KR20230078152A - Psma에 특이적으로 결합하는 항체 및 그의 용도 - Google Patents
Psma에 특이적으로 결합하는 항체 및 그의 용도 Download PDFInfo
- Publication number
- KR20230078152A KR20230078152A KR1020210165641A KR20210165641A KR20230078152A KR 20230078152 A KR20230078152 A KR 20230078152A KR 1020210165641 A KR1020210165641 A KR 1020210165641A KR 20210165641 A KR20210165641 A KR 20210165641A KR 20230078152 A KR20230078152 A KR 20230078152A
- Authority
- KR
- South Korea
- Prior art keywords
- antibody
- antigen
- psma
- binding fragment
- cells
- Prior art date
Links
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 title claims abstract description 104
- 230000027455 binding Effects 0.000 title claims abstract description 102
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 title claims abstract description 101
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 title claims abstract description 76
- 239000000427 antigen Substances 0.000 claims abstract description 107
- 108091007433 antigens Proteins 0.000 claims abstract description 107
- 102000036639 antigens Human genes 0.000 claims abstract description 107
- 239000012634 fragment Substances 0.000 claims abstract description 90
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 64
- 201000011510 cancer Diseases 0.000 claims abstract description 55
- 239000000611 antibody drug conjugate Substances 0.000 claims abstract description 44
- 229940049595 antibody-drug conjugate Drugs 0.000 claims abstract description 44
- 238000000034 method Methods 0.000 claims abstract description 29
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 24
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 24
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 24
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 24
- 238000011282 treatment Methods 0.000 claims abstract description 23
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 13
- 239000000203 mixture Substances 0.000 claims abstract description 11
- 230000002265 prevention Effects 0.000 claims abstract description 10
- 238000003745 diagnosis Methods 0.000 claims abstract description 3
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 claims abstract 2
- 210000004027 cell Anatomy 0.000 claims description 118
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 37
- 239000003814 drug Substances 0.000 claims description 35
- 229940079593 drug Drugs 0.000 claims description 29
- 239000013604 expression vector Substances 0.000 claims description 16
- 239000002246 antineoplastic agent Substances 0.000 claims description 11
- 210000002865 immune cell Anatomy 0.000 claims description 8
- 238000003259 recombinant expression Methods 0.000 claims description 8
- 229940127089 cytotoxic agent Drugs 0.000 claims description 6
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 5
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 4
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 4
- 108091070501 miRNA Proteins 0.000 claims description 4
- 239000002679 microRNA Substances 0.000 claims description 4
- 239000003053 toxin Substances 0.000 claims description 4
- 231100000765 toxin Toxicity 0.000 claims description 4
- 108700012359 toxins Proteins 0.000 claims description 4
- 102000037982 Immune checkpoint proteins Human genes 0.000 claims description 3
- 108091008036 Immune checkpoint proteins Proteins 0.000 claims description 3
- 241000221961 Neurospora crassa Species 0.000 claims description 3
- 210000003734 kidney Anatomy 0.000 claims description 3
- 241000228257 Aspergillus sp. Species 0.000 claims description 2
- 244000063299 Bacillus subtilis Species 0.000 claims description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 claims description 2
- 241000282693 Cercopithecidae Species 0.000 claims description 2
- 241000699800 Cricetinae Species 0.000 claims description 2
- 241000699802 Cricetulus griseus Species 0.000 claims description 2
- 241000235058 Komagataella pastoris Species 0.000 claims description 2
- 241000588770 Proteus mirabilis Species 0.000 claims description 2
- 241000589774 Pseudomonas sp. Species 0.000 claims description 2
- 241000720795 Schizosaccharomyces sp. Species 0.000 claims description 2
- 108091027967 Small hairpin RNA Proteins 0.000 claims description 2
- 108020004459 Small interfering RNA Proteins 0.000 claims description 2
- 241001147693 Staphylococcus sp. Species 0.000 claims description 2
- 241000187180 Streptomyces sp. Species 0.000 claims description 2
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 2
- 210000003292 kidney cell Anatomy 0.000 claims description 2
- 210000000822 natural killer cell Anatomy 0.000 claims description 2
- 210000001672 ovary Anatomy 0.000 claims description 2
- 230000002285 radioactive effect Effects 0.000 claims description 2
- 239000004055 small Interfering RNA Substances 0.000 claims description 2
- 239000013598 vector Substances 0.000 abstract description 18
- 238000004519 manufacturing process Methods 0.000 abstract description 9
- 230000001225 therapeutic effect Effects 0.000 abstract description 6
- 230000003449 preventive effect Effects 0.000 abstract 1
- 108090000623 proteins and genes Proteins 0.000 description 31
- 102000004169 proteins and genes Human genes 0.000 description 19
- 235000018102 proteins Nutrition 0.000 description 18
- 108020004414 DNA Proteins 0.000 description 16
- 206010060862 Prostate cancer Diseases 0.000 description 16
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 16
- 230000014509 gene expression Effects 0.000 description 16
- 108090000765 processed proteins & peptides Proteins 0.000 description 16
- 235000001014 amino acid Nutrition 0.000 description 13
- 229940024606 amino acid Drugs 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 210000004408 hybridoma Anatomy 0.000 description 10
- -1 debouganin Proteins 0.000 description 9
- 230000003834 intracellular effect Effects 0.000 description 9
- 239000013642 negative control Substances 0.000 description 9
- 102000035195 Peptidases Human genes 0.000 description 8
- 108091005804 Peptidases Proteins 0.000 description 8
- 231100000135 cytotoxicity Toxicity 0.000 description 8
- 230000003013 cytotoxicity Effects 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 108010076504 Protein Sorting Signals Proteins 0.000 description 7
- 210000003719 b-lymphocyte Anatomy 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 5
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 5
- 239000012472 biological sample Substances 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 108010093470 monomethyl auristatin E Proteins 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 206010005003 Bladder cancer Diseases 0.000 description 4
- 206010006187 Breast cancer Diseases 0.000 description 4
- 208000026310 Breast neoplasm Diseases 0.000 description 4
- 206010009944 Colon cancer Diseases 0.000 description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 4
- 108010092160 Dactinomycin Proteins 0.000 description 4
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 229940041181 antineoplastic drug Drugs 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 238000004587 chromatography analysis Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 239000000975 dye Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 235000019833 protease Nutrition 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 239000011347 resin Substances 0.000 description 4
- 229920005989 resin Polymers 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 201000005112 urinary bladder cancer Diseases 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 108010006654 Bleomycin Proteins 0.000 description 3
- 208000030808 Clear cell renal carcinoma Diseases 0.000 description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 3
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 108090000369 Glutamate Carboxypeptidase II Proteins 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 3
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- 229930182555 Penicillin Natural products 0.000 description 3
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 3
- 208000004965 Prostatic Intraepithelial Neoplasia Diseases 0.000 description 3
- 206010071019 Prostatic dysplasia Diseases 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 208000006265 Renal cell carcinoma Diseases 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 3
- 229960002964 adalimumab Drugs 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 229960000640 dactinomycin Drugs 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- 210000003712 lysosome Anatomy 0.000 description 3
- 230000001868 lysosomic effect Effects 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 238000013508 migration Methods 0.000 description 3
- 230000005012 migration Effects 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 230000002018 overexpression Effects 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 229940049954 penicillin Drugs 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 238000003752 polymerase chain reaction Methods 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 208000021046 prostate intraepithelial neoplasia Diseases 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 229960005322 streptomycin Drugs 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 2
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 2
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 2
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 2
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 2
- 108010024976 Asparaginase Proteins 0.000 description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 108090000712 Cathepsin B Proteins 0.000 description 2
- 102000004225 Cathepsin B Human genes 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 206010061818 Disease progression Diseases 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- ICDIMQAMJGDHSE-GUBZILKMSA-N Gln-His-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O ICDIMQAMJGDHSE-GUBZILKMSA-N 0.000 description 2
- 101710183768 Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- BYYNJRSNDARRBX-YFKPBYRVSA-N Gly-Gln-Gly Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O BYYNJRSNDARRBX-YFKPBYRVSA-N 0.000 description 2
- UIQGJYUEQDOODF-KWQFWETISA-N Gly-Tyr-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 UIQGJYUEQDOODF-KWQFWETISA-N 0.000 description 2
- DNAZKGFYFRGZIH-QWRGUYRKSA-N Gly-Tyr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 DNAZKGFYFRGZIH-QWRGUYRKSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- MCIXMYKSPQUMJG-SRVKXCTJSA-N Phe-Ser-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MCIXMYKSPQUMJG-SRVKXCTJSA-N 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- IEZVHOULSUULHD-XGEHTFHBSA-N Thr-Ser-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O IEZVHOULSUULHD-XGEHTFHBSA-N 0.000 description 2
- 101710120037 Toxin CcdB Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- XYNFFTNEQDWZNY-ULQDDVLXSA-N Tyr-Met-His Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N XYNFFTNEQDWZNY-ULQDDVLXSA-N 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229960003896 aminopterin Drugs 0.000 description 2
- 108010038850 arginyl-isoleucyl-tyrosine Proteins 0.000 description 2
- 108010047857 aspartylglycine Proteins 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- 230000007910 cell fusion Effects 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- 229960004630 chlorambucil Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000000562 conjugate Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 229960000684 cytarabine Drugs 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 239000002619 cytotoxin Substances 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 230000005750 disease progression Effects 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 2
- HKSZLNNOFSGOKW-UHFFFAOYSA-N ent-staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(C)O1 HKSZLNNOFSGOKW-UHFFFAOYSA-N 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 229940014144 folate Drugs 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 235000019152 folic acid Nutrition 0.000 description 2
- 239000011724 folic acid Substances 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Chemical compound NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 2
- 108010050848 glycylleucine Proteins 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 102000046689 human FOLH1 Human genes 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 239000012642 immune effector Substances 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 230000033001 locomotion Effects 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 229960001924 melphalan Drugs 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 229960001428 mercaptopurine Drugs 0.000 description 2
- ANZJBCHSOXCCRQ-FKUXLPTCSA-N mertansine Chemical compound CO[C@@H]([C@@]1(O)C[C@H](OC(=O)N1)[C@@H](C)[C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(=O)CCS)CC(=O)N1C)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 ANZJBCHSOXCCRQ-FKUXLPTCSA-N 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 108010059074 monomethylauristatin F Proteins 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- IEQIEDJGQAUEQZ-UHFFFAOYSA-N phthalocyanine Chemical compound N1C(N=C2C3=CC=CC=C3C(N=C3C4=CC=CC=C4C(=N4)N3)=N2)=C(C=CC=C2)C2=C1N=C1C2=CC=CC=C2C4=N1 IEQIEDJGQAUEQZ-UHFFFAOYSA-N 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 201000005825 prostate adenocarcinoma Diseases 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- YUOCYTRGANSSRY-UHFFFAOYSA-N pyrrolo[2,3-i][1,2]benzodiazepine Chemical compound C1=CN=NC2=C3C=CN=C3C=CC2=C1 YUOCYTRGANSSRY-UHFFFAOYSA-N 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- HKSZLNNOFSGOKW-FYTWVXJKSA-N staurosporine Chemical compound C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@H]1C[C@@H](NC)[C@@H](OC)[C@]4(C)O1 HKSZLNNOFSGOKW-FYTWVXJKSA-N 0.000 description 2
