ l of the solution was plated at a constant size, cultured in a thermostat at 37°C for 18 hours, and colony formation was confirmed on the plate.
  • the minimum concentration of bacterial sterilization was defined as the minimum concentration of peptide at which not a single colony was generated, and the experimental results are shown in Table 4 below.
  • antibacterial peptides consisting of a transmembrane peptide domain and basic or polar amino acids at both ends were found to exhibit a wide range of antibacterial activity against both Gram-positive and Gram-negative bacteria.
  • Example 6 Confirmation of antibacterial activity in multidrug-resistant bacteria of representative peptides among the antibacterial peptides identified in Tables 1 and 3
  • multidrug-resistant Pseudomonas aeruginosa and multidrug-resistant Acinetobacter are bacteria isolated from patients at Korea University Anam Hospital.
  • piperacillin and piperacillin-tazobactam are used.
  • ceftazidime, imipenem, meropenem, gentamicin, amikacin, and ciprofloxacin is resistant to multidrug-resistant Acinetobacter.
  • vancomycin-resistant Enterococcus faecium and vancomycin-resistant Staphylococcus aureus were purchased from the National Culture Collection for Pathogens (NCCP), and vancomycin-resistant Enterococcus faecium was treated with vancomycin, rifampin, It is resistant to tetracycline, gentamicin, erythromycin, streptomycin, and ampicillin, and vancomycin-resistant Staphylococcus aureus is resistant to vancomycin, oxacillin, benzylpenicillin, ampicillin, and cepha. It was confirmed to be resistant to cefazolin and used in experiments.
  • the antibacterial peptide consisting of a transmembrane peptide domain and basic or polar amino acids at both ends was found to exhibit a wide range of antibacterial activity against both multidrug-resistant Gram-positive and multidrug-resistant Gram-negative bacteria.
  • Example 7 Confirmation of antibacterial activity of some peptides of the antibacterial peptides in Table 1, which consist of a transmembrane domain and a sum of 3 or more basic amino acids and some polar amino acids at both ends among proteins corresponding to other species.
  • Example 1 the present inventor confirmed that among human proteins, peptides consisting of a transmembrane domain and basic or polar amino acids at both ends have excellent antibacterial activity, and this suggests that peptides with the same motif among proteins of other species have antibacterial activity.
  • Table 6 the peptides shown in Table 6 below were synthesized and their antibacterial activity against Pseudomonas aeruginosa and Staphylococcus aureus was measured using the minimum bacterial sterilization concentration measurement method.
  • the method for measuring the minimum bacterial sterilization concentration was the same as the method in Example 2 above.
  • antibacterial peptides consisting of a transmembrane peptide domain and basic or polar amino acids at both ends were also found to have antibacterial activity.
  • Example 8 Confirmation of antibacterial activity of a peptide synthesized by fusing the membrane penetrating domain of two or more different antibacterial peptides and the N-terminal and C-terminal sequences at both ends of the domain.
  • the present inventors produced the transmembrane domain of SEQ ID NO: 5 and 60 of the antibacterial peptide of the previous example by fusing the amino acid sequence (KAK---KLK) at both ends of the domain of SEQ ID NO: 40, and then administered it to Pseudomonas aeruginosa and Staphylococcus aureus.
  • Antibacterial activity was measured using the minimum bacterial sterilization concentration measurement method.
  • the method for measuring the minimum bacterial sterilization concentration was the same as the method in Example 2 above.
  • transmembrane domains of SEQ ID NOs: 5 and 60 do not have antibacterial activity per se, but that a new fusion peptide consisting of these transmembrane domains and four basic amino acids at each end exhibits excellent antibacterial activity (SEQ ID NO: 71, 72).
  • transmembrane domain Protein name of transmembrane domain Peptide sequence (transmembrane domain/amino acid number) MBC value ( ⁇ g/ml)
  • transmembrane domain amino acid number Pseudomonas aeruginosa Staphylococcus aureus K+R hydrophilic amino acids 71 HI2-m1 Q9BW72 HIG1 domain family member 2A, mitochondrial-Human KAK IAAQGFTVAAILLGLAVTAMK KLK (27) 3 12 4 0 72 NDn-1-m1 O95298 NADH dehydrogenase [ubiquinone] 1 subunit C2 KAK GLHRQLLYITAFFFAGYYLV KLK (26) 13 25 4 0

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Plant Pathology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Agronomy & Crop Science (AREA)
  • Pest Control & Pesticides (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Dentistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Environmental Sciences (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단에 일반식 I의 폴리펩타이드가 결합된 융합 폴리펩타이드로서 상기 융합 폴리펩타이드는 그람 양성, 그람 음성, 및 다제내성 박테리아에 대한 항균 활성을 제공할 수 있다.