- CGPUWJWCVCFERF-UHFFFAOYSA-N staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(OC)O1 CGPUWJWCVCFERF-UHFFFAOYSA-N 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- 229960000303 topotecan Drugs 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000003656 tris buffered saline Substances 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 210000005166 vasculature Anatomy 0.000 description 2
- LVLLALCJVJNGQQ-SEODYNFXSA-N (1r,3s,5z)-5-[(2e)-2-[(1r,3as,7ar)-1-[(2r,3e,5e)-7-ethyl-7-hydroxynona-3,5-dien-2-yl]-7a-methyl-2,3,3a,5,6,7-hexahydro-1h-inden-4-ylidene]ethylidene]-4-methylidenecyclohexane-1,3-diol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)/C=C/C=C/C(O)(CC)CC)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C LVLLALCJVJNGQQ-SEODYNFXSA-N 0.000 description 1
- KLZOTDOJMRMLDX-YBBVPDDNSA-N (1r,3s,5z)-5-[(2e)-2-[(1s,3as,7as)-1-[(1r)-1-(4-ethyl-4-hydroxyhexoxy)ethyl]-7a-methyl-2,3,3a,5,6,7-hexahydro-1h-inden-4-ylidene]ethylidene]-4-methylidenecyclohexane-1,3-diol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](C)OCCCC(O)(CC)CC)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C KLZOTDOJMRMLDX-YBBVPDDNSA-N 0.000 description 1
- UFIVODCEJLHUTQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-(1-phenylethyldisulfanyl)-2h-pyridine-1-carboxylate Chemical compound C=1C=CC=CC=1C(C)SSC1C=CC=CN1C(=O)ON1C(=O)CCC1=O UFIVODCEJLHUTQ-UHFFFAOYSA-N 0.000 description 1
- FLCQLSRLQIPNLM-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-acetylsulfanylacetate Chemical compound CC(=O)SCC(=O)ON1C(=O)CCC1=O FLCQLSRLQIPNLM-UHFFFAOYSA-N 0.000 description 1
- VQZYZXLBKBUOHE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)butanoate Chemical compound C=1C=CC=NC=1SSC(C)CC(=O)ON1C(=O)CCC1=O VQZYZXLBKBUOHE-UHFFFAOYSA-N 0.000 description 1
- JSHOVKSMJRQOGY-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCSSC1=CC=CC=N1 JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 description 1
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical compound C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- SMBRZDVGVHNORI-WOYAITHZSA-N (2s)-2-acetamidobutanedioic acid;(2s)-2-aminopentanedioic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O.CC(=O)N[C@H](C(O)=O)CC(O)=O SMBRZDVGVHNORI-WOYAITHZSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- NVKGVBZZSJFQLM-UHFFFAOYSA-N 1-(2-chloroethyl)-1-nitrosourea Chemical compound NC(=O)N(N=O)CCCl NVKGVBZZSJFQLM-UHFFFAOYSA-N 0.000 description 1
- SWQQELWGJDXCFT-PNHWDRBUSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-ethynylimidazole-4-carboxamide Chemical compound C#CC1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 SWQQELWGJDXCFT-PNHWDRBUSA-N 0.000 description 1
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- 102000010400 1-phosphatidylinositol-3-kinase activity proteins Human genes 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- FUXVKZWTXQUGMW-FQEVSTJZSA-N 9-Aminocamptothecin Chemical compound C1=CC(N)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 FUXVKZWTXQUGMW-FQEVSTJZSA-N 0.000 description 1
- JBVSSSZFNTXJDX-YTLHQDLWSA-N Ala-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](C)N JBVSSSZFNTXJDX-YTLHQDLWSA-N 0.000 description 1
- WRDANSJTFOHBPI-FXQIFTODSA-N Ala-Arg-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CS)C(=O)O)N WRDANSJTFOHBPI-FXQIFTODSA-N 0.000 description 1
- REAQAWSENITKJL-DDWPSWQVSA-N Ala-Met-Asp-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O REAQAWSENITKJL-DDWPSWQVSA-N 0.000 description 1
- KLALXKYLOMZDQT-ZLUOBGJFSA-N Ala-Ser-Asn Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(N)=O KLALXKYLOMZDQT-ZLUOBGJFSA-N 0.000 description 1
- IOFVWPYSRSCWHI-JXUBOQSCSA-N Ala-Thr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)N IOFVWPYSRSCWHI-JXUBOQSCSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010073478 Anaplastic large-cell lymphoma Diseases 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- GIVATXIGCXFQQA-FXQIFTODSA-N Arg-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N GIVATXIGCXFQQA-FXQIFTODSA-N 0.000 description 1
- NKBQZKVMKJJDLX-SRVKXCTJSA-N Arg-Glu-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NKBQZKVMKJJDLX-SRVKXCTJSA-N 0.000 description 1
- FNXCAFKDGBROCU-STECZYCISA-N Arg-Ile-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FNXCAFKDGBROCU-STECZYCISA-N 0.000 description 1
- AOHKLEBWKMKITA-IHRRRGAJSA-N Arg-Phe-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N AOHKLEBWKMKITA-IHRRRGAJSA-N 0.000 description 1
- MOGMYRUNTKYZFB-UNQGMJICSA-N Arg-Thr-Phe Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MOGMYRUNTKYZFB-UNQGMJICSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- OLVIPTLKNSAYRJ-YUMQZZPRSA-N Asn-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N OLVIPTLKNSAYRJ-YUMQZZPRSA-N 0.000 description 1
- HDHZCEDPLTVHFZ-GUBZILKMSA-N Asn-Leu-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O HDHZCEDPLTVHFZ-GUBZILKMSA-N 0.000 description 1
- RTFXPCYMDYBZNQ-SRVKXCTJSA-N Asn-Tyr-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O RTFXPCYMDYBZNQ-SRVKXCTJSA-N 0.000 description 1
- WBDWQKRLTVCDSY-WHFBIAKZSA-N Asp-Gly-Asp Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O WBDWQKRLTVCDSY-WHFBIAKZSA-N 0.000 description 1
- OMMIEVATLAGRCK-BYPYZUCNSA-N Asp-Gly-Gly Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)NCC(O)=O OMMIEVATLAGRCK-BYPYZUCNSA-N 0.000 description 1
- KYQNAIMCTRZLNP-QSFUFRPTSA-N Asp-Ile-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O KYQNAIMCTRZLNP-QSFUFRPTSA-N 0.000 description 1
- USNJAPJZSGTTPX-XVSYOHENSA-N Asp-Phe-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O USNJAPJZSGTTPX-XVSYOHENSA-N 0.000 description 1
- WMLFFCRUSPNENW-ZLUOBGJFSA-N Asp-Ser-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O WMLFFCRUSPNENW-ZLUOBGJFSA-N 0.000 description 1
- HTSSXFASOUSJQG-IHPCNDPISA-N Asp-Tyr-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O HTSSXFASOUSJQG-IHPCNDPISA-N 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 101710185679 CD276 antigen Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 101100512078 Caenorhabditis elegans lys-1 gene Proteins 0.000 description 1
- 101100421200 Caenorhabditis elegans sep-1 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000003908 Cathepsin D Human genes 0.000 description 1
- 108090000258 Cathepsin D Proteins 0.000 description 1
- FMGYKKMPNATWHP-UHFFFAOYSA-N Cyperquat Chemical compound C1=C[N+](C)=CC=C1C1=CC=CC=C1 FMGYKKMPNATWHP-UHFFFAOYSA-N 0.000 description 1
- SZQCDCKIGWQAQN-FXQIFTODSA-N Cys-Arg-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O SZQCDCKIGWQAQN-FXQIFTODSA-N 0.000 description 1
- JDHMXPSXWMPYQZ-AAEUAGOBSA-N Cys-Gly-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CS)N JDHMXPSXWMPYQZ-AAEUAGOBSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 206010061819 Disease recurrence Diseases 0.000 description 1
- 108010024212 E-Selectin Proteins 0.000 description 1
- 102100023471 E-selectin Human genes 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 208000001976 Endocrine Gland Neoplasms Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 108010055196 EphA2 Receptor Proteins 0.000 description 1
- 108010055179 EphA4 Receptor Proteins 0.000 description 1
- 108010055334 EphB2 Receptor Proteins 0.000 description 1
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 1
- 102100021616 Ephrin type-A receptor 4 Human genes 0.000 description 1
- 102100031968 Ephrin type-B receptor 2 Human genes 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108091008794 FGF receptors Proteins 0.000 description 1
- 108010088842 Fibrinolysin Proteins 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 1
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- RGXXLQWXBFNXTG-CIUDSAMLSA-N Gln-Arg-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O RGXXLQWXBFNXTG-CIUDSAMLSA-N 0.000 description 1
- XOKGKOQWADCLFQ-GARJFASQSA-N Gln-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XOKGKOQWADCLFQ-GARJFASQSA-N 0.000 description 1
- XZLLTYBONVKGLO-SDDRHHMPSA-N Gln-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XZLLTYBONVKGLO-SDDRHHMPSA-N 0.000 description 1
- NKLRYVLERDYDBI-FXQIFTODSA-N Glu-Glu-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O NKLRYVLERDYDBI-FXQIFTODSA-N 0.000 description 1
- XTZDZAXYPDISRR-MNXVOIDGSA-N Glu-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N XTZDZAXYPDISRR-MNXVOIDGSA-N 0.000 description 1
- UGSVSNXPJJDJKL-SDDRHHMPSA-N Glu-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)O)N UGSVSNXPJJDJKL-SDDRHHMPSA-N 0.000 description 1
- GJBUAAAIZSRCDC-GVXVVHGQSA-N Glu-Leu-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O GJBUAAAIZSRCDC-GVXVVHGQSA-N 0.000 description 1
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 108010048963 Glutamate carboxypeptidase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- OCQUNKSFDYDXBG-QXEWZRGKSA-N Gly-Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N OCQUNKSFDYDXBG-QXEWZRGKSA-N 0.000 description 1
- PMNHJLASAAWELO-FOHZUACHSA-N Gly-Asp-Thr Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PMNHJLASAAWELO-FOHZUACHSA-N 0.000 description 1
- PABFFPWEJMEVEC-JGVFFNPUSA-N Gly-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)CN)C(=O)O PABFFPWEJMEVEC-JGVFFNPUSA-N 0.000 description 1
- OLPPXYMMIARYAL-QMMMGPOBSA-N Gly-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)CN OLPPXYMMIARYAL-QMMMGPOBSA-N 0.000 description 1
- MHZXESQPPXOING-KBPBESRZSA-N Gly-Lys-Phe Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MHZXESQPPXOING-KBPBESRZSA-N 0.000 description 1
- 108010009504 Gly-Phe-Leu-Gly Chemical group 0.000 description 1
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 1
- GULGDABMYTYMJZ-STQMWFEESA-N Gly-Trp-Asp Chemical compound [H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(O)=O)C(O)=O GULGDABMYTYMJZ-STQMWFEESA-N 0.000 description 1
- YGHSQRJSHKYUJY-SCZZXKLOSA-N Gly-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN YGHSQRJSHKYUJY-SCZZXKLOSA-N 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 101150112082 Gpnmb gene Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 102100035943 HERV-H LTR-associating protein 2 Human genes 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000924533 Homo sapiens Angiopoietin-2 Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001021491 Homo sapiens HERV-H LTR-associating protein 2 Proteins 0.000 description 1
- 101000898034 Homo sapiens Hepatocyte growth factor Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 1
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 1
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 1
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- 101710093458 ICOS ligand Proteins 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- FBGXMKUWQFPHFB-JBDRJPRFSA-N Ile-Ser-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N FBGXMKUWQFPHFB-JBDRJPRFSA-N 0.000 description 1
- GVEODXUBBFDBPW-MGHWNKPDSA-N Ile-Tyr-Leu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 GVEODXUBBFDBPW-MGHWNKPDSA-N 0.000 description 1
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102000002698 KIR Receptors Human genes 0.000 description 1
- 108010043610 KIR Receptors Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 241000880493 Leptailurus serval Species 0.000 description 1
- BQSLGJHIAGOZCD-CIUDSAMLSA-N Leu-Ala-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O BQSLGJHIAGOZCD-CIUDSAMLSA-N 0.000 description 1
- OXKYZSRZKBTVEY-ZPFDUUQYSA-N Leu-Asn-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O OXKYZSRZKBTVEY-ZPFDUUQYSA-N 0.000 description 1
- KAFOIVJDVSZUMD-DCAQKATOSA-N Leu-Gln-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O KAFOIVJDVSZUMD-DCAQKATOSA-N 0.000 description 1
- KAFOIVJDVSZUMD-UHFFFAOYSA-N Leu-Gln-Gln Natural products CC(C)CC(N)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(O)=O KAFOIVJDVSZUMD-UHFFFAOYSA-N 0.000 description 1
- WQWSMEOYXJTFRU-GUBZILKMSA-N Leu-Glu-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O WQWSMEOYXJTFRU-GUBZILKMSA-N 0.000 description 1
- FEHQLKKBVJHSEC-SZMVWBNQSA-N Leu-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(C)C)C(O)=O)=CNC2=C1 FEHQLKKBVJHSEC-SZMVWBNQSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 1
- NKKFVJRLCCUJNA-QWRGUYRKSA-N Lys-Gly-Lys Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN NKKFVJRLCCUJNA-QWRGUYRKSA-N 0.000 description 1
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 1
- PDIDTSZKKFEDMB-UWVGGRQHSA-N Lys-Pro-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O PDIDTSZKKFEDMB-UWVGGRQHSA-N 0.000 description 1
- DIBZLYZXTSVGLN-CIUDSAMLSA-N Lys-Ser-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O DIBZLYZXTSVGLN-CIUDSAMLSA-N 0.000 description 1
- MEQLGHAMAUPOSJ-DCAQKATOSA-N Lys-Ser-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O MEQLGHAMAUPOSJ-DCAQKATOSA-N 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- VOOINLQYUZOREH-SRVKXCTJSA-N Met-Gln-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCSC)N VOOINLQYUZOREH-SRVKXCTJSA-N 0.000 description 1
- SPSSJSICDYYTQN-HJGDQZAQSA-N Met-Thr-Gln Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O SPSSJSICDYYTQN-HJGDQZAQSA-N 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- HYFMSAFINFJTFH-UHFFFAOYSA-N Mitomycin-A Natural products O=C1C(OC)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)N2CC2NC21 HYFMSAFINFJTFH-UHFFFAOYSA-N 0.000 description 1