Description

막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체
본 발명은 세포에서 세포막과 세포 내 소기관 막에 위치하는 막 단백질에서 막을 관통하는 펩타이드 도메인(transmembrane domain)과 이 도메인 양 끝에 염기성 또는 극성(비전하) 아미노산으로 이루어진 항균 펩타이드에 관한 것으로서, 구체적으로 이러한 특징을 갖는 자연계에 존재하는 펩타이드와 인위적으로 합성한 다양한 펩타이드가 그람 양성, 그람 음성, 및 다제내성 박테리아에 대한 항균 활성을 확인하여 상기 각 펩타이드와 각 펩타이드를 포함하는 항균용 조성물 등을 제공하는 것이다.
박테리아 감염에 대한 치료 수단으로 사용되고 있는 항생제의 가장 큰 문제점은 박테리아의 항생제 내성 획득이다. 영국정부의 웰컴트러스트 보고서에 의하면 2050년에는 기존 항생제로 치료할 수 없는 슈퍼박테리아에 의해 세계적으로 사망자 수가 1,000만 명을 초과하여, 사망 원인에 있어서 슈퍼박테리아 감염이 암을 추월하는 위협이 될 것으로 전망된다.
또한, 세계보건기구(WHO)는 수많은 다제내성균에서 위급 단계(critical priority)에는 있는 박테리아로는 카바페넴 내성 아시네토박터균(carbapenem-resistant Acinetobacter baumannii), 카바페넴 내성 녹농균(carbapenem-resistant Pseudomonas aeruginosa), 및 카바페넴 내성 장내세균 속(carbapenem-resistant Enterobacteriaceae sp.) 균종을 선정하고, 최후의 항생제로 알려진 카바페넴계 항생제에 내성을 보이는 그람 음성 슈퍼박테리아를 최우선으로 해결해야 한다고 발표하였다.
상술한 바와 같이, 현재까지 인류가 사용하고 있는 항생제의 가장 큰 문제점은 박테리아의 내성 획득이고, 이를 해결하기 위한 많은 연구가 진행되고 있으며, 특히 박테리아의 항생제 내성 획득을 극복하기 위해 항균 펩타이드(antimicrobial peptide, AMP)의 개발이 활발하게 진행되고 있다. 동물 또는 인간의 방어 단백질(host defense protein) 유래의 다양한 항균 펩타이드가 개발되었으나, 인체 면역 체계에 대한 박테리아의 내성 획득의 가능성이 있고, 혈액 내에서 짧은 반감기와 인체에 나타내는 독성의 문제 및 기존 항생제와 비교하여 제한적인 약효를 나타내는 등의 문제가 있어 실용화되지 못하고 있는 실정이다. 일례로, 마개닌(magainin)는 1999년 미국에서 개발된 항균 펩타이드로 임상 3상 이후 FDA 승인을 요청하였으나 그 약효가 종래 항생제와 비교하여 우수하지 못해 승인이 거부되었다. 또한, 2003 년에 답토마이신(daptomycin), 2014 년에 오리타반신(oritavancin)이 미국 식약처에서 승인을 받았으나, 두개의 펩타이드 모두 그람 양성균에서만 항균 활성을 나타내었으며, 피부 감염 질환에만 적용될 수 있었다.
이를 해결하기 위하여 본 발명자는 선행발명에서 미토콘드리아 내막에 위치하는 Romo1 단백질의 두 번째 막 관통 도메인을 포함하는 펩타이드(KU-5878, AMPR-11)가 그람 양성, 그람 음성, 및 다제내성 박테리아에서 항균활성을 나타내어 광범위한 세균 감염질환 치료에 적용할 수 있음을 확인하고 특허를 출원하고 논문을 발표하였다. 그렇지만 KU-5878의 경우 막 관통 펩타이드 도메인을 포함하고 있지만, 도메인 양 끝쪽에 염기성 아미노산이 각각 1개씩 포함하기 때문에 항균 활성이 우수하지 못하였다. 본 발명자는 더 진보된 연구로서 막 단백질에서 막을 관통하는 펩타이드 도메인(transmembrane domain)과 이 도메인 양 끝에 합이 3 개 이상의 염기성 아미노산과 일부 극성(비전하) 아미노산으로 이루어진 펩타이드가 선행 발명보다 더 우수한 항균 활성이 있다는 것을 발견하게 되었으며 그람 양성, 그람 음성, 및 다제내성 박테리아에서 항균활성을 나타내어 광범위한 세균 감염질환 치료에 적용할 수 있음을 확인하고 본 발명을 완성하였다.
본 발명이 이루고자 하는 기술적 과제는 세포에서 막을 관통하는 펩타이드 도메인(transmembrane domain)과 이 도메인 양 끝에 합이 3 개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 항균 펩타이드로서(도 1), 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 양 말단의 합이 3 개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공하는 것이다.
또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 포함하는 항생제와 상기 항균 펩타이드를 포함하는 식품 및 사료 첨가제, 화장료 조성물, 생물농약, 및 항균용 의약외품 조성물을 제공하는 것을 목적으로 한다.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당해 기술분야의 통상의 기술자에게 명확하게 이해될 수 있을 것이다.
본 발명의 일 양상은 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 양 말단의 합이 3 개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공한다.
본 발명의 다른 일 양상은 상기 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드를 제공한다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 포함하는 항생제와 식품 및 사료 첨가제, 화장료 조성물, 생물농약, 및 항균용 의약외품 조성물을 제공한다.
본 발명의 펩타이드 및 그 변이체는 기존의 항생물질과 선행발명 펩타이드보다 다양한 종류의 세균에 대해 높은 항생능력을 가진다. 특히, 본 발명의 펩타이드는 항생제 내성을 갖는 박테리아에 대해 높은 항균 능력을 발휘하여 기존 항생제 적용의 한계를 넘어서 다제내성 박테리아에 의한 감염성 질환의 예방 또는 치료제로서 제공될 수 있다. 따라서 본 항균 펩타이드는 광범위한 세균성 감염질환의 예방 또는 치료를 목적으로 의약용, 의약부외용, 식품 및 사료 첨가용, 농약 및 화장품 첨가용 등 다양한 방면으로 이용될 것으로 기대된다.
도 1은 막을 관통하는 트랜스멤브레인 도메인(transmembrane domain, TMD)과 이 도메인 양 끝에 염기성 또는 극성(비전하) 아미노산으로 이루어진 항균 펩타이드의 그림을 제공하는 것이다. 상기 펩타이드가 그람 양성, 그람 음성 및 다제내성 박테리아 세포막에 pore를 형성시켜 박테리아를 살상시킨다는 것을 표시하는 도면이다.
본 발명의 일 양상은 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 합이 3개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공한다.
본 발명의 일 구체예로, 상기 트랜스멤브레인 도메인(transmembrane domain, TMD)은 서열번호 39, 41, 54, 73 내지 78 중 어느 하나일 수 있다.
본 발명의 일 구체예로, 상기 말단 아미노산은 C-말단 및 N-말단 각각에 2 내지 6개의 아미노산이 결합된 것일 수 있다.
본 발명의 일 구체예로, 상기 말단 아미노산은 염기성 아미노산 및 극성 아미노산으로 이루어진 군으로부터 선택되는 것일 수 있다.
본 발명의 일 구체예로, 상기 말단 아미노산은 라이신, 아르기닌, 히스티딘, 세린, 트레오닌 시스테인, 글루타민, 아르파라긴 및 티로신 중 어느 하나일 수 있다.
본 발명의 일 구체예로, 상기융합 폴리펩타이드는 서열번호 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65, 66, 71 및 72 중 어느 하나일 수 있다.
본 발명의 다른 일 양상은 상기 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드를 제공한다.
본 발명의 일 구체예로, 상기 폴리펩타이드는 N-말단 또는 C-말단에 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)을 더 포함하는 것일 수 있다.
본 발명의 일 구체예로, 상기 폴리펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 갖는 것일 수 있다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 유효성분으로 포함하는 항생제, 식품 첨가제, 사료 첨가제, 화장료 조성물, 항균용 생물 농약 제제 및 항균용 의약외품 조성물을 제공한다.
본 발명의 일 양상은 15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 양 말단의 합이 3개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드를 제공한다.
상기 트랜스멤브레인 도메인은 막 관통능을 가진 펩타이드 서열 영역으로서, 막 관통능을 가진 펩타이드는 세포내에 존재하는 소기관의 지질 이중막을 관통하여 존재하는 펩타이드이다. 막 관통 펩타이드에서 지질막을 관통하는 도메인(transmembrane domain, TMD)은 약 22개 정도의 아미노산으로 이루어져 있는데 소수성 아미노산과 일부 친수성 아미노산으로 구성돼 있다. 막 관통 도메인은 하나일 수도 있고 여러 개일 수도 있다.
유전체의 상당 부분이 막 관통 단백질이며 컴퓨터 알고리즘으로 비교적 정확하게 막 관통 부분을 예측할 수 있다. 본 발명에서 막 관통 단백질 서열 정보는 유니프로트(UniProt, www.uniprot.org)에서 확보하였다.
본 발명의 발명자들은 유니프로트에서 검색하여 얻은 정보를 바탕으로 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 다양한 길이의 펩타이드를 합성하여 그 항균활성을 확인하고, 상기 펩타이드의 변이체로부터 항균활성을 확인하여 본 발명을 완성하였다 (실시예 1, 2 참조).
본 발명의 구체적인 실시예에서, 본 발명자들은 상기 서술된 내용과 같이 사람 단백질 중 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 극성 아미노산으로 이루어진 자연계에 존재하는 다양한 길이의 펩타이드를 합성하고, 녹농균 및 황색포도상구균에 대한 각 펩타이드의 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 확인하였다. 그 결과 합성한 펩타이드 모두 기존에 발명한 KU-5878 보다 우수한 항균 활성을 가지는 것을 확인할 수 있었다 (실시예 2 참조).
나아가, 본 발명의 서열번호 1, 2으로 표시되는 펩타이드의 양 끝부분을 일부 결핍시킨 펩타이드를 합성하여 항균 활성을 확인한 결과 항균 활성이 감소됨을 확인하였고, 39와 41로 표시되는 세포막 관통 도메인 양 끝에 염기성 또는 극성 아미노산이 없는 펩타이드는 항균 활성이 없어지는 것을 확인하였기 때문에, 세포막 관통 도메인 양 끝에 염기성 또는 극성 아미노산 서열이 항균 활성에 중요하다는 것을 확인하였다 (실시예 3 참조).
본 발명의 다른 구체적인 실시예에서, 본 발명자들은 세포막 관통 도메인 양 끝에 염기성 아미노산을 인위적으로 반복하여 부착한 합성 펩타이드의 항균 활성을 확인하였다. 그 결과, 세포막 관통 도메인 양쪽에 합이 3개 이상의 라이신(K) 또는 아르기닌(R)을 부착하여 합성한 펩타이드 군이 우수한 항균 활성을 나타냄을 알 수 있었다 (실시예 4 참조).
본 발명의 구체적인 실시예에서, 본 발명자들은 본 발명의 융합 폴리펩타이드가 엔테로코커스 패시움, 대장균, 아시네토박터 바우마니, 다제내성 녹농균, 다제내성 포도상구균, 다제내성 엔테로코커스 패시움 및 다제내성 아시네토박터 바우마니에 대한 상기 펩타이드의 항균 활성을 확인하였다. 그 결과 대표 펩타이드 모두는 그람 양성균, 그람 음성균, 및 다제내성 박테리아 모두에게서 광범위한 항균 활성을 나타냄을 알 수 있었다 (실시예 5, 6 참조).
또한, 본 발명의 다른 구체적인 실시예에서, 본 발명자들은 인간 외의 다른 종의 막 관통 도메인과 도메인 양 끝에 합이 3개 이상의 염기성 아미노산과 극성 아미노산으로 이루어진 펩타이드를 합성하여 항균 활성을 확인하였고, 그 결과 종에 상관없이 공통된 특징을 가진 상기 펩타이드에서 항균 활성을 나타낸다는 것을 알 수 있었다 (실시예 7 참조).
또한, 본 발명의 다른 구체적인 실시예에서, 본 발명자들은 양 말단에 결합된 아미노산 서열을 다른 막 관통 펩타이드에 결합시키더라도 우수한 항균 활성을 나타내는 것을 확인하였다 (실시예 8 참조).
본 명세서에서 “펩타이드”는 펩타이드 결합에 의해 아미노산 잔기들이 서로 결합되어 형성된 선형의 분자를 의미한다. 당 업계에 공지된 화학적 합성 방법, 특히 고상 합성 기술 또는 액상 합성 기술에 따라 제조될 수 있다.
본 발명의 일 구체예로, 상기 트랜스멤브레인 도메인은 17 내지 25개 아미노산으로 구성되는 것일 수 있으며, 더욱 구체적으로는 서열번호 39, 41, 54, 73 내지 78 중 어느 하나일 수 있다.
상기 말단 아미노산은 막 관통 펩타이드 도메인의 C-말단 및 N-말단에 결합되는 것으로 각각의 말단에 하나 이상, 합이 3 개 이상의 아미노산, 구체적으로, C-말단 및 N-말단 각각에 3 내지 6개의 아미노산이 포함되어, 최소 1개에서 최대 6개의 아미노산이 양 말단에 결합되는 것일 수 있다.
상기 말단 아미노산은 염기성 아미노산 및 극성 아미노산들에서 선택되는 것으로, 상기 말단 아미노산은 라이신, 아르기닌, 히스티딘, 세린, 트레오닌 시스테인, 글루타민, 아르파라긴 및 티로신 중 어느 하나일 수 있다.
이 때 C-말단 및 N-말단에 결합되는 말단 아미노산은 양 말단에 각각 1개 이상, 양 말단의 아미노산 개수의 합이 3개 이상이면 족하고, 각각의 아미노산은 서로 독립적이며, C-말단 및 N-말단에 결합되는 펩타이드가 서로 다른 아미노산 구성, 서로 다른 길이여도 본 발명에 포함된다. 상기 말단 아미노산의 일 예시로 트랜스멤브레인 도메인의 일 말단에 1개의 아미노산이 결합되고, 타 말단에 2개 이상의 아미노산이 결합되는 구성일 수 있다.
본 발명의 일 구체예로, 상기 융합 폴리펩타이드는 서열번호 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65, 66, 71 및 72 중 어느 하나일 수 있다.
본 발명의 또 다른 구현예로서, 상기 폴리펩타이드는 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)일 수 있고, 더욱 구체적으로 아미노 말단은 아세틸기, 플루오레닐 메톡시 카르보닐기, 포르밀기, 팔미토일기, 미리스틸기, 스테아릴기 및 폴리에틸렌글리콜(PEG) 등의 보호기가 결합될 수 있으며, 펩타이드의 카르복시 말단은 히드록시기(-OH), 아미노기(-NH2), 아자이드(-NHNH2) 등으로 변형될 수 있다. 또한 본 발명의 펩타이드의 말단 또는 아미노산의 R-잔기(R-group)에 지방산(fatty acids), 당사슬(oligosaccharides chains), 모든 나노입자(골드입자, 리포솜, 헤파린, 하이드로젤 등), 아미노산, 담체 단백질(carrier proteins) 등을 결합할 수 있다.
본 발명의 또 다른 구현예로서, 상기 펩타이드를 구성하는 아미노산은 각각 독립적으로 L-형 또는 D-형의 아미노산일 수 있으며, 방사선 또는 형광 라벨된 아미노산 유사체일 수 있다.
본 발명의 또 다른 구현예로서, 상기 펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 가질 수 있다.
본 발명의 다른 일 양상은 상기 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드를 제공한다.
전술한 바와 같이 상기 융합 폴리펩타이드는 막 관통 펩타이드 도메인과 양 말단에 아미노산 잔기를 더 포함하여 세포막을 관통, 세균을 용출 시켜 항균 효과를 가길 수 있으므로, 본 발명은 상기 융합 폴리펩타이드를 포함하는 항균 능을 가진 폴리펩타이드를 제공할 수 있다.
본 발명의 일 구체예로, 상기 폴리펩타이드는 N-말단 또는 C-말단에 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)을 더 포함하는 것일 수 있고, 더욱 구체적으로 아미노 말단은 아세틸기, 플루오레닐 메톡시 카르보닐기, 포르밀기, 팔미토일기, 미리스틸기, 스테아릴기 및 폴리에틸렌글리콜(PEG) 등의 보호기가 결합될 수 있으며, 펩타이드의 카르복시 말단은 히드록시기(-OH), 아미노기(-NH2), 아자이드(-NHNH2) 등으로 변형될 수 있다. 또한 본 발명의 펩타이드의 말단 또는 아미노산의 R-잔기(R-group)에 지방산(fatty acids), 당사슬(oligosaccharides chains), 모든 나노입자(골드입자, 리포솜, 헤파린, 하이드로젤 등), 아미노산, 담체 단백질(carrier proteins) 등을 결합할 수 있다.
본 발명의 일 구체예로, 상기 폴리펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 갖는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 그람 양성균은 포도상구균 속(Staphylococcus sp.), 간균 속(Bacillus sp.), 엔테로코커스 속(Enterococcus sp.), 스트렙토마이세스 속(Streptomyces sp.), 및 스트렙토코커스 속(Streptococcus sp.)으로 이루어진 군으로부터 선택되는 하나의 속(Genus)에 속하는 세균일 수 있으며, 바람직하게 상기 그람 양성균은 황색포도상구균(Staphylococcus aureus), 고초균(Bacillus subtilis), 엔테로코커스 패시움(Enterococcus faecium), 스트렙토마이세스 신데넨시스(Streptomyces sindenensis), 엔테로코커스 패칼리스(Enterococcus faecalis), 및 스트렙토코커스 뉴모니아(Streptococcus pneumoniae)로 이루어진 군으로부터 선택되는 하나 이상의 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 그람 음성균은 대장균 속(Escherichia sp.), 클렙시엘라 속(Klebsiella sp.), 아시네토박터 속(Acinetobacter sp.), 수도모나스 속(Pseudomonas sp.), 및 엔테로박터 속(Enterobacter sp.)으로 이루어진 군으로부터 선택되는 하나의 속(Genus)에 속하는 세균일 수 있으며, 바람직하게 상기 그람 음성균은 대장균(Escherichia coli), 클렙시엘라 뉴모니아(Klebsiella pneumoniae), 아시네토박터 바우마니(Acinetobacter baumannii), 녹농균(Pseudomonas aeruginosa), 및 엔테로박터 에어로게네스(Enterobacter aerogenes)로 이루어진 군으로부터 선택되는 하나 이상의 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 다제내성균은 페니실린계(penicillins), 카바페넴계(carbapenems), 세팔로스포린계(cephalosporins), 퀴놀론계(quinolones), 마크로라이드계(macrolides), 테트라사이클린계(tetracyclins), 또는 글리코펩티드계(glycopeptides)에 속하는 1종 이상의 항생물질에 대한 내성을 갖는 상기 그람 양성균 또는 그람 음성균으로서, 바람직하게 상기 다제내성균은 메티실린 내성 포도상구균(methicillin-resistant Staphylococcus sp.), 다제내성 수도모나스 속(multidrug-resistant Pseudomonas sp.), 반코마이신 내성 엔테로코커스 속(vancomycin-resistant Enterococcus sp.), 다제내성 클렙시엘라 속(multidrug-resistant Klebsiella sp.), 다제내성 아시네토박터 속(multidrug-resistant Acinetobacter sp.), 및 반코마이신 내성 포도상구균(vancomycin-resistant Staphylococcus sp.)으로 이루어진 군으로부터 선택되는 하나의 속(Genus)에 속하는 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 다제내성균은 메티실린 내성 황색포도상구균(methicillin-resistant S. aureus), 다제내성 녹농균(multidrug-resistant P. aeruginosa), 다제내성 아시네토박터 바우마니(multidrug-resistant A. baumannii), 다제내성 클렙시엘라 뉴모니아(multidrug-resistant K. pneumoniae), 반코마이신 내성 엔테로코커스 패시움(vancomycin-resistant E. faecium), 및 반코마이신 내성 황색포도상구균(vancomycin-resistant S. aureus)로 이루어진 군으로부터 선택되는 하나 이상의 세균일 수 있다.
본 발명의 또 다른 구현예로서, 상기 다제내성 녹농균은 피페라실린(piperacilin), 피페라실린타조박탐(piperacilin-tazobactam), 세프타지딤(ceftazidime), 이미페넴(imipenem), 메로페넴(meropenem), 젠타마이신(gentamicin), 아미카신(amikacin), 및 시프로플록사신(ciprofloxacin)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 갖는 것일 수 있으며, 상기 다제내성 아시네토박터 바우마니는 피페라실린, 피페라실린타조박탐, 세프타지딤, 이미페넴, 메로페넴, 젠타마이신, 아미카신, 시프로플록사신, 및 세페핌(cefepime)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 갖는 것일 수 있고, 상기 다제내성 클렙시엘라 뉴모니아는 피페라실린타조박탐, 세프타지딤, 세페핌, 이미페넴, 젠타마이신, 및 시프로플록사신으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 갖는 것일 수 있다.
본 발명의 또 다른 구현예로서, 상기 반코마이신 내성 엔테로코커스 패시움은 반코마이신 외에도 리팜핀(rifampin), 테트라사이클린, 젠타마이신, 에리트로마이신(erythromycin), 스트렙토마이신(streptomycin), 및 암피실린(ampicillin)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 추가로 갖는 것일 수 있으며, 상기 반코마이신 내성 황색포도상구균은 반코마이신 외에도 옥사실린(oxacillin), 벤질페니실린(benzylpenicillin), 암피실린 및 세파졸린(cefazolin)으로 이루어진 군으로부터 선택되는 1종 이상의 항생제에 대한 내성을 추가로 갖는 것일 수 있다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 유효성분으로 포함하는 항생제를 제공한다.
또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 포함하는 세균성 감염 질환 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명에서 "예방"이란 본 발명에 따른 약학적 조성물의 투여에 의해 상기 그람 양성균, 그람 음성성균, 및/또는 다제내성 세균의 감염을 지연시키거나, 그 감염에 의한 질병의 발병을 지연시키는 모든 행위를 의미하고, "치료"란 본 발명에 따른 약학적 조성물의 투여에 의해 상기 세균 감염에 따른 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
본 발명에서 약학적 조성물(pharmaceutical composition)은 상기 융합 폴리펩타이드 또는 항균 폴리펩타이드 외에 공지의 항생물질을 1종 이상 더 포함할 수 있으며, 약학적 조성물의 제조에 통상적으로 사용되는 적절한 담체, 부형제, 및 희석제를 더 포함할 수 있다.
본 발명에서 "담체(carrier)"란 비이클(vehicle)이라고도 불리우며, 세포 또는 조직 내로의 단백질 또는 펩타이드의 부가를 용이하게 하는 화합물을 의미하는 것으로서, 예를 들어, 디메틸술폭사이드(DMSO)는 생물체의 세포 또는 조직 내로의 많은 유기물의 투입을 용이하게 하는 통상 사용되는 담체이다.
본 발명에서 "희석제(diluent)"란 대상 단백질 또는 펩타이드의 생물학적 활성 형태를 안정화시킬 뿐만 아니라, 단백질 또는 펩타이드를 용해시키게 되는 물에서 희석되는 화합물로 정의된다. 버퍼 용액에 용해되어 있는 염은 당해 분야에서 희석제로 사용된다. 통상 사용되는 버퍼 용액은 포스페이트 버퍼 식염수이며, 이는 인간 용액의 염 상태를 모방하고 있기 때문이다. 버퍼 염은 낮은 농도에서 용액의 pH를 제어할 수 있기 때문에, 버퍼 희석제가 화합물의 생물학적 활성을 변형하는 일은 드물다. 여기에 사용된 아젤라산을 함유하는 화합물들은 인간 환자에게 그 자체로서, 또는 결합 요법에서와 같이 다른 성분들과 함께 또는 적당한 담체나 부형제와 함께 혼합된 약학적 조성물로서, 투여될 수 있다.
또한, 본 발명에 따른 약학적 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 외용제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있으며, 본 발명의 약학적 조성물은 목적하는 방법에 따라 경구 투여하거나 비경구 투여(예를 들어, 정맥 내, 피하, 복강 내 또는 국소에 적용)할 수 있으며, 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있으며, 예를 들어, 약학적으로 허용가능한 담체와 혼합된 형태로 약 0.001mg 내지 1000mg이 투여될 수 있다. 본 발명의 약학적 조성물은 필요에 따라 일일 1회 내지 수회로 나누어 투여할 수 있으며, 단독으로, 또는 수술, 호르몬 치료, 약물 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