- PCZOHLXUXFIOCF-UHFFFAOYSA-N Monacolin X Natural products C12C(OC(=O)C(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 PCZOHLXUXFIOCF-UHFFFAOYSA-N 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100262697 Mus musculus Axl gene Proteins 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- FONIWJIDLJEJTL-UHFFFAOYSA-N N(8)-acetylspermidine Chemical compound CC(=O)NCCCCNCCCN FONIWJIDLJEJTL-UHFFFAOYSA-N 0.000 description 1
- UBQYURCVBFRUQT-UHFFFAOYSA-N N-benzoyl-Ferrioxamine B Chemical compound CC(=O)N(O)CCCCCNC(=O)CCC(=O)N(O)CCCCCNC(=O)CCC(=O)N(O)CCCCCN UBQYURCVBFRUQT-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 102100029527 Natural cytotoxicity triggering receptor 3 ligand 1 Human genes 0.000 description 1
- 101710201161 Natural cytotoxicity triggering receptor 3 ligand 1 Proteins 0.000 description 1
- 206010028851 Necrosis Diseases 0.000 description 1
- 102100035486 Nectin-4 Human genes 0.000 description 1
- 101710043865 Nectin-4 Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 102000004207 Neuropilin-1 Human genes 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- RFCVXVPWSPOMFJ-STQMWFEESA-N Phe-Leu Chemical group CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 RFCVXVPWSPOMFJ-STQMWFEESA-N 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- APKRGYLBSCWJJP-FXQIFTODSA-N Pro-Ala-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O APKRGYLBSCWJJP-FXQIFTODSA-N 0.000 description 1
- ZSKJPKFTPQCPIH-RCWTZXSCSA-N Pro-Arg-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZSKJPKFTPQCPIH-RCWTZXSCSA-N 0.000 description 1
- IMNVAOPEMFDAQD-NHCYSSNCSA-N Pro-Val-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O IMNVAOPEMFDAQD-NHCYSSNCSA-N 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 1
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 1
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 101100221606 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) COS7 gene Proteins 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- KDGARKCAKHBEDB-NKWVEPMBSA-N Ser-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CO)N)C(=O)O KDGARKCAKHBEDB-NKWVEPMBSA-N 0.000 description 1
- SFTZWNJFZYOLBD-ZDLURKLDSA-N Ser-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO SFTZWNJFZYOLBD-ZDLURKLDSA-N 0.000 description 1
- FUMGHWDRRFCKEP-CIUDSAMLSA-N Ser-Leu-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O FUMGHWDRRFCKEP-CIUDSAMLSA-N 0.000 description 1
- FPCGZYMRFFIYIH-CIUDSAMLSA-N Ser-Lys-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O FPCGZYMRFFIYIH-CIUDSAMLSA-N 0.000 description 1
- ADJDNJCSPNFFPI-FXQIFTODSA-N Ser-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO ADJDNJCSPNFFPI-FXQIFTODSA-N 0.000 description 1
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 1
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 1
- FRPNVPKQVFHSQY-BPUTZDHNSA-N Ser-Trp-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CO)N FRPNVPKQVFHSQY-BPUTZDHNSA-N 0.000 description 1
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 201000004283 Shwachman-Diamond syndrome Diseases 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- HATRDXDCPOXQJX-UHFFFAOYSA-N Thapsigargin Natural products CCCCCCCC(=O)OC1C(OC(O)C(=C/C)C)C(=C2C3OC(=O)C(C)(O)C3(O)C(CC(C)(OC(=O)C)C12)OC(=O)CCC)C HATRDXDCPOXQJX-UHFFFAOYSA-N 0.000 description 1
- NJEMRSFGDNECGF-GCJQMDKQSA-N Thr-Ala-Asp Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O NJEMRSFGDNECGF-GCJQMDKQSA-N 0.000 description 1
- JVTHIXKSVYEWNI-JRQIVUDYSA-N Thr-Asn-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JVTHIXKSVYEWNI-JRQIVUDYSA-N 0.000 description 1
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 1
- SPVHQURZJCUDQC-VOAKCMCISA-N Thr-Lys-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O SPVHQURZJCUDQC-VOAKCMCISA-N 0.000 description 1
- ZMYCLHFLHRVOEA-HEIBUPTGSA-N Thr-Thr-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ZMYCLHFLHRVOEA-HEIBUPTGSA-N 0.000 description 1
- MNYNCKZAEIAONY-XGEHTFHBSA-N Thr-Val-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O MNYNCKZAEIAONY-XGEHTFHBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- YCPOZVAOBBQLRI-WDSKDSINSA-N Treosulfan Chemical compound CS(=O)(=O)OC[C@H](O)[C@@H](O)COS(C)(=O)=O YCPOZVAOBBQLRI-WDSKDSINSA-N 0.000 description 1
- RCMHSGRBJCMFLR-BPUTZDHNSA-N Trp-Met-Asn Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(O)=O)=CNC2=C1 RCMHSGRBJCMFLR-BPUTZDHNSA-N 0.000 description 1
- PKZIWSHDJYIPRH-JBACZVJFSA-N Trp-Tyr-Gln Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O PKZIWSHDJYIPRH-JBACZVJFSA-N 0.000 description 1
- UOXPLPBMEPLZBW-WDSOQIARSA-N Trp-Val-Lys Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(O)=O)=CNC2=C1 UOXPLPBMEPLZBW-WDSOQIARSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 1
- CDBXVDXSLPLFMD-BPNCWPANSA-N Tyr-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC1=CC=C(O)C=C1 CDBXVDXSLPLFMD-BPNCWPANSA-N 0.000 description 1
- MWUYSCVVPVITMW-IGNZVWTISA-N Tyr-Tyr-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 MWUYSCVVPVITMW-IGNZVWTISA-N 0.000 description 1
- ANHVRCNNGJMJNG-BZSNNMDCSA-N Tyr-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CS)C(=O)O)N)O ANHVRCNNGJMJNG-BZSNNMDCSA-N 0.000 description 1
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 1
- VHIZXDZMTDVFGX-DCAQKATOSA-N Val-Ser-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N VHIZXDZMTDVFGX-DCAQKATOSA-N 0.000 description 1
- JAIZPWVHPQRYOU-ZJDVBMNYSA-N Val-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O JAIZPWVHPQRYOU-ZJDVBMNYSA-N 0.000 description 1
- PGBMPFKFKXYROZ-UFYCRDLUSA-N Val-Tyr-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)O)N PGBMPFKFKXYROZ-UFYCRDLUSA-N 0.000 description 1
- OWFGFHQMSBTKLX-UFYCRDLUSA-N Val-Tyr-Tyr Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N OWFGFHQMSBTKLX-UFYCRDLUSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 102000016548 Vascular Endothelial Growth Factor Receptor-1 Human genes 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- NBLHOLNNKJBEDC-XOGQCRKLSA-N [(2r,3s,4s,5r,6r)-2-[(2r,3s,4s,5s,6s)-2-[(1r,2s)-2-[[6-amino-2-[(1s)-3-amino-1-[[(2s)-2,3-diamino-3-oxopropyl]amino]-3-oxopropyl]-5-methylpyrimidine-4-carbonyl]amino]-3-[[(2r,3s,4s)-5-[[(2s,3r)-1-[2-[4-[4-[4-(diaminomethylideneamino)butylcarbamoyl]-1,3-th Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCCN=C(N)N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C NBLHOLNNKJBEDC-XOGQCRKLSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 108010081404 acein-2 Proteins 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 229940124339 anthelmintic agent Drugs 0.000 description 1
- 239000000921 anthelmintic agent Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 229940125644 antibody drug Drugs 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 108010059459 arginyl-threonyl-phenylalanine Proteins 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 108010044540 auristatin Proteins 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- NBLHOLNNKJBEDC-UHFFFAOYSA-N bleomycin B2 Natural products N=1C(C=2SC=C(N=2)C(=O)NCCCCN=C(N)N)=CSC=1CCNC(=O)C(C(O)C)NC(=O)C(C)C(O)C(C)NC(=O)C(C(OC1C(C(O)C(O)C(CO)O1)OC1C(C(OC(N)=O)C(O)C(CO)O1)O)C=1NC=NC=1)NC(=O)C1=NC(C(CC(N)=O)NCC(N)C(N)=O)=NC(N)=C1C NBLHOLNNKJBEDC-UHFFFAOYSA-N 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960001714 calcium phosphate Drugs 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 229960003340 calcium silicate Drugs 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 238000010609 cell counting kit-8 assay Methods 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- SBRXTSOCZITGQG-UHFFFAOYSA-N crisnatol Chemical compound C1=CC=C2C(CNC(CO)(CO)C)=CC3=C(C=CC=C4)C4=CC=C3C2=C1 SBRXTSOCZITGQG-UHFFFAOYSA-N 0.000 description 1
- 229950007258 crisnatol Drugs 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 229960000958 deferoxamine Drugs 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 108700041286 delta Proteins 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229940042396 direct acting antivirals thiosemicarbazones Drugs 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 101150109170 dll4 gene Proteins 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 229950009791 durvalumab Drugs 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 102000052178 fibroblast growth factor receptor activity proteins Human genes 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 229940014259 gelatin Drugs 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010080575 glutamyl-aspartyl-alanine Proteins 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- ZNNLBTZKUZBEKO-UHFFFAOYSA-N glyburide Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZNNLBTZKUZBEKO-UHFFFAOYSA-N 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- 108010079413 glycyl-prolyl-glutamic acid Proteins 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010048994 glycyl-tyrosyl-alanine Proteins 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003317 immunochromatography Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- PCZOHLXUXFIOCF-BXMDZJJMSA-N lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 description 1
- 229960004844 lovastatin Drugs 0.000 description 1
- QLJODMDSTUBWDW-UHFFFAOYSA-N lovastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(C)C=C21 QLJODMDSTUBWDW-UHFFFAOYSA-N 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 208000029559 malignant endocrine neoplasm Diseases 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 229960001786 megestrol Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229960005558 mertansine Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 208000010658 metastatic prostate carcinoma Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- HYFMSAFINFJTFH-NGSRAFSJSA-N mitomycin A Chemical compound O=C1C(OC)=C(C)C(=O)C2=C1[C@@H](COC(N)=O)[C@]1(OC)N2C[C@@H]2N[C@@H]21 HYFMSAFINFJTFH-NGSRAFSJSA-N 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000009562 momordin Substances 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- OWIUPIRUAQMTTK-UHFFFAOYSA-M n-aminocarbamate Chemical compound NNC([O-])=O OWIUPIRUAQMTTK-UHFFFAOYSA-M 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 201000002740 oral squamous cell carcinoma Diseases 0.000 description 1
- 150000002905 orthoesters Chemical class 0.000 description 1
- 150000002923 oximes Chemical class 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 108010073101 phenylalanylleucine Proteins 0.000 description 1
- 239000003504 photosensitizing agent Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229940012957 plasmin Drugs 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 208000037920 primary disease Diseases 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 108010077112 prolyl-proline Proteins 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 210000005267 prostate cell Anatomy 0.000 description 1
- 210000000064 prostate epithelial cell Anatomy 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 229960004622 raloxifene Drugs 0.000 description 1
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 239000000985 reactive dye Substances 0.000 description 1
- 210000003370 receptor cell Anatomy 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229940120975 revlimid Drugs 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 150000007659 semicarbazones Chemical class 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- IXFPJGBNCFXKPI-FSIHEZPISA-N thapsigargin Chemical compound CCCC(=O)O[C@H]1C[C@](C)(OC(C)=O)[C@H]2[C@H](OC(=O)CCCCCCC)[C@@H](OC(=O)C(\C)=C/C)C(C)=C2[C@@H]2OC(=O)[C@@](C)(O)[C@]21O IXFPJGBNCFXKPI-FSIHEZPISA-N 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- SRVJKTDHMYAMHA-WUXMJOGZSA-N thioacetazone Chemical compound CC(=O)NC1=CC=C(\C=N\NC(N)=S)C=C1 SRVJKTDHMYAMHA-WUXMJOGZSA-N 0.000 description 1
- 125000000101 thioether group Chemical group 0.000 description 1
- 150000003584 thiosemicarbazones Chemical class 0.000 description 1
- 229960003723 tiazofurine Drugs 0.000 description 1
- FVRDYQYEVDDKCR-DBRKOABJSA-N tiazofurine Chemical compound NC(=O)C1=CSC([C@H]2[C@@H]([C@H](O)[C@@H](CO)O2)O)=N1 FVRDYQYEVDDKCR-DBRKOABJSA-N 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 229960001612 trastuzumab emtansine Drugs 0.000 description 1
- 229960003181 treosulfan Drugs 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- 150000003327 trichothecene derivatives Chemical class 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- 229960001722 verapamil Drugs 0.000 description 1
- ZQFGRJWRSLZCSQ-ZSFNYQMMSA-N verteporfin Chemical compound C=1C([C@@]2([C@H](C(=O)OC)C(=CC=C22)C(=O)OC)C)=NC2=CC(C(=C2C=C)C)=NC2=CC(C(=C2CCC(O)=O)C)=NC2=CC2=NC=1C(C)=C2CCC(=O)OC ZQFGRJWRSLZCSQ-ZSFNYQMMSA-N 0.000 description 1
- 229960003895 verteporfin Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Urology & Nephrology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Reproductive Health (AREA)
- Hospice & Palliative Care (AREA)
- Oncology (AREA)
- Pregnancy & Childbirth (AREA)
- Biotechnology (AREA)
- Gynecology & Obstetrics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
Abstract
본 발명은 PSMA(prostate-specific membrane antigen)에 특이적으로 결합하는 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 숙주세포, 이를 이용한 항-PSMA 항체 또는 이의 항원 결합 단편의 제조 방법, 상기 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체, 이중특이 항체, 키메라 항원 수용체, 상기 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물, 예방 또는 치료용 약학 조성물 및 예방 또는 치료방법에 관한 것이다. 본 발명에 따른 PSMA에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 PSMA에 대한 높은 친화도 및 결합력을 나타내며, 목적하는 종양 또는 암의 예방 또는 치료에 유용하게 사용될 수 있다.
Description
본 발명은 PSMA(prostate-specific membrane antigen)에 특이적으로 결합하는 항-PSMA 항체 및 그 용도에 관한 것으로, 더욱 상세하게는 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 숙주세포, 이를 이용한 항-PSMA 항체 또는 이의 항원 결합 단편의 제조 방법, 상기 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체, 이중특이 항체, 키메라 항원 수용체 및 이를 함유하는 면역세포, 상기 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물 및 진단방법, 암의 예방 또는 치료용 약학 조성물 및 예방 또는 치료방법에 관한 것이다.