또한, 본 발명은 상기 항균 펩타이드를 개체에 투여하는 단계를 포함하는 세균성 감염 질환 예방 또는 치료 방법을 제공한다.
또한, 본 발명은 세균성 감염 질환 예방 또는 치료용 약제의 제조를 위한 상기 항균 펩타이드의 용도를 제공한다.
본 발명의 일 구현예로서, 상기 세균성 감염 질환은 피부감염, 식중독, 중이염, 방광염, 복막염, 요로감염, 유방염, 폐렴, 심내막염, 결막염, 관절염, 자궁내막염, 선역, 균혈증, 패혈증, 골수염 및 여드름으로 이루어진 군으로부터 선택되는 하나 이상의 질병일 수 있고, 바람직하게는 폐렴 또는 패혈증일 수 있다.
본 발명의 다른 일 양상은 상기 폴리펩타이드를 포함하는 식품 첨가제, 사료 첨가제, 화장료 조성물, 항균용 생물 농약 제제 및 항균용 의약외품 조성물을 제공한다.
본 발명의 펩타이드를 식품 또는 사료의 첨가물 등으로 사용할 경우, 상기 펩타이드를 그대로 첨가하거나 다른 식품, 사료, 또는 그 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효성분의 혼합양은 사용 목적(세균의 증식 및 생장 억제를 통한 감염성 질환의 예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다. 일반적으로, 사료, 식품 또는 음료의 제조 시 본 발명의 펩타이드 원료에 대하여 15중량% 이하, 바람직하게는 10 중량% 이하의 양으로 첨가된다. 그러나, 건강 및 위생을 목적으로 하거나 또는 건강 조절을 목적으로 하는 장기간의 섭취의 경우 상기 양은 상기 범위 이하일 수 있으며, 안전성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다. 상기 식품 및 사료의 종류에는 특별한 제한은 없다.
본 발명은 다양한 변환을 가할 수 있고 여러 가지 실시예를 가질 수 있는 바, 이하 특정 실시예들을 도면에 예시하고 상세한 설명에 상세하게 설명하고자 한다. 그러나, 이는 본 발명을 특정한 실시 형태에 대해 한정하려는 것이 아니며, 본 발명의 사상 및 기술 범위에 포함되는 모든 변환, 균등물 내지 대체물을 포함하는 것으로 이해되어야 한다. 본 발명을 설명함에 있어서 관련된 공지 기술에 대한 구체적인 설명이 본 발명의 요지를 흐릴 수 있다고 판단되는 경우 그 상세한 설명을 생략한다.
[실시예]
실시예 1. 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드 탐색
본 발명에서 막 관통 단백질 서열 정보는 단백질의 서열 및 기능에 대한 정보가 들어 있는 유니프로트(UniProt, www.uniprot.org)에서 탐색하였다. 유니프로트 홈페이지에 접속하여 proteins UniProt knowledgesbase를 접속한 후 reviewed (Swiss-Prot)에 접속한다. 이어서 proteins with transmembrane에 접속하면 79,724 단백질이 검색이 된다. 인간 단백질의 경우 20,422 단백질이 검색이 되고 이 중 막 관통 단백질은 5,217 단백질이 검색이 된다. 각각의 막 관통 단백질에 접속하면 각각의 단백질 정보를 확인이 가능하며 동시에 막 관통 펩타이드 도메인의 펩타이드 서열의 확인이 가능하다. 본 발명자는 우선 5,217의 막 관통 단백질에서 막 관통 도메인과 그 주변 서열을 탐색하였고 이 중 도 1과 유사한 구조를 갖는 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드를 합성하였다 (표 1).
실시예 2. UniProt에서 탐색한 펩타이드의 항균 활성 확인
본 발명자는 UniProt에서 탐색한 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 36종을 합성하고, 박테리아 살균 최소 농도 측정법 (minimum bactericidal concentration: MBC)을 이용하여 각 펩타이드의 항균 활성을 확인하였다 (각 펩타이드의 정보는 하기 표 1 참조). 상기 각 펩타이드의 박테리아 살균 최소 농도 측정법을 이용한 항균 활성 확인은 구체적으로 하기와 같이 수행되었다.
먼저, 녹농균 (ATCC 27853)과 황색포도상구균 (NCCP 15872)를 LB (1% tryptone, 0.5% yeast extract, 1% sodium chloride) 액체 배지 또는 3%(w/v) TSB (Tryptic Soy Broth) 액체 배지에 37℃, 200 rpm 조건으로 overnight 배양한 후, 다시 동일한 조건에서 2 시간 동안 2차 배양하였다. 상기 2차 배양한 각 균주의 최종 농도가 5×105 CFU/㎖ 농도가 되도록 10 mM sodium phosphate 용액으로 희석하여 균주 용액을 준비하였다.
이어서, 96-웰 마이크로 플레이트의 각 웰에 농도를 달리하여 (최종 농도: 0 ㎍/㎖ - 200 ㎍/㎖ 펩타이드) 각 펩타이드를 100 ㎕ 씩 분주하고, 상기 준비된 균주 용액을 100 ㎕ 를 넣고 섞어 37℃ 항온기에서 1 시간 동안 반응시켰다.
그리고, LB 25 g/L 또는 TS (Tryptic Soy) 30 g/L 와 한천 15 g/L을 증류수에 녹이고 멸균한 다음 100 ㎜ 원형 플레이트에 20 ㎖을 붓고 하루 이상 실온에서 굳혀서 제조한 LB 또는 TS 한천 플레이트에 상기 펩타이드와 균주의 반응 용액을 10 ㎕씩 일정한 크기로 도말하고, 37℃ 항온기에서 18 시간 동안 배양한 뒤, 플레이트에서 콜로니 생성을 확인하였다. 박테리아 살균 최소농도는 콜로니가 단 하나도 생성되지 않은 펩타이드의 최소 농도로 정의하였고, 실험 결과는 하기 표 1과 같다.
SEQ.No 펩타이드명 UniPort entry 단백질 이름 유전자이름 총 아미노산 수/항균 펩타이드 위치 펩타이드 서열(막 관통 도메인/아미노산 수) 세포내 위치 MBC 값
(μg/ml)		 막 관통 도메인 양 끝
아미노산 수
녹농균 황색포도상구균 K+R 친수성 아미노산
1 COX20-1 Q5RI15 Cytochrome c oxidase assembly protein COX20, mitochondrial-Human COX20 118/31-57 RHSILYGSLGSVVAGFGHFLFTSRIRR(34-51/27) 미토콘드리아막 4 10 4 4
2 HIG1A-1 Q9Y241 HIG1 domain family member 1A, mitochondrial-Human HIG1A 93/22-51 RKAKEAPFVPVGIAGFAAIVAYGLYKLKSR(26-46/30) 미토콘드리아막 3 11 6 1
3 PIRT P0C851 Phosphoinositide-interacting protein-Human PIRT 131/84-123 KSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQK(94-114/40) 세포막 2 10 8 5
4 HIG1C A8MV81 HIG1 domain family member 1C-Human HIG1C 97/21-51 RKSRDSPFVPIGIAGFVTVVSCGLYKLKYRR(27-47/31) 미토콘드리아막 2 9 6 2
5 HIG2A-1 Q9BW72 HIG1 domain family member 2A, mitochondrial-Human HIG2A 106/81-105 TRIAAQGFTVAAILLGLAVTAMKSR(83-103/25) 미토콘드리아막 11 20 2 2
6 PAPPA Q5QFB9 Protein PAPPAS-Human PAPPA-AS1 102/7-38 RKKHRGLFLTTVAALPIWNPISEFVKWYKSHK(13-33/32) ER막 7 20 6 3
7 PLGRKT-1 Q9HBL7 Plasminogen receptor-Human PLGRKT 147/50-76 SREFLKYFGTFFGLAAISLTAGAIKKK(53-73/27) 세포 막 7 80 4 1
8 PGAP6 Q9HCN3 Post-GPI attachment to proteins factor 6-Human PGAP6 771/543-568 QQRAATLLLTLSNLMFLAPIAVSVRR(546-566/26) 세포막, 리소좀막 6 50 3 2
9 OPA1-1 O60313 Dynamin-like 120 kDa protein, mitochondrial-Human OPA1 960/92-118 RLATRLLKLRYLILGSAVGGGYTAKKT (97-113/27) 미토콘드리아막 1 4 4 3
10 TOMM20 Q15388 Mitochondrial import receptor subunit TOM20 homolog-Human TOMM20 145/4-30) RNSAIAAGVCGALFIGYCIYFDRKRRS(7-24/27) 미토콘드리아막 20 35 5 3
11 SLC25A19 Q9HC21 Mitochondrial thiamine pyrophosphate carrier-Human SLC25A19 320(212-243) KKNENLQNLLCGSGAGVISKTLTYPLDLFKKR(220-240/32) 미토콘드리아막 5 30 5 4
12 VKORL Q8N0U8 Vitamin K epoxide reductase complex subunit 1-like protein 1-Human VKORC1L1 176(13-42) RWERVARYAVCAAGILLSIYAYHVEREKER (17-37/30) ER막 30 25 5 0
13 YME1L1 Q96TA2 ATP-dependent zinc metalloprotease YME1L1-Human YME1L1 773(291-322) RRTRLILFVLLLFGIYGLLKNPFLSVRFRTTT(296-316/32) 미토콘드리아막 6 18 5 4
14 SLC22A14 Q9Y267 Solute carrier family 22 member 14-Human SLC22A14 594(181-210) TKKDTAQIMFMAGLPIGSLIFRLITDKMGR (185-205/30) 미토콘드리아막 10 20 4 1
15 SCO2 O43819 Protein SCO2 homolog, mitochondrial-Human SCO2 266(58-82) RTRLLITGLFGAGLGGAWLALRAEK (61-78/25) 미토콘드리아막 16 25 4 1
16 ABCB8 Q9NUT2 Mitochondrial potassium channel ATP-binding subunit-Human ABCB8 735(291-322) STRLTLLLMVATPALMGVGTLMGSGLRKLSRQ(296-316/32) 미토콘드리아막 25 25 4 5
17 UXS1 Q8NBZ7 UDP-glucuronic acid decarboxylase 1-Human UXS1 420(15-44) RRRMKLLLGIALLAYVASVWGNFVNMRSIQ(20-40/30) 골지체막 24 25 5 2
18 TOMM20L Q6UXN7 TOMM20-like protein 1 TOMM20L 152(5-34) RSLLRLLAAAAACGAFAFLGYCIYLNRKRR(10-29/30) 미토콘드리아막 16 10 6 2
19 CNR1 P21554 Cannabinoid receptor 1 CNR1 472(373-405) KLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLR(378-399/33) 미토콘드리아막, 세포막 12 24 5 2
20 ARMCX3 Q9UH62 Armadillo repeat-containing X-linked protein 3 ARMCX3 379(5-35) RKVGWVTAGLVIGAGACYCIYRLTRGRKQNK(7-29/31) 미토콘드리아막 10 22 5 2
21 GDAP1-1 Q8TB36 Ganglioside-induced differentiation-associated protein 1 GDAP1 358(285-318) KRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPK(292-312/34) 미토콘드리아막 1 4 8 2
22 GDAP1-2 Q8TB36 Ganglioside-induced differentiation-associated protein 1 GDAP1 358(313-343) KKRAPKVLGTTLVVGLLAGVGYFAFMLFRKR(320-340/31) 미토콘드리아막 4 6 7 0
23 GPAT2 Q6NUI2 Glycerol-3-phosphate acyltransferase 2, mitochondrial GPAT2 795(444-476) RRLSCHVLSASVGSSAVMSTAIMATLLLFKHQK(450-472/33) 미토콘드리아막 4 13 4 5