글루타메이트 카르복시펩티다제 II(glutamate carboxypeptidase II; GCPII), N-아세틸-L-아스파르틸-L-글루타메이트 펩티다제 I(N-acetyl-L-aspartyl-L-glutamate peptidase I; NAALADase I) 또는 N-아세틸-아스파티르 글루타메이트(NAAG) 펩티다제로도 알려져 있는 전립선 특이적 막 항원(prostate-specific membrane antigen; PSMA)은 인간 엽산 가수분해 효소(folate hydrolase 1; FOLH1) 유전자에 의해 코딩되는 효소이다(D S O'Keefe, et al., Biochimica et Biophysica Acta (BBA) - Gene Structure and Expression. 1998 Nov 26;1443(1-2):113-27). 인간 PSMA는 약 84kDa의 분자량을 가진 type II 막 단백질로, 악성 전립선 상피 세포 및 교모세포종, 유방암 및 방광암을 포함한 수많은 고형 종양 악성 종양의 혈관 내피 세포에서 고도로 발현된다. PSMA의 과발현은 높은 종양 등급, 고위험의 질환 진행 및 재발과 관련이 있으며(SvenPerner, et al., Human Pathology, 2007 May;38(5):696-701), PSMA의 고발현은 부정적인 임상 예후 및 현저히 짧은 생존과 관련되어 왔다. PSMA 발현은 원발성 질환 부위와 뼈 및 림프절과 같은 전이 부위 모두에서 관찰된다(William C Olson, Robert J Israel, Frontiers in Bioscience (Landmark Ed), 2014 Jan 1;19:12-33, 2014).
PSMA는 folate와 N-acetyl-I-aspatryl-I-glutamate을 substrate로 인지하여 glutamate를 생성하는 glutamate carboxypeptidase이다. PSMA에 의해 생성된 glutamate는 second messenger로서 전립선암 세포 표면의 수용체에 결합하여 PI3K 활성을 촉진하게 되어 암의 성장을 가속화 시킨다고 알려져 있다(Charalambos Kaittanis, et al., J. Exp. Med. 2018 Vol. 215 No. 1 159-175). 따라서, PSMA의 활성을 저해하거나 PSMA 수용체가 발현되는 암세포를 파괴시킨다면 전립선암이 치료될 수 있을 것이다.
전립선암은 남성에서 가장 흔하게 진단되는 암이며, 질병 진행과 관련된 심각한 사망률과 질병 발생률(morbidity)로 인해 새로운 표적 치료가 시급히 필요한 상태다. 현재 전립선암 치료를 위하여 평가되고 있는 다양한 접근법이 있다. 화학 요법 약물의 표적 전달에 PSMA를 활용하기 위하여 소분자, 압타머 또는 항체가 특정 리간드로 사용되고 있다(James C Evans, et al., British Journal of Pharmacology (2016) 173 3041-3079). PSMA에 결합하는 항체는 선행 기술에 기재되어 있다. PSMA는 처음에 부분 정제된, 인간 전립선 선암(LNCap) 세포주에서 분리된 세포막 분획으로 면역화된 마우스에서 유래된 뮤린(murine) 단클론 항체인 7E11에 의해 최초로 특성화되었다(J S Horoszewicz, et al., Anticancer Res. 7: 927-936. 1987).
면역원성은 항체 기반 약물을 개발할 때 중요한 관심사이다(J Juan C. Almagro, Johan Fransson, Frontiers in Bioscience 13, 1619-1633, January 1, 2008). 치료 목적으로 사용되는 모든 외인성 단백질은 수혜자(recipients)에게 항-약물 항체 형성을 유발할 위험이 있으며(Huub Schellekens, Nature Reviews Drug Discovery volume 1, pages 457-462 (2002)), 비인간 기원의 치료용 단백질 및 항체의 사용은 항-약물 항체 생성과 관련이 있어서 종종 유해한 면역 복합체(deleterious immune complexes)의 형성 또는 치료제의 중화로 이어지는 것으로 일상적으로 발견되었다. 항체의 기원과 특성 외에도, 질병의 유형, 투여 경로 및 수혜자의 유전적 배경과 같은 다른 요인들이 면역원성에 영향을 미치는 것으로 나타났다. 따라서, 다양한 이유로 인해, 상기 종래 기술에 개시된 항-PSMA 항체들은 인간 요법에, 특히 면역원성 잠재력(immunogenic potential), 표적 인식(target recognition) 부족 또는 불충분한 결합 친화성 때문에 적합하지 않았다.
PSMA의 물리적 특성과 전립선암 진행과 관련된 그의 발현 패턴을 고려할 때, PSMA는 항체-약물 접합체 개발에 있어 탁월한 표적이다. 항체-약물 접합체(antibody-drug conjugate; ADC)는 암세포와 같은 표적 세포에 세포 독성제의 표적화 전달을 허용하는 강력한 치료 구조물 부류이다. 표적화 기능 때문에, 이러한 화합물은 동일한 전신 전달 약물에 비해 훨씬 높은 치료 지수를 나타낸다. ADC는 온전한 항체 또는 scFv와 같은 항체 단편으로 개발되었다. 항체 또는 단편은 생리학적 조건하에서 안정하지만, 일단 표적 세포 내에 들어가면 절단될 수 있는 링커를 통해 하나 이상의 약물 사본에 연결된다. 현재까지, AML용 젬투주맙 오조가미신(이후 시장에서 철수됨), ALCL 및 호지킨 림프종용 브렌툭시맙 베도틴, 및 HER2 양성 전이성 유방암용 트라스투주맙 엠탄신을 포함하여 몇 개의 ADC만이 치료 용도로 승인 받았다(Verma et al., N Engl J Med 367:1783-91, 2012; Bross et al., Clin Cancer Res 7:1490-96, 2001; Francisco et al., Blood 102:1458-65, 2003). 다양한 약물을 표적화하는 많은 ADC가 임상 시험 중에 있다. 그러나 PSMA를 표적화하는 ADC는 치료 지수의 부족과 독성으로 인해 어려움에 직면한다.
이러한 기술적 배경하에서, 본 발명자들은 PSMA에 높은 친화도로 결합하여 PSMA의 활성을 효과적으로 저해하며, PSMA 발현 암의 성장을 억제하는 항체를 개발하고, 본 발명을 완성하였다.
본 배경기술 부분에 기재된 상기 정보는 오직 본 발명의 배경에 대한 이해를 향상시키기 위한 것이며, 이에 본 발명이 속하는 기술분야에서 통상의 지식을 가지는 자에게 있어 이미 알려진 선행기술을 형성하는 정보를 포함하지 않을 수 있다.
본 발명의 목적은 PSMA(prostate-specific membrane antigen)에 특이적으로 결합하는 항-PSMA 항체 또는 이의 항원 결합 단편을 제공하는 데 있다.
본 발명의 다른 목적은 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 숙주세포, 이를 이용한 항-PSMA 항체 또는 이의 항원 결합 단편의 제조 방법을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체 또는 이중특이 항체를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 키메라 항원 수용체, 상기 키메라 항원 수용체를 함유하는 면역세포를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물 및 진단방법을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체-약물 접합체, 상기 이중특이 항체 또는 상기 키메라 항원 수용체를 포함하는 암의 예방 또는 치료용 약학 조성물, 암의 예방 또는 치료방법, 암의 예방 또는 치료를 위한 상기 항체, 항체-약물 접합체, 이중특이 항체 또는 키메라 항원 수용체의 용도 및 암의 예방 또는 치료용 약제 제조를 위한 상기 항체, 항체-약물 접합체, 이중특이 항체 또는 키메라 항원 수용체의 사용을 제공하는 데 있다.
상기 목적을 달성하기 위하여, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 중쇄(heavy chain) CDR1, 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3; 및 서열번호 4의 아미노산 서열을 포함하는 경쇄(light chain) CDR1, 서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 항-PSMA(prostate-specific membrane antigen) 항체 또는 이의 항원 결합 단편을 제공한다.
본 발명은 또한, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 재조합 발현벡터 및 숙주세포, 이를 이용한 항-PSMA 항체 또는 이의 항원 결합 단편의 제조 방법을 제공한다.
본 발명은 또한, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체 또는 이중특이 항체를 제공한다.
본 발명은 또한, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 키메라 항원 수용체 또는 상기 키메라 항원 수용체를 함유하는 면역세포를 제공한다.
본 발명은 또한, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물 및 진단방법을 제공한다.
본 발명은 또한, 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 항체-약물 접합체, 이중특이 항체 또는 키메라 항원 수용체를 포함하는 암의 예방 또는 치료용 약학 조성물을 제공한다.
본 발명은 또한, 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 항체-약물 접합체, 이중특이 항체 또는 키메라 항원 수용체를 이용한 암의 예방 또는 치료방법, 암의 예방 또는 치료를 위한 상기 항체 또는 이의 항원 결합 단편, 항체-약물 접합체, 이중특이 항체 또는 키메라 항원 수용체의 용도 및 암의 예방 또는 치료용 약제 제조를 위한 상기 항체 또는 이의 항원 결합 단편, 항체-약물 접합체, 이중특이 항체 또는 키메라 항원 수용체의 사용을 제공한다.
본 발명에 따른 PSMA에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 PSMA에 대한 높은 친화도 및 결합력을 나타내며, 상기 항체에 약물이 접합된 항체-약물 접합체는 PSMA 발현 세포에 특이적으로 결합함으로써 약물을 효과적이면서도 특이적 또는 선택적으로 전달할 수 있다. 따라서, 상기 항체 또는 이의 항원 결합 단편은 목적하는 종양 또는 암의 예방 또는 치료에 유용하게 사용될 수 있다.
도 1은 후보 PSMA 타겟 항체의 IgG Purification 정제 결과를 나타낸 도면이다(Lane 1: adalimumab 1μg(Reduced), Lane 2: PSMA 타겟 항체 1μg(Reduced), Lane 4: adalimumab 1μg(Non-Reduced), Lane 5: PSMA 타겟 항체 1μg(Non-Reduced)).
도 2는 인간 PSMA 타겟 항체-약물 접합체의 세포 독성 확인 결과를 나타낸 그래프이다.
도 3은 인간 PSMA 타겟 항체의 인간 전립선암 세포주(LNCaP) 세포내 이동 결과를 나타낸 도면이다.
도 4는 PSMA 타겟 항체의 전립선암 세포주에서 발현되는 PSMA와의 결합 확인을 위한 유세포 분석 결과를 나타낸 도면이다.
도 2는 인간 PSMA 타겟 항체-약물 접합체의 세포 독성 확인 결과를 나타낸 그래프이다.
도 3은 인간 PSMA 타겟 항체의 인간 전립선암 세포주(LNCaP) 세포내 이동 결과를 나타낸 도면이다.
도 4는 PSMA 타겟 항체의 전립선암 세포주에서 발현되는 PSMA와의 결합 확인을 위한 유세포 분석 결과를 나타낸 도면이다.
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명은 인간 PSMA(prostate-specific membrane antigen(또는 glutamate carboxypeptidase II)에 결합하는 항체 및 변형된 항체에 관한 것이다. PSMA는 benign prostate secretory-acinar epithelium, prostatic intraepithelial neoplasia, prostatic adenocarcinoma 등에서 발현되며 특히, 호르몬 치료제로 치료가 어려운 악성 전립선암에서 높게 발현되어 전립선 암 항체 치료제의 표지 물질로 매우 적합한 단백질이다. 본 발명자들은 PSMA의 활성을 저해하거나 PSMA 수용체가 발현되는 암세포를 파괴시킨다면 전립선암이 치료될 수 있을 것임을 바탕으로, PSMA에 specific하게 결합하여 PSMA의 활성을 저해하기 위한 항체를 개발하였다.
따라서, 본 발명은 일 관점에서, PSMA(prostate-specific membrane antigen)에 특이적으로 결합하는 항-PSMA 항체 또는 이의 항원 결합 단편에 관한 것이다. 바람직하게는, 서열번호 1의 아미노산 서열을 포함하는 중쇄(heavy chain) CDR1, 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3; 및 서열번호 4의 아미노산 서열을 포함하는 경쇄(light chain) CDR1, 서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 항-PSMA 항체 또는 이의 항원 결합 단편에 관한 것이다.
본 발명에 있어서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편은 서열번호 1의 아미노산 서열을 포함하는 중쇄(heavy chain) CDR1, 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3와 각각 80% 이상의 서열 상동성, 바람직하게는 90% 이상의 서열 상동성, 더욱 바람직하게는 99%의 서열 상동성을 가지는 서열을 포함하는 중쇄 가변영역을 포함한다.
또한, 서열번호 4의 아미노산 서열을 포함하는 경쇄(light chain) CDR1, 서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR3와 각각 80% 이상의 서열 상동성, 바람직하게는 90% 이상의 서열 상동성, 더욱 바람직하게는 99%의 서열 상동성을 가지는 서열을 포함하는 경쇄 가변영역을 포함한다.
본 발명에 있어서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편은 서열번호 7의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 것을 특징으로 할 수 있다.