24 CDS2 O95674 Phosphatidatecytidylyltransferase 2 CDS2 445(160-191) TM3.RILSKYHRFISFTLYLIGFCMFVLSLVKKHYR(166-186/32) ER 막 50 45 5 2
25 BCL2L1 Q07817 Bcl-2-like protein 1 BCL2L1 233(204-233) RKGQERFNRWFLTGMTVAGVVLLGSLFSRK(210-22630) 미토콘드리아막 4 6 5 3
26 ATP5MK Q96IX5 ATP synthase membrane subunit K, mitochondrial ATP5MK 58(16-51) KKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKK(23-45/36) 미토콘드리아막 80 80 6 3
27 CEBPZOS A8MTT3 Protein CEBPZOS CEBPZOS 80(10-38) KKIFKGVLVAELVGVFGAYFLFSKMHTSQ(15-32/29) 미토콘드리아막 7 40 4 4
28 EXD2 Q9NVH0 Exonuclease 3'-5' domain-containing protein 2 EXD2 621(2-32) SRQNLVALTVTTLLGVAVGGFVLWKGIQRRR(5-25/31) 미토콘드리아막 14 70 5 3
29 MIGA1 Q8NAN2 Mitoguardin 1 MIGA1 632(64-96) SQIKFSPVAKKLFVVTAVSAISVIFLAHFKRKR(70-90/33) 미토콘드리아막 5 7 5 4
30 RHOT1 Q8IXI2 Mitochondrial Rho GTPase 1 RHOT1 618(588-618) KSSTFWLRASFGATVFAVLGFAMYKALLKQR(593-615/31) 미토콘드리아막 8 5 3 4
31 MTX1 Q13505 Metaxin-1 MTX1 466(416-445) RRRNQILSVLAGLAAMVGYALLSGIVSIQR(421-441/30) 미토콘드리아막 12 10 4 4
32 NDUFA13 Q9P0J0 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 NDUFA13 144(27-58) RRGLSGYSMLAIGIGTLIYGHWSIMKWNRERR(30-51/32) 미토콘드리아막 16 4 6 1
33 SPNS1 Q9H2V7 Protein spinster homolog 1 SPNS1 528(183-210 QRSRMLSIFYFAIPVGSGLGYIAGSKVK(187-207/28) 미토콘드리아막 4 20 4 2
34 SLC25A44 Q96H78 Solute carrier family 25 member 44 SLC25A44 314(17-49) KKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQK(20-42/33) 미토콘드리아막 8 3 5 3
35 TMEM14A Q9Y6G1 Transmembrane protein 14A TMEM14A 99(21-51) KRRGGVPSLIAGLFVGCLAGYGAYRVSNDKR(24-44/31) 미토콘드리아막 4 8 6 2
36 IFI6 P09912 Interferon alpha-inducible protein 6 IFI6 130(2-27) RQKAVSLFLCYLLLFTCSGVEAGKKK (4-24/26) 미토콘드리아막 12 50 4 1
(밑줄: 막 관통 도메인 아미노산 서열)
상기 표 1에 나타낸 바와 같이, UniProt에서 탐색한 막 관통 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 36종은 우수한 항균 활성을 가짐을 확인할 수 있었다. 본 발명자는 선행연구에서 Romo1 단백질의 두 번째 막 관통 도메인을 포함하는 펩타이드가 항균 활성을 가지고 있다는 것을 발명하였고 연속된 연구에서 21개의 아미노산 잔기로 구성되어 있는 KU-5878 펩타이드의 항균활성이 가장 우수하다는 것을 발명하였다(녹농균 MBC 값: 100 μg/ml; 황색포도상구균 MBC 값: 100 μg/ml). 본 발명에서 발견한 펩타이드는 KU-5878보다 녹농균의 경우 1.25~100배, 황색포도상구균의 경우 1.25~25배 우수한 항균 활성을 가짐을 확인할 수 있었다.
실시예 3. UniProt에서 탐색한 펩타이드에서 막 관통 도메인 양 끝의 일부 아미노산이 결핍된 펩타이드의 항균 활성 확인
UniProt에서 탐색한 펩타이드에서 막 관통 도메인 양 끝 부분이 일부 결핍된 펩타이드의 항균 활성 확인하기 위하여 상기 표 1에 나타낸 합성 펩타이드 중 COX20-1 펩타이드를 대표로 선정하여 녹농균과 황색포도상구균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다. COX20-1 펩타이드의 양끝에서 일부 아미노산이 결핍된 아미노산 서열을 포함하는 3종의 펩타이드 (서열번호 37, 38, 39)를 합성하여 박테리아 살균 최소 농도 측정법을 통해 각 펩타이드의 항균 활성을 비교 확인하였다 (각 펩타이드의 정보는 하기 표 2 참조). 동일한 실험으로 HIG1A-1 펩타이드의 양끝에서 일부 아미노산이 결핍된 아미노산 서열을 포함하는 2종의 펩타이드 (서열번호 40, 41)를 합성하여 박테리아 살균 최소 농도 측정법을 통해 각 펩타이드의 항균 활성을 비교 확인하였다 (각 펩타이드의 정보는 하기 표 2 참조).
SEQ.No 펩타이드 이름 UniPort entry 단백질 이름 유전자이름 총 아미노산 수/항균 펩타이드 위치 펩타이드 서열(막 관통 도메인/아미노산 수) 세포내 위치 MBC 값
(μg/ml)		 막 관통 도메인 양 끝
아미노산 수
녹농균 황색포도상구균 K+R 친수성 아미노산
1 COX20-1 Q5RI15 Cytochrome c oxidase assembly protein COX20, mitochondrial-Human COX20 118/31-57 RHSILYGSLGSVVAGFGHFLFTSRIRR(34-51/27) 미토콘드리아막 4 10 4 4
37 COX20-2 Q5RI15 Cytochrome c oxidase assembly protein COX20, mitochondrial-Human COX20 118/33-57 SILYGSLGSVVAGFGHFLFTSRIRR(34-51/25) 미토콘드리아막 30 55 3 3
38 COX20-3 Q5RI15 Cytochrome c oxidase assembly protein COX20, mitochondrial-Human COX20 118/31-54 RHSILYGSLGSVVAGFGHFLFTSR(34-51/24) 미토콘드리아막 25 200< 2 4
39 COX20-0 Q5RI15 Cytochrome c oxidase assembly protein COX20, mitochondrial-Human COX20 118/34-51 ILYGSLGSVVAGFGHFLF(34-51/18) 미토콘드리아막 200< 200< 0 0
2 HIG1A-1 Q9Y241 HIG1 domain family member 1A, mitochondrial-Human HIG1A 93/22-51 RKAKEAPFVPVGIAGFAAIVAYGLYKLKSR(26-46/30) 미토콘드리아막 3 11 6 1
40 HIG1A-2 Q9Y241 HIG1 domain family member 1A, mitochondrial-Human HIG1A 93/23-49 KAKEAPFVPVGIAGFAAIVAYGLYKLK(26-46/27) 미토콘드리아막 11 200< 4 0
41 HIG1A-0 Q9Y241 HIG1 domain family member 1A, mitochondrial-Human HIG1A 93/26-46 EAPFVPVGIAGFAAIVAYGLY(26-46/21) 미토콘드리아막 200< 200< 0 0
상기 표 2에 나타낸 바와 같이, 막 관통 도메인 양 끝의 일부 아미노산을 결핍할 경우 펩타이드의 항균 활성이 처음 항균 활성을 나타냈던 펩타이드 (서열번호 1 또는 2)에 비해 감소하는 것을 확인하였고, 특히 세포막 관통 펩타이드 도메인 양 끝에 염기성 또는 극성 아미노산이 없는 펩타이드는 항균 활성이 낮아서 박테리아 살균 최소 농도 측정법을 이용하여 측정이 불가능하였다(서열번호 39, 41). 따라서 막 관통 도메인 양 끝의 염기성 아미노산과 극성 아미노산 서열이 항균 활성에 영향을 준다는 것을 알 수 있다.
실시예 4. 막 관통 도메인 양 끝에 염기성 아미노산을 인위적으로 부착하여 합성한 펩타이드의 항균 활성 확인
본 발명에서는 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드군이 선행 연구에서 발명한 KU-5878보다 우수한 항균활성을 나타냄을 확인하였다 (상기 실시예 2). 이들 항균 펩타이드군은 자연계에서 존재하는 아미노산 서열을 포함하는 펩타이드이다. 본 실시 예에서는 이들 항균 펩타이드군과 유사한 특징을 가지고 자연계에서 존재하지 않는 아미노산 서열로 이루어진 펩타이드를 합성하여 박테리아 살균 최소 농도 측정법을 통해 각 펩타이드의 항균 활성을 비교 확인하였다 (각 펩타이드의 정보는 하기 표 3 참조).
KU-5878의 경우 막 관통 도메인은 58번째 아미노산으로부터 77번 아미노산에 해당한다. 막 관통 도메인 오른쪽에는 아르기닌(R)이 한 개 존재하지만 왼쪽에는 염기성 아미노산이 존재하지 않는다. 그렇지만 막 관통 도메인 내부의 왼쪽에 염기성 아미노산 라이신(K)이 한 개가 존재한다. 본 발명에서는 막 관통 도메인 양쪽에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드의 항균 활성을 확인하였다. 표 3에서와 같이 HIG1A, COX20 단백질의 막 관통 도메인에 라이신(K) 또는 아르기닌(R)을 각각 1개에서 5개까지 인위적으로 부착하여 합성한 펩타이드의 항균 활성을 측정하였다.
SEQ.No 펩타이드 이름 UniPort entry 단백질 이름 유전자이름 총 아미노산 수/항균 펩타이드 위치 펩타이드 서열(막 관통 도메인/아미노산 수) 세포내 위치 MBC 값
(μg/ml)		 막 관통 도메인 양 끝
아미노산 수
녹농균 황색포도상구균 K+R 친수성 아미노산
41 HIG1A-0 Q9Y241 HIG1 domain family member 1A, mitochondrial-Human HIG1A 93/26-46 EAPFVPVGIAGFAAIVAYGLY(26-46/21) 미토콘드리아막 200< 200< 0 0
42 HIG1A-0-K1 - - - - KEAPFVPVGIAGFAAIVAYGLYK(23) - 200< 200< 2 0
43 HIG1A-0-K2 - - - - KKEAPFVPVGIAGFAAIVAYGLYKK(25) - 18 100 4 0
44 HIG1A-0-K3 - - - - KKKEAPFVPVGIAGFAAIVAYGLYKKK(27) - 2 2 6 0
45 HIG1A-0-K4 - - - - KKKKEAPFVPVGIAGFAAIVAYGLYKKKK(29) - 1 2 8 0
46 HIG1A-0-K5 - - - - KKKKKEAPFVPVGIAGFAAIVAYGLYKKKKK(31) - 1 2 10 0
47 HIG1A-0-R2 - - - - RREAPFVPVGIAGFAAIVAYGLYRR(25) - 12 15 4 0
48 HIG1A-0-R3 - - - - RRREAPFVPVGIAGFAAIVAYGLYRRR(27) - 5 2 6 0
49 HIG1A-0-R4 - - - - RRRREAPFVPVGIAGFAAIVAYGLYRRRR(29) - 1 1 8 0
50 COX20-0-K2 - - - - KKILYGKLGKVVAGFGHFLFKK (22) - 7 18 4 0
51 COX20-0-K3 - - - - KKKILYGKLGKVVAGFGHFLFKKK (24) - 5 5 6 0
52 COX20-0-R2 - - - - RRILYGKLGKVVAGFGHFLFRR (22) - 5 10 4 0
53 COX20-0-R3 - - - - RRRILYGKLGKVVAGFGHFLFRRR (24) - 5 3 6 0
54 SLC25A6-0 P12236 ADP/ATP translocase 3 SLC25A6 298/75-99 LANVIRYFPTQALNFAFKDKYKQIF(75-99/25) 미토콘드리아막 200<x 200<x 0 0
55 SLC25A6-0-K1 - - - - KLANVIRYFPTQALNFAFKDKYKQIFK(75-99/27) - 4 50 2 0
56 SLC25A6-0-K2 - - - - KKLANVIRYFPTQALNFAFKDKYKQIFKK(75-99/29) - 1 40 4 0
57 SLC25A6-0-K3 - - - - KKKLANVIRYFPTQALNFAFKDKYKQIFKKK(75-99/31) - 1 30 6 0
58 ATP5MC2 Q06055 ATP synthase F(0) complex subunit C2, mitochondrial ATP5MC2 141/80-104 ATVGVAGSGAGIGTVFGSLIIGYAR (82-102/25) 미토콘드리아막 <200 <200 1 1