한편, 서열번호 7의 아미노산 서열을 포함하는 중쇄 가변영역과 80% 이상의 서열 상동성, 바람직하게는 90% 이상의 서열 상동성, 더욱 바람직하게는 99%의 서열 상동성을 가지는 서열을 포함하며, 서열번호 8의 아미노산 서열을 포함하는 경쇄 가변영역과 80% 이상의 서열 상동성, 바람직하게는 90% 이상의 서열 상동성, 더욱 바람직하게는 99%의 서열 상동성을 가지는 서열을 포함하는 경쇄 가변영역을 포함한다.
또한, 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편에는 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편에서, 보존적 치환을 통해 아미노산 서열의 일부가 치환된 항체 또는 이의 항원 결합 단편도 포함된다.
본 명세서에서 “보존적 치환”이란 1개 이상의 아미노산을 해당 폴리펩티드의 생물학적 또는 생화학적 기능의 손실을 야기하지 않는 유사한 생화학적 특성을 갖는 아미노산으로 치환하는 것을 포함하는 폴리펩티드의 변형을 의미한다. “보존적 아미노산 치환”은 아미노산 잔기를 유사한 측쇄를 갖는 아미노산 잔기로 대체시키는 치환이다. 유사한 측쇄를 갖는 아미노산 잔기 부류는 해당 기술분야에 규정되어 있으며, 잘 알려져 있다. 이들 부류는 염기성 측쇄를 갖는 아미노산(예를 들어, 라이신, 아르기닌, 히스티딘), 산성 측쇄를 갖는 아미노산(예를 들어, 아스파르트산, 글루탐산), 대전되지 않은 극성 측쇄를 갖는 아미노산(예를 들어, 글리신, 아스파라진, 글루타민, 세린, 트레오닌, 티로신, 시스테인), 비-극성 측쇄를 갖는 아미노산(예를 들어, 알라닌, 발린, 류신, 이소류신, 프롤린, 페닐알라닌, 메티오닌, 트립토판), 베타-분지된 측쇄를 갖는 아미노산(예를 들어, 트레오닌, 발린, 이소류신) 및 방향족 측쇄를 갖는 아미노산(예를 들어, 티로신, 페닐알라닌, 트립토판, 히스티딘)을 포함한다. 본 발명의 항체가 보존적 아미노산 치환을 갖고 여전히 활성을 보유할 수 있음이 예상된다.
본 명세서에서 “항체”라 함은, 면역계 내에서 항원의 자극에 의하여 만들어지는 물질을 총칭하는 것으로서 그 종류는 특별히 제한되지 않는다. 상기 항체는 특정 항원과 면역학적으로 반응성인 면역글로불린 분자로, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미하며, 다클론 항체 및 단클론 항체와 전체 항체 및 항체 단편을 모두 포함할 수 있다. 상기 항체는 비자연적으로 생성된 것, 예컨대, 재조합적 또는 합성적으로 생성된 것일 수 있다. 상기 항체는 동물 항체(예컨대, 마우스 항체 등), 키메릭 항체, 인간화 항체 또는 인간 항체일 수 있다. 상기 항체는 단일클론 항체일 수 있다. 또한 항체는 특별한 언급이 없는 한, 항원 결합능을 보유한 항체의 항원 결합 단편도 포함하는 것으로 이해될 수 있다.
본 명세서에서 용어 “항-PSMA 항체”는 PSMA에 결합하여 PSMA의 생물학적 활성의 억제를 초래하는 항체를 의미하며, “PSMA 특이적 항체”와 혼용되어 사용된다. 본 발명에 있어서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편은 인간 PSMA에 대하여 특이적 결합능을 갖는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, “항-PSMA 항체”는 다클론 항체(polyclonal antibody) 및 단클론 항체(단일클론 항체, monoclonal antibody)를 모두 포함하는 개념으로, 바람직하게는 단클론 항체이며, 온전한 전체 항체(whole antibody) 형태를 가질 수 있다. 전체 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조로서, 불변영역을 포함하는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다.
본 발명에 따른 항-PSMA 항체의 전체 항체는 IgA, IgD, IgE, IgM 및 IgG 형태를 포함하는 개념으로, IgG는 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다.
본 발명에 따른 항-PSMA 항체는 인간 항체 라이브러리(human antibody library)로부터 선별된 완전 인간 항체(fully human antibody)인 것이 바람직하지만, 이에 한정되는 것은 아니다.
본 발명에 따른 항-PSMA 항체의 “항원 결합 단편”은 항-PSMA 항체의 항원, 즉 PSMA와 결합할 수 있는 기능을 보유하고 있는 단편을 의미하며, Fab, Fab', F(ab')2, scFv, (scFv)2, scFv-Fc 및 Fv 등을 포함하는 개념으로, 본 명세서에서는 “항체 단편”과 동일한 의미로 혼용되어 사용된다.
상기 Fab은 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫 번째 불변영역(CH1 도메인)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'은 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab과 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다.
Fv(variable fragment)는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각을 의미한다. 이중쇄 Fv(dsFv)는 디설파이드 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고, 단쇄 Fv(scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변영역과 경쇄의 가변영역이 공유 결합으로 연결되어 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab을 얻을 수 있고, 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 유전자 재조합 기술(예를 들어, 항체의 중쇄 또는 이의 가변영역을 코딩하는 DNA 및 경쇄 또는 이의 가변 영역을 코딩하는 DNA를 주형으로 하고, 프라이머쌍을 이용하여 PCR(Polymerase Chain Reaction)법에 의해 증폭시키고, 펩티드 링커를 코딩하는 DNA와 양 말단이 각각 중쇄 또는 이의 가변영역 및 경쇄 또는 이의 가변영역과 연결되도록 하는 프라이머쌍을 조합하여 증폭)을 통하여 제작할 수 있다.
본 명세서에서, 용어 “중쇄”는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VH 및 3개의 불변영역 도메인 CH1, CH2 및 CH3를 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다. 또한 용어 “경쇄”는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VL 및 불변영역 도메인 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 “상보성 결정 영역(complementarity determining region; CDR)”은 면역글로블린 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다(Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(CDRH1, CDRH2 및 CDRH3) 및 경쇄(CDRL1, CDRL2 및 CDRL3)에는 각각 3개의 CDRs이 포함되어 있다. CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
본 발명은 다른 관점에서, 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 코딩하는 핵산에 관한 것이다.
본 명세서에서 사용되는 핵산은 세포, 세포 용해물(lysate) 중에 존재하거나, 또는 부분적으로 정제된 형태 또는 실질적으로 순수한 형태로 존재할 수도 있다. 핵산은 알칼리/SDS 처리, CsCl 밴드화(banding), 컬럼 크로마토그래피, 아가로스 겔 전기 영동 및 해당 기술분야에 잘 알려진 기타의 것을 포함하는 표준 기술에 의해 다른 세포 성분 또는 기타 오염 물질, 예를 들어 다른 세포의 핵산 또는 단백질로부터 정제되어 나올 경우 “단리”되거나 “실질적으로 순수하게 된” 것이다. 본 발명의 핵산은 예를 들어 DNA 또는 RNA일 수 있으며, 인트론 서열을 포함하거나 포함하지 않을 수 있다.
본 발명에 있어서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 코딩하는 핵산은 서열번호 9 및 서열번호 10의 폴리뉴클레오타이드 서열을 포함하는 것을 특징으로 할 수 있으며, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산을 분리하여 항체 또는 이의 항원 결합 단편을 재조합적으로 생산할 수 있다.
본 명세서에서, 용어 "핵산"은 DNA(gDNA 및 cDNA) 및 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산에서 기본 구성단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다. 본 발명의 중쇄 및 경쇄 가변영역을 코딩하는 핵산의 서열은 변형될 수 있다. 상기 변형은 뉴클레오타이드의 추가, 결실 또는 비보존적 치환 또는 보존적 치환을 포함한다.
상기 항체를 암호화하는 DNA는 통상적인 분자생물학적 수법을 사용하여 (예를 들어, 항체와 중쇄와 경쇄를 암호화하는 DNA와 특이적으로 결합할 수 있는 올리고뉴클레오타이드 프로브를 사용함으로써) 용이하게 분리 또는 합성할 수 있으며, 핵산을 분리하고, 이를 복제 가능한 벡터 내로 삽입하여 추가로 클로닝하거나(DNA의 증폭) 또는 추가로 발현시킨다.
본 발명은 또 다른 관점에서, 상기 핵산을 포함하는 재조합 발현벡터에 관한 것이다.
본 명세서에서 사용되는 용어, "벡터"는 숙주세포에서 목적 유전자를 발현시키기 위한 수단으로, 플라스미드 벡터, 코즈미드 벡터, 박테리오파지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터, 아데노-연관 바이러스 벡터와 같은 바이러스 벡터 등을 포함한다.
본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편의 발현을 위하여, 부분적이거나 전장인 경쇄 및 중쇄를 코딩하는 DNA를 표준 분자 생물학 기술(예를 들어 PCR 증폭 또는 목적 항체를 발현하는 하이브리도마를 사용한 cDNA 클로닝)로 수득할 수 있으며, DNA가 전사 및 번역 제어 서열에 “작동되도록 결합”되어 발현벡터 내로 삽입될 수 있다.
본 명세서에서 사용되는 용어 “작동되도록 결합”은 벡터 내의 전사 및 번역 제어 서열이 항체 유전자의 전사 및 번역을 조절하는 의도된 기능을 하도록 항체를 코딩하는 유전자가 벡터 내로 라이게이션된다는 것을 의미할 수 있다. 발현벡터 및 발현 제어 서열은 사용되는 발현용 숙주세포와 상용성 있도록 선택된다. 항체의 경쇄 유전자 및 항체의 중쇄 유전자는 별개의 벡터 내로 삽입되거나, 두 유전자 모두 동일한 발현벡터 내로 삽입된다. 항체는 표준 방법(예를 들어 항체 유전자 단편 및 벡터 상의 상보성 제한 효소 부위의 라이게이션, 또는 제한 효소 부위가 전혀 존재하지 않을 경우 블런트(blunt) 말단 라이게이션)으로 발현벡터 내로 삽입된다.
경우에 따라서 상기 재조합 발현벡터는 숙주세포로부터의 항체 사슬의 분비를 용이하게 하는 신호 펩티드를 코딩할 수 있다. 항체 사슬 유전자는 신호 펩티드가 프레임에 맞게 항체 사슬 유전자의 아미노 말단에 결합되도록 벡터 내로 클로닝될 수 있다. 신호 펩티드는 면역글로불린 신호 펩티드 또는 이종성 신호 펩티드(즉, 면역글로불린 외 단백질 유래의 신호 펩티드)일 수 있다. 또한, 상기 재조합 발현벡터는 숙주세포에서 항체 사슬 유전자의 발현을 제어하는 조절서열을 지닌다. “조절서열”은 항체 사슬 유전자의 전사 또는 번역을 제어하는 프로모터, 인핸서 및 기타 발현 제어 요소(예를 들어 폴리아데닐화 신호)를 포함할 수 있다. 통상의 기술자는 형질전환시킬 숙주세포의 선택, 단백질의 발현 수준 등과 같은 인자에 따라 조절 서열을 달리 선택하여, 발현벡터의 디자인이 달라질 수 있음을 인식할 수 있다.
본 발명은 또 다른 관점에서, 상기 재조합 발현벡터로 형질전환된 숙주세포에 관한 것이다. 본 발명에 따른 숙주세포는 동물세포, 식물세포, 효모, 대장균 및 곤충세포로 구성된 군에서 선택되는 것이 바람직하지만, 이에 한정되는 것은 아니다.
구체적으로는 본 발명에 따른 숙주세포는 대장균, 바실러스 서브틸리스(Bacillus subtilis), 스트렙토마이세스 속(Streptomyces sp.), 슈도모나스 속(Pseudomonas sp.), 프로테우스 미라빌리스(Proteus mirabilis) 또는 스타필로코쿠스 속(Staphylococcus sp.)과 같은 원핵 세포일 수 있다. 또한, 아스페르길러스 속(Aspergillus sp.)과 같은 진균, 피치아 파스토리스(Pichia pastoris), 사카로마이세스 세레비지애(Saccharomyces cerevisiae), 쉬조사카로마세스 속(Schizosaccharomyces sp.) 및 뉴로스포라 크라사(Neurospora crassa)와 같은 효모, 그 밖의 하등진핵 세포, 및 곤충으로부터의 세포와 같은 고등 진핵생물의 세포와 같은 진핵 세포일 수 있다.
또한 식물이나 포유동물로부터 유래할 수 있다. 바람직하게는, 원숭이 신장 세포7(COS7; monkey kidney cells)세포, NSO 세포, SP2/0 세포, 차이니즈 햄스터 난소(CHO; Chinese hamster ovary) 세포, W138, 어린 햄스터 신장(BHK; baby hamster kidney)세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK293 세포 등이 이용 가능하지만 이에 한정되지 않는다. 특히 바람직하게는 CHO 세포가 사용될 수 있다.