59 ATP5MC2-0-K4 - - - - KKKKVGVAGSGAGIGTVFGSLIIGYKKKK(29) - 4 8 8 0
60 NDUFC2(NDn-1) O95298 NADH dehydrogenase [ubiquinone] 1 subunit C2 NDUFC2 119/54-77 TAGLHRQLLYITAFFFAGYYLVKR(56-75/24) 미토콘드리아막 <200 <200 2 1
61 NDUFC2 (NDn-1)-0-K4 - - - - KKKKGLHRQLLYITAFFFAGYYLVKKKK (28) - 3 30 8 0
62 HIGD2B Q4VC39 Putative HIG1 domain family member 2B HIGD2B 106/80-104 HTQIAAQGFTIAAILLGLAATAMKS(82-102/25) 미토콘드리아막 <200 <200 1 3
63 HIGD2B-0-K4 - - - - KKKKQIAAQGFTIAAILLGLAATAMKKKK (29) - 4 20 8 0
64 ZDH23-K4-> ZDH23-0-K4 Q8IYP9 (TMD number) Palmitoyltransferase ZDHHC23 (TMD only) - KKKKVGPVQLAVLTCGLFLILLALHKKKK(166-186/29) - 3 10 8 0
65 PGAP6-K4-> PGAP6-0-K4 Q9HCN3 (TMD number) Post-GPI attachment to proteins factor 6 (TMD only) PGAP6 (TMD only) - KKKKAATLLLTLSNLMFLAPIAVSVKKKK(546-566/29) - 1 30 8 0
66 GHITM-K4->GHITM-0-K4 Q9H3K2
(TMD number)		 Growth hormone-inducible transmembrane protein (TMD only) GHITM (TMD only) - KKKKSTYMYLAGSIGLTALSAIAISKKKK(126-146/29) - 3 6 8 0
표 2와 3에서 나타낸 바와 같이, 세포막 관통 도메인 양 끝에 염기성 또는 극성 아미노산이 없는 펩타이드는 항균 활성이 낮아서 박테리아 살균 최소 농도 측정법을 이용하여 측정이 불가능하였지만, 상기 표 3에서 확인할 수 있는 바와 같이, 라이신 또는 아르기닌을 각각 2개 이상 인위적으로 부착하여 합성한 펩타이드군은 KU-5878보다 우수한 항균 활성을 나타냄을 알 수 있었다.
또한 탐색을 통해 서열번호 54, 58, 60, 62, 64, 65, 66번에 대한 막 관통 도메인을 추가 합성하고 도메인 양 끝에 라이신(K)을 1개에서 4개까지 인위적으로 부착하여 합성한 펩타이드의 항균 활성을 측정한 결과, 라이신을 인위적으로 부착했을 때, 각 펩타이드의 항균 활성이 증가한 것을 알 수 있었다.
실시예 5. 표 1과 3에서 확인한 항균 펩타이드 중에서 대표 펩타이드의 다양한 박테리아에 대한 항균 활성 확인
상기 실시예 2와 4에서 항균활성을 확인한 펩타이드가 살균력을 발휘하는 세균의 종류를 확인하기 위하여, 상기 표 1에 나타낸 합성 펩타이드 중 OPA1-1, HIG1C, COX20-1 3개의 펩타이드와 표 3에 나타낸 합성 펩타이드 중 HIG1A-0-K4, HIG1A-0-R4 2개의 펩타이드를 대표로 선정하여 하기 표 4에 나타낸 세균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다.
구체적으로, 각 세균을 3%(w/v) TSB (Tryptic Soy Broth) 액체 배지에 37℃ 200 rpm 조건으로 overnight 배양한 후, 다시 동일한 조건에서 2 시간 동안 2차 배양하였다. 상기 2차 배양한 각 균주의 최종 농도가 5Х105 CFU/㎖ 농도가 되도록 10 mM sodium phosphate 용액으로 희석하여 균주 용액을 준비하였다.
이어서, 96-웰 마이크로 플레이트의 각 웰에 농도를 달리하여 (최종 농도: 0 ㎍/㎖ - 200 ㎍/㎖ 펩타이드) 각 펩타이드를 분주하고, 상기 준비된 균주 용액을 100 ㎕ 를 넣고 섞어 37℃항온기에서 1 시간 동안 반응시켰다.
그리고, TS (Tryptic Soy) 30 g/L 및 한천 15 g/L을 증류수에 녹이고 멸균한 다음 100 ㎜ 원형 플레이트에 20 ㎖을 붓고 하루 이상 실온에서 굳혀서 제조한 TS 한천 플레이트에 상기 펩타이드와 균주의 반응 용액을 10 ㎕씩 일정한 크기로 도말하고, 37℃항온기에서 18 시간 동안 배양한 뒤, 플레이트에서 콜로니 생성을 확인하였다. 박테리아 살균 최소농도는 콜로니가 단 하나도 생성되지 않은 펩타이드의 최소 농도로 정의하였고, 실험 결과는 하기 표 4와 같다.
SEQ.No 펩타이드 이름 Enterococcus faecium (14475) MBC 값 (μg/ml) E. coli MBC 값 (μg/ml) Acinetobacter baumannii MBC 값 (μg/ml)
1 COX20-1 7 4 2
4 HIG1C 3 4 2
9 OPA1-1 3 1 1
45 HIG1A-0-K4 1 3 3
49 HIG1A-0-R4 2 2 3
상기 표 4에서 확인할 수 있는 바와 같이, 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드는 그람 양성균, 그람 음성균 박테리아 모두에게서 광범위한 항균 활성을 나타냄을 알 수 있었다.
실시예 6. 표 1과 3에서 확인한 항균 펩타이드 중에서 대표 펩타이드의 다제내성 박테리아에서 항균 활성 확인
상기 실시예 2와 4에서 항균활성을 확인한 펩타이드가 다제내성 박테리아에서 항균 활성 확인하기 위하여, 상기 표 1에 나타낸 합성 펩타이드 중 OPA1-1, HIG1C, COX20-1 3개의 펩타이드와 표 3에 나타낸 합성 펩타이드 중 HIG1A-0-K4, HIG1A-0-R4 2개의 펩타이드를 대표로 선정하여 하기 표 5에 나타낸 세균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다.
한편, 하기 표 5에서 다제내성 녹농균 과 다제내성 아시네토박터는 고려대학교 안암병원의 환자로부터 분리한 균으로서, 다제내성 녹농균의 경우 피페라실린(piperacilin), 피페라실린타조박탐(piperacilin-tazobactam), 세프타지딤(ceftazidime), 이미페넴(imipenem), 메로페넴(meropenem), 젠타마이신(gentamicin), 아미카신(amikacin), 및 시프로플록사신(ciprofloxacin) 항생제에 내성을 나타내고, 다제내성 아시네토박터는 피페라실린, 피페라실린타조박탐, 세프타지딤, 이미페넴, 메로페넴, 젠타마이신, 아미카신, 시프로플록사신, 및 세페핌(cefepime) 항생제에 내성을 나타냄을 확인하고 실험에 이용하였다.
또한, 하기 표 5에서 반코마이신 내성 엔테로코커스 패시움 및 반코마이신 내성 황색포도상구균은 국가병원체자원은행(national culture collection for pathogens, NCCP)에서 구입하였으며, 반코마이신 내성 엔테로코커스 패시움은 반코마이신, 리팜핀(rifampin), 테트라사이클린, 젠타마이신, 에리트로마이신(erythromycin), 스트렙토마이신(streptomycin) 및 암피실린(ampicillin)에 내성을 가지며, 반코마이신 내성 황색포도상구균은 반코마이신, 옥사실린(oxacillin), 벤질페니실린(benzylpenicillin), 암피실린 및 세파졸린(cefazolin)에 내성을 가짐을 확인하고 실험에 이용하였다.
SEQ.No 펩타이드 이름 다제내성 녹농균 MBC 값 (μg/ml) 다제내성 포도상구균(16870) MBC 값 (μg/ml) 다제내성 Enterococcus faecium (14475) MBC 값 (μg/ml) 다제내성 Acinetobacter baumannii MBC 값 (μg/ml)
1 COX20-1 6 18 7 4
4 HIG1C 2 8 2 2
9 OPA1-1 0.5 6 2 1
45 HIG1A-0-K4 3 2 1 3
49 HIG1A-0-R4 2 2 2 2
상기 표 5에서 확인할 수 있는 바와 같이, 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드는 다제내성 그람 양성균, 다제내성 그람 음성균 박테리아 모두에게서 광범위한 항균 활성을 나타냄을 알 수 있었다.
실시예 7. 표 1에서의 향균 펩타이드의 일부 펩타이드에서 다른 종에 해당하는 단백질 중 막 관통 도메인과 양 끝에 합이 3개 이상의 염기성 아미노산과 일부 극성 아미노산으로 이루어진 펩타이드의 항균 활성 확인
본 발명자는 앞선 실시예 1에서 사람 단백질 중 막 관통 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 펩타이드가 우수한 항균 활성을 가짐을 확인하였고, 이것이 다른 종의 단백질 중에서도 동일한 모티프의 펩타이드가 항균 활성을 가진다는 것을 확인하기 위하여 하기 표 6에 나타낸 펩타이드를 합성하고 녹농균과 황색포도상구균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다.
SEQ.No 펩타이드 이름 UniPort entry 단백질 이름 유전자이름 펩타이드 서열(막 관통 도메인/아미노산 수) 세포내 위치 MBC 값
(μg/ml)		 막 관통 도메인 양 끝
아미노산 수
녹농균 황색포도상구균 K+R 친수성 아미노산
67 COX-20-mouse Q9D7J4 Cytochrome c oxidase assembly protein COX20, mitochondrial COX-20 RESILYGSLGSIVTGLGHFLVTSRIRR (27) 미토콘드리아막 30 80 4 3
68 OPA1-rat Q2TA68 Dynamin-like 120 kDa protein, mitochondrial OPA1 RLAARLLKLRYIILGSAVGGGYTAKKT (97-113/27) 미토콘드리아막 2 2 4 2
69 GDAP1-bovine A6QQZ0 Ganglioside-induced differentiation-associated protein 1 GDAP1 KRKTFNKVLGHVNNILISAVLPTAFRVAKKR (292-312/31) 미토콘드리아막 4 4 7 2
70 BCL2L1-chick Q07816 Bcl-2-like protein 1 BCL2L1 RKGQETFNKWLLTGATVAGVLLLGSLLSRK (206-223/30) 미토콘드리아막 8 8 4 4
상기 표 6에서 확인할 수 있는 바와 같이, 다른 종에 해당하는 단백질 중 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 역시 항균 활성을 가진다는 것을 알 수 있었다.
실시예 8. 서로 다른 두가지 이상의 항균 펩타이드의 세포막 관통 도메인과 도메인 양 끝의 N-말단과 C-말단의 서열을 융합하여 합성한 펩타이드의 항균 활성 확인
본 발명자들은 앞선 실시예의 항균 펩타이드 중 서열번호 5, 60번의 막 관통 도메인과, 서열번호 40의 도메인 양 끝의 아미노산 서열(KAK---KLK)을 융합하여 제작한 뒤, 녹농균과 황색포도상구균에 대한 항균 활성을 박테리아 살균 최소 농도 측정법을 이용하여 측정하였다. 박테리아 살균 최소 농도 측정법은 상기 실시예 2의 방법과 동일하다. 그 결과 서열번호 5, 60번의 막 관통 도메인은 그 자체로 항균 활성이 없지만 이들 막 관통 도메인과 양 끝에 각각 4개의 염기성 아미노산으로 이루어진 새로운 융합 펩타이드가 우수한 항균 활성을 나타내는 것을 확인하였다 (서열번호 71, 72).
SEQ.No 펩타이드 이름 막 관통 도메인의 UniPort entry 막 관통 도메인의 단백질 이름 펩타이드 서열(막 관통 도메인/아미노산 수) MBC 값
(μg/ml)		 막 관통 도메인 양 끝
아미노산 수
녹농균 황색포도상구균 K+R 친수성 아미노산
71 HI2-m1 Q9BW72 HIG1 domain family member 2A, mitochondrial-Human KAKIAAQGFTVAAILLGLAVTAMKKLK (27) 3 12 4 0
72 NDn-1-m1 O95298 NADH dehydrogenase [ubiquinone] 1 subunit C2 KAKGLHRQLLYITAFFFAGYYLVKLK (26) 13 25 4 0
상기 표 7에서 확인할 수 있는 바와 같이, 앞선 실시예와 같은 패턴의 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 융합 펩타이드 역시 모두 우수한 항균 활성을 나타내는 것을 확인하였다.
이제까지 본 발명에 대하여 그 바람직한 실시예들을 중심으로 살펴보았다. 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자는 본 발명이 본 발명의 본질적인 특성에서 벗어나지 않는 범위에서 변형된 형태로 구현될 수 있음을 이해할 수 있을 것이다. 그러므로 개시된 실시예들은 한정적인 관점이 아니라 설명적인 관점에서 고려되어야 한다. 본 발명의 범위는 전술한 설명이 아니라 특허청구범위에 나타나 있으며, 그와 동등한 범위 내에 있는 모든 차이점은 본 발명에 포함된 것으로 해석되어야 할 것이다.