상기 핵산 또는 상기 벡터는 숙주세포에 형질주입 또는 트랜스펙션(transfection)된다. “형질주입” 또는 “트랜스펙션”시키기 위해 원핵 또는 진핵 숙주세포 내로 외인성 핵산(DNA 또는 RNA)을 도입하는 데에 통상 사용되는 여러 종류의 다양한 기술, 예를 들어 전기 영동법, 인산칼슘 침전법, DEAE-덱스트란 트랜스펙션 또는 리포펙션(lipofection) 등을 사용할 수 있다. 본 발명에 따른 항-글리피칸 3 항체를 발현시키기 위해 다양한 발현 숙주/벡터 조합이 이용될 수 있다. 진핵숙주에 적합한 발현벡터로는 이들로 한정되는 것은 아니지만 SV40, 소 유두종바이러스, 아네노바이러스, 아데노-연관 바이러스(adeno-associated virus), 시토메갈로바이러스 및 레트로바이러스로부터 유래된 발현 조절 서열이 포함된다. 세균 숙주에 사용할 수 있는 발현벡터에는 pET, pRSET, pBluescript, pGEX2T, pUC벡터, col E1, pCR1, pBR322, pMB9 및 이들의 유도체와 같이 대장균(Escherichia coli)에서 얻어지는 세균성 플라스미드, RP4와 같이 보다 넓은 숙주 범위를 갖는 플라스미드, λgt10과 λgt11, NM989와 같은 매우 다양한 파지 람다(phage lambda) 유도체로 예시될 수 있는 파지 DNA, 및 M13과 필라멘트성 단일가닥의 DNA 파지와 같은 기타 다른 DNA 파지가 포함된다. 효모 세포에 유용한 발현벡터는 2℃ 플라스미드 및 그의 유도체이다. 곤충 세포에 유용한 벡터는 pVL941이다.
본 발명은 또 다른 관점에서, 상기 숙주세포를 배양하여 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 발현시키는 단계를 포함하는 항-PSMA 항체 또는 이의 항원 결합 단편의 제조 방법에 관한 것이다.
상기 항-PSMA 또는 이의 항원 결합 단편을 발현할 수 있는 재조합 발현벡터가 포유류 숙주세포 내로 도입될 경우 항체는 숙주세포에서 항체가 발현되게 하기에 충분한 기간 동안, 또는 더 바람직하게는 숙주세포가 배양되는 배양 배지 내로 항체가 분비되게 하기에 충분한 기간 동안 숙주세포를 배양함으로써 제조될 수 있다.
경우에 따라서, 발현된 항체는 숙주세포로부터 분리하여 균일하도록 정제할 수 있다. 상기 항체의 분리 또는 정제는 통상의 단백질에서 사용되고 있는 분리, 정제 방법, 예를 들어 크로마토그래피에 의해 수행될 수 있다. 상기 크로마토그래피는 예를 들어, 프로틴 A 컬럼, 프로틴 G 컬럼을 포함하는 친화성 크로마토그래피, 이온 교환 크로마토그래피 또는 소수성 크로마토그래피를 포함할 수 있다. 상기 크로마토그래피 이외에, 추가로 여과, 초여과, 염석, 투석 등을 조합함으로써 항체를 분리, 정제할 수 있다.
본 발명은 또 다른 관점에서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편에 약물이 접합된 항체-약물 접합체(Antibody-drug conjugate; ADC)에 관한 것이다.
항체-약물 접합체는 타겟 암세포로 항암 약물을 전달하기 전까지 항암 약물이 항체에 안정적으로 결합되어 있어야 한다. 타겟으로 전달된 약물은 항체로부터 유리되어 타겟 세포의 사멸을 유도해야 한다. 이를 위해서는 약물이 항체에 안정적으로 결합함과 동시에 타겟 세포에서 유리될 때는 타겟 세포의 사멸을 유도할 충분한 세포독성을 가져야 한다.
본 발명에 있어서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편과 항암제 등 약물을 포함하는 세포독성물질은 서로 결합(예컨대, 공유결합, 펩타이드 결합 등에 의함)되어 접합체(conjugate) 또는 융합 단백질(세포독성물질 및/또는 표지물질이 단백질인 경우)의 형태로 사용될 수 있다. 상기 세포독성물질은 암세포, 특히 고형암세포에 대하여 독성을 갖는 모든 물질일 수 있으며, 방사선동위원소, 세포 독소 화합물(small molecule), 세포 독성 단백질, 항암제 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되는 것은 아니다. 상기 세포 독소 단백질은 리신(ricin), 사포린(saporin), 젤로닌(gelonin), 모로딘(momordin), 데보가닌(debouganin), 디프테리아독소, 녹농균독소(pseudomonas toxin) 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되는 것은 아니다. 상기 방사선동위원소로는 131I, 188Rh, 90Y 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되는 것은 아니다. 상기 세포 독소 화합물은 듀오카마이신(duocarmycin), 모노메틸 아우리스타틴 E(monomethyl auristatin E; MMAE), 모노메틸 아우리스타틴 F(monomethyl auristatin F; MMAF), N2'-디아세틸-N2'-(3-머캅토-1-옥소프로필)메이탄신(N2'-deacetyl-N2'-(3-mercapto-1-oxopropyl)maytansine; DM1), PBD(Pyrrolobenzodiazepine) dimer 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 항체-약물 접합체는 본 발명이 속하는 기술분야에 잘 알려진 기술에 따른 것일 수 있다.
본 발명에 있어서, 상기 항체-약물 접합체는 상기 항체 또는 이의 항원 결합 단편이 링커를 통하여 약물과 결합되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 링커는 절단성 링커 또는 비절단성 링커인 것을 특징으로 할 수 있다.
상기 링커는 항-PSMA 항체와 약물 사이를 연결하는 부위로, 예를 들어 상기 링커는 세포 내 조건에서 절단 가능한 형태 즉, 세포 내 환경에서 항체에서 약물이 링커의 절단을 통해 방출될 수 있도록 한다.
상기 링커는 세포 내 환경 예를 들어 리소좀 또는 엔도좀에 존재하는 절단제에 의해 절단될 수 있으며, 세포 내 펩티다아제 또는 프로테아제 효소 예를 들어 리소좀 또는 엔도좀 프로테아제에 의해 절단될 수 있는 펩타이드 링커일 수 있다. 일반적으로 펩타이드 링커는 적어도 2개 이상의 아미노산 길이를 가진다. 상기 절단제는 카텝신 B 및 카텝신 D, 플라스민을 포함할 수 있으며, 펩타이드를 가수분해 하여 약물을 표적 세포 내로 방출할 수 있도록 한다. 상기 펩타이드 링커는 티올 의존성 프로테아제 카텝신-B에 의해 절단될 수 있고, 이는 암 조직에서 고발현되며, 예를 들어 Phe-Leu 또는 Gly-Phe-Leu-Gly 링커가 사용될 수 있다. 또한, 상기 펩타이드 링커는 예를 들어 세포 내 프로테아제에 의해 절단될 수 있는 것으로, Val-Cit 링커이거나 Phe-Lys 링커일 수 있다.
본 발명에 있어서, 상기 절단성 링커는 pH 민감성으로, 특정 pH 값에서 가수분해에 민감할 수 있다. 일반적으로, pH 민감성 링커는 산성 조건에서 가수분해될 수 있음을 나타낸다. 예를 들어, 리소좀에서 가수분해될 수 있는 산성 불안정 링커 예를 들어, 하이드라존, 세미카바존, 티오세미카바존, 시스-아코니틱 아마이드(cis-aconitic amide), 오르쏘에스테르, 아세탈, 케탈 등일 수 있다.
상기 링커는 환원 조건에서 절단될 수도 있으며, 예를 들어 이황화 링커가 이에 해당할 수 있다. SATA(N-succinimidyl-S-acetylthioacetate), SPDP(N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB(N-succinimidyl-3-(2-pyridyldithio)butyrate) 및 SMPT(N-succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene)를 사용하여 다양한 이황화 결합이 형성될 수 있다.
본 발명에 있어서, 상기 약물 및/또는 약물-링커는 항체의 라이신을 통해 무작위로 접합되거나, 이황화 결합 사슬을 환원하였을 때 노출되는 시스테인을 통해 접합될 수 있다. 경우에 따라서, 유전공학적으로 제작된 태그 예를 들어, 펩타이드 또는 단백질에 존재하는 시스테인을 통해 링커-약물이 결합될 수 있다. 상기 유전공학적으로 제작된 태그 예를 들어, 펩타이드 또는 단백질은 예를 들어, 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 아미노산 모티프를 포함할 수 있다. 상기 펩타이드 또는 단백질은 펩타이드 또는 단백질의 카복시 말단에서 결실(deletion)을 가지거나, 펩타이드 또는 단백질의 카복시(C) 말단에 스페이서 유닛의 공유결합을 통한 부가를 갖는다. 상기 펩타이드 또는 단백질은 아미노산 모티프와 바로 공유결합 되거나, 스페이서 유닛과 공유결합 되어 아미노산 모티프와 연결될 수 있다. 상기 아미노산 스페이서 유닛은 1 내지 20개의 아미노산으로 구성되며, 그 중에서 글리신(glycine) 유닛이 바람직하다.
상기 링커는 리소좀에서 다수 존재하거나, 또는 몇몇 종양세포에서 과발현되는 베타-글루쿠로니데이즈(β-glucuronidase)에 의해 인식되어 가수분해 되는 베타-글루쿠로나이드 링커를 포함할 수 있다. 펩타이드 링커와는 달리 친수성(hydrophilicity)이 커서 소수성의 성질이 높은 약물과 결합시 항체-약물 복합체의 용해도를 증가시킬 수 있는 장점을 지닌다.
이와 관련하여, 본 발명에서는 대한민국 특허공개공보 제2015-0137015호에 개시된 베타-글루쿠로나이드 링커, 예를 들어 자가-희생기(self-immolative group)를 포함하는 베타-글루쿠로나이드 링커를 사용할 수 있다.
또한, 상기 링커는 예를 들어 비절단성 링커일 수 있으며, 항체 가수분해 한 단계만을 통해 약물이 방출되어, 예를 들어 아미노산-링커-약물 복합체를 생산한다. 이러한 유형의 링커는 티오에테르기 또는 말레이미도카프로일기(maleimidocaproyl)일 수 있고, 혈액 내 안정성을 유지할 수 있다.
본 발명에 있어서, 상기 약물은 화학요법제, 독소, 마이크로 RNA(miRNA), siRNA, shRNA 또는 방사성 동위원소인 것을 특징으로 할 수 있다. 상기 약물은 약리학적 효과를 나타내는 제제로 항체에 결합될 수 있다.
상기 화학요법제는 세포독성 제제 또는 면역억제제일 수 있다. 구체적으로 마이크로투불린 억제제, 유사분열 억제제, 토포이소머라아제 억제제, 또는 DNA 인터컬레이터로서 기능할 수 있는 화학요법제를 포함할 수 있다. 또한, 면역조절 화합물, 항암제, 항바이러스제, 항박테리아제, 항진균제, 구충제 또는 이들의 조합을 포함할 수 있다.
상기 약물에는 예를 들어, 마이탄시노이드, 오리스타틴, 아미노프테린, 악티노마이신, 블레오마이신, 탈리도마이드, 캄프토쎄신, N8-아세틸 스퍼미딘, 1-(2 클로로에틸)-1,2-다이메틸 술포닐 하이드라자이드, 에스퍼라마이신, 에토포사이드, 6-머캅토퓨린, 돌라스타틴, 트리코테센, 칼리케아미신, 탁솔(taxol), 탁산, 파클리탁셀(paclitaxel), 도세탁셀(docetaxel), 메토트렉세이트, 빈크리스틴, 빈블라스틴, 독소루비신, 멜팔란, 클로람부실, 듀오카마이신, L-아스파라기나제(L-asparaginase), 머캡토퓨린(mercaptopurine), 티오구아닌(thioguanine), 하이드록시우레아(hydroxyurea), 시타라빈(cytarabine), 사이클로포스파미드(cyclophosphamide), 이포스파미드(ifosfamide), 니트로소우레아(nitrosourea), 시스플라틴(cisplatin), 카보플라틴(carboplatin), 미토마이신(mitomycin; 미토마이신 A, 미토마이신 C), 다카바진(dacarbazine), 프로카바진(procarbazine), 토포테칸(topotecan), 질소 머스터드(nitrogen mustard), 사이톡산(cytoxan), 5-플루오로우라실(5-fluorouracil), CNU(bischloroethylnitrosourea), 이리노테칸(irinotecan), 캄포토테신(camptothecin), 이다루비신(idarubicin), 다우노루비신(daunorubicin), 닥티노마이신(dactinomycin), 플리카마이신(plicamycin), 아스파라기나제(asparaginase), 비노렐빈(vinorelbine), 클로로람부실(chlorambucil), 멜파란(melphalan), 카르무스틴(carmustine), 로무스틴(lomustine), 부설판(busuLfan), 트레오설판(treosulfan), 데카바진(decarbazine), 테니포시드(teniposide), 토포테칸(topotecan), 9-아미노캠프토테신(9-aminocamptothecin), 크리스나톨(crisnatol), 트리메트렉세이트(trimetrexate), 마이코페놀산(mycophenolic acid), 티아조퓨린(tiazofurin), 리바비린(ribavirin), EICAR(5-ethynyl-1-beta-Dribofuranosylimidazole-4-carboxamide), 하이드록시우레아(hydroxyurea), 데프록사민(deferoxamine), 플룩수리딘(floxuridine), 독시플루리딘(doxifluridine), 랄티트렉세드(raltitrexed), 시타라빈(cytarabine(ara C)), 시토신 아라비노시드(cytosine arabinoside), 플루다라빈(fludarabine), 타목시펜(tamoxifen), 라록시펜(raloxifene), 메게스트롤(megestrol), 고세렐린(goserelin), 류프롤리드 아세테이트(leuprolide acetate), 플루타미드(flutamide), 바이칼루타마이드(bicalutamide), EB1089, CB1093, KH1060, 베르테포르핀(verteporfin), 프탈로시아닌(phthalocyanine), 광감작제 Pe4(photosensitizer Pe4), 데메톡시-하이포크레린 A(demethoxy-hypocrellin A), 인터페론-α(Interferon-α), 인터페론-γ(Interferon-γ), 종양 괴사 인자(tumor necrosis factor), 젬시타빈(Gemcitabine), 벨케이드(velcade),레블리미드(Revlimid), 로바스타틴(lovastatin), 1-메틸-4-페닐피리디늄 이온(1-methyl-4-phenylpyridiniumion), 스타우로스포린(staurosporine), 악티노마이신 D(actinomycin D), 닥티노마이신(dactinomycin), 블레오마이신 A2(bleomycin A2), 블레오마이신 B2(bleomycinB2), 페플로마이신(peplomycin), 에피루비신(epirubicin), 피라루비신(pirarubicin), 조루비신(zorubicin), 마이토산트론(mitoxantrone), 베라파밀(verapamil) 및 탑시가르긴(thapsigargin), 핵산 분해 효소 및 세균이나 동식물 유래의 독소로 구성된 군에서 선택된 하나 이상일 수 있으나, 이에 한정되는 것은 아니다.