Claims (15)

15 내지 30개의 아미노산으로 구성되는 트랜스멤브레인 도메인(transmembrane domain, TMD)을 포함하는 폴리펩타이드 및 상기 폴리펩타이드의 C-말단 및 N-말단 각각에 하나 이상, 합이 3개 이상의 아미노산을 포함하는 말단 아미노산이 결합된 융합 폴리펩타이드.
제 1항에 있어서,
상기 트랜스멤브레인 도메인(transmembrane domain, TMD)은 서열번호 39, 41, 54, 73 내지 78 중 어느 하나인 융합 폴리펩타이드.
제 1항에 있어서,
상기 말단 아미노산은 C-말단 및 N-말단 각각에 2 내지 6개의 아미노산이 결합된 것인 융합 폴리펩타이드.
제 1항에 있어서,
상기 말단 아미노산은 염기성 아미노산 및 극성 아미노산으로 이루어진 군으로부터 선택되는 것인 융합 폴리펩타이드.
제 1항에 있어서,
상기 말단 아미노산은 라이신, 아르기닌, 히스티딘, 세린, 트레오닌 시스테인, 글루타민, 아르파라긴 및 티로신 중 어느 하나인 융합 폴리펩타이드.
제 1항에 있어서,
상기 융합 폴리펩타이드는 서열번호 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 59, 61, 63, 64, 65, 66, 71 및 72 중 어느 하나인 융합 폴리펩타이드.
제 1항의 융합 폴리펩타이드를 포함하는 항균 폴리펩타이드.
제 7항에 있어서,
상기 폴리펩타이드는 N-말단 또는 C-말단에 페길레이션(PEGylation), 아세틸레이션(acetylation), 카르복실레이션(carboxylation), 리피데이션(lipidation), 또는 아미데이션(amidation)을 더 포함하는 것인 항균 폴리펩타이드.
제 7항에 있어서,
상기 폴리펩타이드는 그람 양성균, 그람 음성균, 및 다제내성균으로 이루어진 군으로부터 선택되는 하나 이상의 세균에 대해 항균 활성을 갖는 것을 특징으로 하는 항균 폴리펩타이드.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 유효성분으로 포함하는 항생제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 식품 첨가제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 사료 첨가제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 화장료 조성물.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 항균용 생물 농약 제제.
제 1항 내지 제 9항 중 어느 한 항의 폴리펩타이드를 포함하는 항균용 의약외품 조성물.
PCT/KR2023/012962 2022-09-01 2023-08-31 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체 WO2024049232A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2022-0110830 2022-09-01
KR20220110830 2022-09-01
KR1020230114740A KR20240032667A (ko) 2022-09-01 2023-08-30 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체
KR10-2023-0114740 2023-08-30