본 발명에 있어서, 상기 약물은 링커 및 링커 시약 상의 친전자성 기와 공유결합을 형성하기 위해 반응할 수 있는 아민, 티올, 히드록실, 히드라지드, 옥심, 히드라진, 티오세미카바존, 히드라진 카르복실레이트, 및 아릴히드라지드기로 구성된 군에서 선택된 하나 이상의 친핵기를 포함할 수 있다.
본 발명은 또 다른 관점에서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 이중특이 항체(bispecific antibody)에 관한 것이다.
본 발명에 있어서, 상기 이중특이 항체는 항체의 2개의 암(arm) 중에서, 하나의 암(arm)은 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하고, 나머지 다른 암(arm)은 PSMA 이외의 다른 항원, 바람직하게는 암 관련 항원 또는 면역관문 단백질 항원에 특이적인 항체, 또는 면역효능세포 관련 항원에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 포함하는 형태를 의미한다.
상기 이중특이 항체에 포함되는 항-PSMA 항체 이외의 항체가 결합하는 항원은, 바람직하게는 암 관련 항원 또는 면역관문 단백질 항원으로 HGF, EGFR, EGFRvIII, Her2, Her3, IGF-1R, VEGF, VEGFR-1, VEGFR-2, VEGFR-3, Ang2, Dll4, NRP1, FGFR, FGFR2, FGFR3, c-Kit, MUC1, MUC16, CD20, CD22, CD27, CD30, CD33, CD40, CD52, CD70, CD79, DDL3, Folate R1, Nectin 4, Trop2, gpNMB, Axl, BCMA, PD-1, PD-L1, PD-L2, CTLA4, BTLA, 4-1BB, ICOS, GITR, OX40, VISTA, TIM-3, LAG-3, KIR, B7.1, B7.2, B7-H2, B7-H3, B7-H4, B7-H6, B7-H7, EphA2, EphA4, EphB2, E-셀렉틴(selectin), EpCam, CEA, PSMA, PSA, c-MET 등에서 선택될 수 있고, 면역효능세포 관련 항원으로는 TCR/CD3, CD16(FcγRIIIa) CD44, CD56, CD69, CD64(FcγRI), CD89, CD11b/CD18(CR3) 등이 선택될 수 있지만, 이에 한정되는 것은 아니다.
본 발명은 또 다른 관점에서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 키메라 항원 수용체(chimeric antigen receptor; CAR)에 관한 것이다.
CAR는 항원 결합 도메인(antigen binding domain), 막통과 도메인(transmembrane domain) 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함할 수 있으며, 항원 결합 도메인은 링커에 의해 막통과 도메인에 연결될 수 있다. 항원 결합 도메인을 포함하는 세포외 도메인은 또한 신호 펩티드를 포함할 수 있다.
본 발명은 또 다른 관점에서, 상기 키메라 항원 수용체를 함유하는 면역세포에 관한 것이다.
상기 면역세포는 상기 키메라 항원 수용체를 발현하도록 유전적으로 변형된 세포를 포함하며, 바람직하게는 T 세포 또는 NK 세포인 것을 특징으로 할 수 있다.
PSMA 단백질의 발현은 여러 질병, 예컨대 암과 관련이 있으므로, 본 발명은 또 다른 관점에서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물 및 대상체로부터 분리된 생물 시료에 상기 항-PSMA 항체 또는 이의 항원 결합 단편을 처리(투여)하는 단계를 포함하는 암의 검출 또는 진단방법, 검출 또는 진단을 위한 정보를 제공하는 방법에 관한 것이다.
상기 검출 또는 진단방법은, 상기 처리하는 단계 이후에, 항원-항체 반응 여부를 확인하는 단계를 추가로 포함하는 것일 수 있다. 상기 방법에서, 항원-항체 반응이 탐지되는 경우, 상기 생물 시료 또는 상기 생물 시료가 유래된 환자에 PSMA 관련 질병, 예컨대 암이 존재하는 것으로 결정(판단)할 수 있다. 따라서, 상기 방법은 상기 확인하는 단계 이후에, 항원-항체 반응이 탐지되는 경우, 상기 생물 시료 또는 상기 환자를 PSMA 관련 질병 환자, 예컨대 암 환자로 결정하는 단계를 추가로 포함할 수 있다. 상기 생물 시료는 포유류, 예컨대 인간(예컨대 암환자)으로부터 얻은(분리된) 세포, 조직, 체액, 이들의 배양물 등으로 이루어진 군에서 선택된 것일 수 있다.
상기 항원-항체 반응 여부를 확인하는 단계는 당업계에 공지된 다양한 방법을 통하여 수행할 수 있다. 예컨대, 통상적인 효소 반응, 형광, 발광 및/또는 방사선 검출을 통하여 하여 측정될 수 있으며, 구체적으로, 면역크로마토그래피(Immunochromatography), 면역조직화학염색(Immunohistochemistry), 효소결합 면역흡착 분석(enzyme linked immunosorbent assay; ELISA), 방사선 면역측정법(radioimmunoassay; RIA), 효소 면역분석(enzyme immunoassay; EIA), 형광면역분석(Floresence immunoassay; FIA), 발광면역분석(luminescence immunoassay; LIA), 웨스턴블라팅(Western blotting), 마이크로어레이, 면역침강분석 등으로 이루어진 군으로부터 선택된 방법에 의하여 측정될 수 있으나, 이에 제한되는 것은 아니다.
이 때, 상기 항-PSMA 항체 또는 이의 항원 결합 단편은 표지물질을 추가로 포함하는 것일 수 있다. 상기 표지 물질은 방사선동위원소, 형광 물질, 크로모젠(chromogen), 염색 물질 등으로 이루어진 군에서 선택된 1종 이상일 수 있다. 상기 표지물질은 상기 항체 또는 항원 결합 단편에 통상적인 방법(예컨대, 공유결합, 배위결합, 이온결합 등의 화학결합)으로 결합(연결)된 것일 수 있다. 상기 항체(또는 항원 결합 단편)과 표지물질의 결합은 본 발명이 속하는 기술분야에 잘 알려진 기술에 따른 것일 수 있다.
본 발명은 또 다른 관점에서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체-약물 접합체, 상기 이중특이 항체 또는 상기 키메라 항원 수용체를 포함하는 암의 예방 또는 치료용 약학 조성물에 관한 것이다.
본 발명은 또 다른 관점에서, 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체-약물 접합체, 상기 이중특이 항체 또는 상기 키메라 항원 수용체를 대상체에 투여하는 단계를 포함하는 암의 예방 또는 치료방법에 관한 것이다.
본 발명은 또 다른 관점에서, 암의 예방 또는 치료를 위한 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체-약물 접합체, 상기 이중특이 항체 또는 상기 키메라 항원 수용체의 용도에 관한 것이다.
본 발명은 또 다른 관점에서, 암의 예방 또는 치료용 약제 제조를 위한 상기 항-PSMA 항체 또는 이의 항원 결합 단편, 상기 항체-약물 접합체, 상기 이중특이 항체 또는 상기 키메라 항원 수용체의 사용에 관한 것이다.
본 명세서에서, 용어 “예방”은 본 발명의 조성물의 투여로 암을 억제시키거나 진행을 지연시키는 모든 행위를 의미하며, “치료”는 암의 발전의 억제, 증상의 경감 또는 제거를 의미한다.
본 발명에 있어서, 상기 암은 PSMA의 발현 또는 과발현과 관련된 것일 수 있다.
본 발명에 있어서, “암”과 “종양”은 동일한 의미로 사용되며, 전형적으로 조절되지 않은 세포 성장/증식을 특징으로 하는 포유동물의 생리학적 상태를 지칭하거나 의미한다.
PSMA는, 일부 전립선 세포가 비정상적으로 보이고 거동하기 시작한 질환인 전립선 상피내 신생종(PIN); 원발성 및 전이성 전립선암; 및 다른 고형 종양(예를 들어, 유방, 폐, 방광, 신장)의 신생혈관계에서 빈번하게 과발현되는 전립선암 관련 세포막 항원이다. 일 실시예에서, 상기 암은 전립선암, 결직장암, 위암, 투명 세포 신장 암종(clear cell renal carcinoma), 방광암, 폐암, 자궁내막암, 신장암, 구강의 편평세포 암종, 교종 및 유방암과 같은 암의 혈관신생 또는 혈관계와 관련된다.
일 실시예에서, 상기 암은 신생혈관성 장애, 예컨대 고형 종양 성장을 특징으로 하는 암이다. PSMA 과발현을 특징으로 하고 본 발명에 따른 치료에 적합한 종양 혈관계를 갖는 예시적인 암은, 예를 들어 투명 세포 신장 암 종(CCRCC), 결직장암, 유방암, 방광암, 폐암, 및 췌장암을 포함한다(Angelo Baccala, et al., Urology, 2007 Aug;70(2):385-90; He Liu, et al., CANCER RESEARCH, 1997 Sep 1;57(17):3629-34).
바람직하게는, 상기 암은 전립선암, 폐암, 아교모세포종, 신장암, 방광암, 고환암, 내분비암, 결장암, 위암, 췌장암, 대장암, 난소암, 유방암, 악성 흑색종, 백혈병 또는 악성 림프종인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 약학 조성물은 치료 유효량의 항-PSMA 항체 또는 이의 항원 결합 단편 및 약제학적으로 허용되는 담체를 포함하는 것을 특징으로 할 수 있다.
상기 “약제학적으로(제약상) 허용되는 담체”는 제제를 제제화하거나 또는 안정화시키는 것을 돕기 위해서 활성 성분에 추가될 수 있는 물질이고, 환자에게 유의한 해로운 독성 효과를 야기하지 않는다. 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다.
상기 약학 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences(19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약학 조성물은 경구투여 또는 비경구로 투여할 수 있고, 예컨대 주입(infusion), 정맥내 투여(intravenous injection), 근육내 투여(intramuscular injection), 피하 투여(subcutaneous injection), 복강내 투여(intraperitoneal injection), 직장내 투여(Intrarectal administration), 국소 투여(topical administration), 비내 투여(intranasal injection) 등으로 투여될 수 있지만, 이에 한정되는 것은 아니다.
본 발명의 약학 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 명세서에서 용어 “약제학적 유효량”은 암의 예방 또는 치료하는 데 충분한 양을 의미한다.
본 발명에 따른 약학 조성물은 종래의 치료제와 병용하여 사용하는 용도로 사용될 수 있다. 즉, 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편, 및 이를 포함하는 약학 조성물은 기존의 항암제 등의 치료제와 동시에 투여되거나, 순차적 또는 역순으로 투여될 수 있음을 의미하는 것으로, 통상의 기술자의 범위 내 적절한 유효량의 조합으로 투여될 수 있다.
상기 다른 암 치료제는 본 발명에 따른 항-PSMA 항체 또는 이의 항원 결합 단편 이외에, 암 치료를 위해 사용될 수 있는 모든 치료제를 의미한다. 본 발명에 있어서, 상기 암 치료제는 면역관문억제제인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 면역관문억제제는 immune checkpoint inhibitor 또는 checkpoint inhibitor를 의미하고, 항-CTLA-4 항체, 항-PD-1 항체 또는 항-PD-L1 항체인 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니며, 구체적으로는 이필리무맙(Ipilimumab), 니볼루맙(Nivolumab), 펨브롤리주맙(Pembrolizumab), 아테졸리주맙(Atezolizumab), 아벨루맙(Avelumab) 또는 더발루맙(Durvalumab) 등이 사용될 수 있지만, 이에 한정되는 것은 아니다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
1:
PSMA
타겟
항체 확보를 위한 마우스 면역
인간 PSMA 타겟 단클론 항체의 제작을 위하여 마우스를 이용한 면역화를 실시하였다. Balb/c 마우스 4.5주령의 암컷 마우스에 인간 PSMA 단백질(sinobiological, 중국, cat no. HPLC-15877-H07H)을 투여하여 면역하였다. 마우스에 투여한 1mg/mL의 인간 PSMA 단백질은 TiterMax Gold Adjuvant(T2684, Merk sigma-aldrich, 미국)와 1:1(v/v)로 1시간동안 혼합한 뒤, 주사기를 이용하여 혼합물을 마리당 200μl씩 복강에 투여하였다. 최초 투여 2주 후에 인간 PSMA 단백질 100μg을 3차 증류수 100μl에 녹여 마리당 인간 PSMA 단백질 100μg을 복강 투여하였다. 이후, 6일 후에 희생시킨 뒤, 하이브리도마 세포 제작에 사용하였다.