Publications (1)

Publication Number Publication Date
WO2024049232A1 true WO2024049232A1 (ko) 2024-03-07

Family

ID=90098430

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/012962 WO2024049232A1 (ko) 2022-09-01 2023-08-31 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체

Country Status (1)

Country Link
WO (1) WO2024049232A1 (ko)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20200144065A (ko) * 2019-06-17 2020-12-28 고려대학교 산학협력단 Romo1 유래 항균 펩타이드 및 그 변이체

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20200144065A (ko) * 2019-06-17 2020-12-28 고려대학교 산학협력단 Romo1 유래 항균 펩타이드 및 그 변이체

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 12 April 2022 (2022-04-12), ANONYMOUS: "HIG1 hypoxia inducible domain family member 1A [Homo sapiens]", XP093145586, retrieved from NCBI Database accession no. KAI2529107.1 *
LEE JONG-KOOK, PARK YOONKYUNG: "Mechanism of Action of Antimicrobial Peptides Against Bacterial Membrane", JOURNAL OF BACTERIOLOGY AND VIROLOGY, KOREAN SOCIETY FOR MICROBIOLOGY, SEOUL, KR, vol. 44, no. 2, 1 June 2014 (2014-06-01), KR , pages 140 - 151, XP093145579, ISSN: 1598-2467, DOI: 10.4167/jbv.2014.44.2.140 *
PIRTSKHALAVA M, VISHNEPOLSKY B, GRIGOLAVA M: "Transmembrane and Antimicrobial Peptides. Hydrophobicity, Amphiphilicity and Propensity to Aggregation", ARXIV (CORNELL UNIVERSITY), CORNELL UNIVERSITY LIBRARY, ARXIV.ORG, ITHACA, 23 July 2013 (2013-07-23), Ithaca, XP093145588, Retrieved from the Internet <URL:https://arxiv.org/ftp/arxiv/papers/1307/1307.6160.pdf> [retrieved on 20240326], DOI: 10.48550/arxiv.1307.6160 *
YOU DEOK-GYUN, LEE HYE-RA, KIM HONG-KYU, LEE GI-YOUNG, YOO YOUNG-DO: "A Novel Peptide Derived from the Transmembrane Domain of Romo1 Is a Promising Candidate for Sepsis Treatment and Multidrug-Resistant Bacteria", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, MOLECULAR DIVERSITY PRESERVATION INTERNATIONAL (MDPI), BASEL, CH, vol. 22, no. 15, 31 July 2021 (2021-07-31), Basel, CH , pages 8243, XP093109295, ISSN: 1422-0067, DOI: 10.3390/ijms22158243 *

Similar Documents

Publication Publication Date Title
TWI665218B (zh) 多黏菌素化合物、包含其之醫藥組成物及其用途
KR102499670B1 (ko) 라이신 치환을 포함하는 Romo1 유래 항균 펩타이드 및 그 변이체
US7078380B2 (en) Antibacterial agents comprising conjugates of glycopeptides and peptidic membrane associating elements
JPH04108800A (ja) グリコペプチド誘導体
US6025326A (en) Compositions and methods for the prevention and treatment of oral mucositis
US20210260070A1 (en) Lysin cf-301 resensitizes methicillin-resistant staphylococcus aureua (mrsa) to penicillin derivatives and first generation cephalosporins
US6841661B2 (en) Glycopeptide antibacterial compounds, compositions containing same and methods of using same
WO2024049232A1 (ko) 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체
WO2024053836A1 (ko) 항생제 내성균에 대한 항균 활성을 가지는 항균 펩타이드 h103b 및 이의 용도
US20020045574A1 (en) Glycopeptide antibacterial compounds and methods of using same
WO2023048411A1 (ko) 신규한 항균 펩타이드 및 이의 용도
KR20240032667A (ko) 막 관통 펩타이드 도메인과 그 양 끝에 염기성 또는 극성 아미노산으로 이루어진 항균 펩타이드 및 그 변이체
WO2021002697A2 (ko) 다제내성 병원성 세균을 효과적으로 사멸시키는 재조합 항균 단백질 Ablysin의 용도
WO2022105948A2 (es) Entidades peptídicas con actividad antimicrobiana frente a patógenos multi-drogoresistentes
WO2012033450A1 (en) Novel antimicrobial peptides
KR102381481B1 (ko) 신규한 항균 펩타이드 또는 펩타이드 유사체 및 이의 용도
US20230086360A1 (en) Antimicrobial Peptides
AU704851B2 (en) Compositions and methods for the prevention and treatment of oral mucositis
JP2001510164A (ja) 動物に対する毒性を減じた生物活性ペプチドおよび同ペプチドを調製する方法。
WO2017048029A1 (ko) 클라바스피린 펩타이드 유사체를 유효성분으로 함유하는 항염증용 조성물
US20090149391A1 (en) Novel antimicrobial bolisin peptides
WO2023039482A1 (en) Prodrugs of antibiotic teixobactin
KR100442527B1 (ko) 항암 및 항생활성을 갖는 신규 폴리펩티드와 그를함유하는 항암제 및 항생제 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23860908

Country of ref document: EP

Kind code of ref document: A1