실시예
2:
하이브리도마
세포의 제작 및 배양
PSMA 면역화된 BALB/c의 림프절과 비장을 적출하고 DMEM(Welgene, 대한민국, cat. No. LM011-01)에서 세척하였다. 조직을 으깨어 DMEM에 림프구를 현탁하고, Cell strainer(Corning, 미국, cat No. 431752)를 사용하여 B cell을 조직으로부터 분리시켰다. 1000rpm, 25℃ 조건으로 원심 분리하여 상층액을 버리고 DMEM으로 세척하였다. 얻어진 B cell 중에서 Anti-Mouse IgG에 positive한 B cell을 얻고자 MACS(Magnetic-activated cell sorting)를 사용하였다. Anti-Mouse IgG에 positive한 B cell을 얻는 방법은 Anti-Mouse IgG MicroBeads(Miltenyi Biotec, 독일, cat. No. 130-048-401)의 사용법을 준수하여 진행하였다. 분리된 B cell과 myeloma cell(Sp2/0-Ag14)을 혼합하고 1000rpm, 25℃ 조건으로 원심 분리하여 상층액을 제거하였다. Electro cell fusion buffer(ECF buffer)[0.3M mannitol(Sigma-Aldrich, 미국, cat No. M9647), 0.1mM calcium chloride(Sigma-Aldrich, 미국, cat No. C3306), 0.1mM magnesium chloride(Sigma-Aldrich, 미국, cat No. M8266)]로 세척하고, 1000rpm, 25℃ 조건으로 원심 분리하여 상층액을 제거하였다. Cell pellet을 ECF buffer로 고르게 풀어주고 Electrode(NEPAGENE, 일본, cat No. CUYP8X10)에 넣어 전압을 걸어주어 세포 융합하였다. 전압은 Electrode에 연결된 Electro Cell Fusion Generator(NEPAGENE, 일본, cat. No. ECFG21)를 사용하여 걸어주었다. 원심 분리하여 상층액을 제거하고, 20% FBS(Gibco, 미국, cat No. 16250-078)와 1% Penicillin/streptomycin(Gibco, USA, cat No. 15140-122), 1X HAT(Sigma, 미국, cat No. H0262)이 포함된 DMEM(Welgene, 대한민국, LM011-01) 배지로 현탁하여 T175 플라스크(Thermo Scientific, 미국, cat. No.159910)에 분주하여 CO2 incubator에서 배양하였다. HGPRT negative인 myeloma cell은 Aminopterin의 영향으로 DNA 합성 경로를 저해받아 소멸되고, HGPRT positive로 DNA 합성에 문제가 없는 B cell은 자연스럽게 소멸되는 과정을 거친다. myeloma와 B cell이 세포 융합된 경우에만 살아남도록 하는 HAT selection 과정을 통해 하이브리도마 세포를 얻었다. HAT selection 과정을 거친 하이브리도마 세포로 단클론화 과정을 거쳐 후보 항체를 분비하는 하이브리도마 세포를 얻었다.
PSMA 타겟 후보 항체는 하이브리도마 배양 과정에서 배양액으로 분비되는 항체를 정제하는 방법으로 얻어졌다. 후보 항체 확보를 위하여 1X107cells의 하이브리도마와 10% FBS(Gibco, 미국, cat no. 16250-078)와 1% Penicillin/streptomycin(Gibco, USA, cat no. 15140-122), 1X HAT(Sigma, 미국, Cat no. H0262)가 포함된 DMEM(Welgene, 대한민국, LM011-01) 배지 40mL을 T175 플라스크(Thermo Scientific, 미국, cat. No.159910)에 넣었다. 이후, 5% CO2, 37℃, humidity 조건에서 7일간 배양하였다. 7일 동안 배양한 뒤, 4000xg, 4℃ 조건으로 원심 분리하여 세포를 제거하고 얻어진 상층액을 이용하여 정제하였다.
실시예
3:
PSMA에
결합하는 항체의 정제
후보 항체의 IgG Purification은 Column(BIO RAD, 미국, 737212)에 Protein G resin(GE Healthcare, 미국, 17-0618-05) 2ml를 packing한 후 10 컬럼 볼륨의 Distilled Water로 rinse 해준다. 10 컬럼 볼륨의 1xPBS(10XPBS를 1/10로 희석, Wellgene, 대한민국, ML008-02)로 resin을 equilibrium시킨 뒤 resin에 culture sup 180ml을 loading하였다. Loading이 완료되면 10 컬럼 볼륨의 1xPBS로 resin을 2회 wash하였다. 3 컬럼 볼륨의 0.1M Glycine pH 2.5(SAMCHUN, 대한민국, 000G0286) elution을 하였고 0.5 컬럼 볼륨씩 6개 fraction으로 나눠 확보하였다. Elution fraction을 중화하기 위해 0.4M NaHCO3 0.2ml(pH 11)을 각 fraction에 넣어주고 샘플 elution과 잘 섞이도록 inverting하였다. 정제된 항체는 Centricon(Millipore, 독일, UFC905096)을 이용하여 4000rpm의 속도로 25분간 상온에서 원심분리 하여 농축하였다. 항체 정제 결과는 UV spectrometer(Mettler Toledo, 미국, UV5Nano)로 농도를 확인하고 항체의 패턴은 SDS-PAGE(Thermo, 미국, XP04200BOX)와 UV spectrometer(Mettler Toledo, 미국, UV5Nano)로 확인하였다. 후보 항체 PSAM10-1 A2 culture sup 180ml 정제 후 1.2mg을 확보하였고, PSMA15-1 B9 culture sup 180ml 정제 후 0.8mg을 확보하였다. 정제된 항체의 SDS-PAGE 결과는 positive control 1mg/ml Adalimumab을 대조군으로 비교하였다(도 1).
실시예
4:
PSMA
타겟
항체의
Isotype
확인
PSMA 타겟 항체의 Isotype 확인은 Rapid ELISA Mouse mAb Isotyping Kit(Invitrogen, 미국, 37503)를 사용하여 수행하였다. Kit 구성품 Pre-coated 96-well Isotyping Plates, Goat Anti-Mouse IgG+IgA+IgM-HRP Conjugates, 30X Wash Buffer, BupH Tris Buffered Saline, TMB Substrate, Stop Solution을 사용하였다. 후보 PSMA 타겟 항체는 BupH Tris Buffered Saline에 250ng/ml, 25ng/ml이 되도록 희석하여 분석하였다. Heavy chain IgG1, Light chain Kappa로 확인되었으며, Isotype identification 결과를 하기 표 1에 나타내었다.
PSMA 타겟 항체 | ||
concentration | 250ng/ml | 25ng/ml |
IgG1 | 2.6481 | 0.5856 |
IgG2a | 0.1157 | 0.0778 |
IgG2b | 0.1023 | 0.0651 |
IgG3 | 0.0786 | 0.0715 |
IgA | 0.0629 | 0.0607 |
IgM | 0.1115 | 0.0706 |
Kappa | 0.5365 | 0.1802 |
Lambda | 0.0688 | 0.0607 |
실시예
5:
PSMA
타겟
항체의 서열 분석
후보 항체의 DNA 서열 분석은 후보 항체가 발현되는 하이브리도마의 mRNA 추출과 cDNA 합성, PCR 실험을 통해 분석하는 방법으로 수행되었다. 해당 실험은 와이바이오로직스(대한민국, 대전광역시)에 위탁하여 수행하였다. 위탁 연구 의뢰를 위하여 후보 항체가 발현되는 하이브리도마 1X106 cells을 냉동 상태로 전달하였다. 분석 의뢰를 통해 확보한 PSMA 타겟 후보 항체의 CDR 및 가변영역 서열은 각각 표 2 및 표 3에 나타내었으며, 가변영역을 코딩하는 폴리뉴클레오티드 서열은 표 4에 나타내었다.
CDR 서열 | 서열번호 | ||
Heavy Chain | CDRH1 | GYAFSSSWMN | 1 |
CDRH2 | RIYPADGDTNYNGKFKG | 2 | |
CDRH3 | CGWDGGVYYAMDY | 3 | |
Light Chain | CDRL1 | RASKSVTTSGYSYMH | 4 |
CDRL2 | LASNLES | 5 | |
CDRL3 | QHSRELPRT | 6 |
가변영역 아미노산 서열 | 서열번호 | |
중쇄 | EVQLQQSGPELVKPGASVKISCKASGYAFSSSWMNWVKQRPGQGLEWIGRIYPADGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSVDSAVYFCARCGWDGGVYYAMDYWGQGTSVTVSS | 7 |
경쇄 | DIVMTQSPASLAVSLGQRATISCRASKSVTTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHSRELPRTFGGGTKLEIK | 8 |
폴리뉴클레오티드 서열 | 서열번호 | |
중쇄 | GAGGTCCAGCTGCAACAATCTGGACCTGAGCTGGTGAAGCCTGGGGCCTCAGTGAAGATTTCCTGCAAAGCTTCTGGCTACGCATTCAGTAGCTCTTGGATGAACTGGGTGAAGCAGAGGCCTGGACAGGGTCTTGAGTGGATTGGACGGATTTATCCTGCAGATGGAGATACTAACTACAATGGGAAGTTCAAGGGCAAGGCCACACTGACTGCAGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACCTCTGTGGACTCTGCGGTCTATTTCTGTGCAAGATGCGGCTGGGACGGGGGGGTTTACTATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA | 9 |
경쇄 | GACATTGTGATGACCCAGTCTCCTGCTTCCTTAGCTGTATCTCTGGGGCAGAGGGCCACCATCTCATGCAGGGCCAGCAAAAGTGTCACTACATCTGGCTATAGTTATATGCACTGGTACCAACAGAAACCAGGACAGCCACCCAAACTCCTCATCTATCTTGCATCCAACCTAGAATCTGGGGTCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACCCTCAACATCCATCCTGTGGAGGAGGAGGATGCTGCAACCTATTACTGTCAGCACAGTAGGGAGCTTCCTCGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAA | 10 |
실시예
6:
PSMA
타겟
항체의
MMAE
conjugation을 통한
ADC
제작
PSMA 타겟 항체의 항체-약물 접합 형태일 때의 세포 독성 확인을 위한 MMAE conjugation은 antibody MMAE Conjugation Kit(With VC-PAB Linkage) (Cell mosaic, 미국, CM11409)를 사용하여 제공된 protocol대로 수행하였다. PSMA 타겟 항체를 1mg씩 각 준비하여 Conjugation하였고 DAR은 O.D. 248nm와 O.D. 280nm의 값을 측정한 뒤, Cell mosaic에서 제시하는 공식을 통해 계산하였다. 해당 공식을 통해 DAR이 8.36임을 확인하였고, 측정 결과는 하기 표 5에 나타내었다.
PSMA 타겟 항체 | |
OD248 | 0.815 |
OD280 | 0.804 |
R | 1.01 |
DAR | 8.36 |
실시예
7:
PSMA
타겟
항체-약물 접합체의 세포 독성 확인
항체-약물 접합체의 세포 독성 확인을 위하여 LNCaP cell(ATCC, 미국)과 PC3 cell(ATCC, 미국)을 사용하였다. LNCaP 세포는 세포 표면에 PSMA가 발현되는 세포이며, PC3는 PSMA가 발현되지 않는 세포이다. 본 실시예에서 PC3는 후보 항체-약물 접합체의 PSMA 특이적 세포 독성을 확인하기 위한 음성 대조군으로서 실험에 사용되었다.
LNCaP 세포와 PC3 세포는 각 5X104cell/100μl/well, 2X104cells/100μl/well로 96 well 플레이트(Corning, Inc., 미국, cat. No. 3596)에 넣은 뒤, 5% CO2, 37℃ incubator에서 24시간동안 10% FBS(Gibco, 미국, cat no. 16000-044)와 1% Penicillin/streptomycin(Gibco, USA, cat no. 15140-122)이 포함된 RPMI 1640(Welgene, 대한민국, cat. No. LM001-05) 배지에서 배양하였다. 이후, 후보 항체-약물 접합체를 최종 농도 20nM부터 0.15625nM이 되도록 1/2배 연속 희석하여 2종의 세포에 각각 처리하였다. 후보 항체-약물 접합체 처리 이후 72시간동안 5% CO2, 37℃ incubator에서 배양하였으며, 72시간이 경과한 뒤, Cell counting kit-8(Sigma Aldrich, 미국, cat. No. 96992)를 10μl/well 씩 처리하고 4시간동안 5% CO2, 37℃ incubator에서 반응시켰다. 이후, 플레이트를 450nm에서 마이크로 플레이트 리더 장비(TECAN, 스위스, 모델명: Spark)로 측정하여 후보 항체-약물 접합체에 의한 세포 독성을 확인하였다. LNCaP 세포에서의 PSMA 타겟 항체-약물 접합체의 IC50 값은 0.5nM로 산출되었으며, PC3 세포에서의 독성은 나타나지 않았다(도 2).
실시예
8:
PSMA
타겟
항체의
세포내
이동 효능 확인
PSMA 타겟 항체의 세포내 이동 여부는 PSMA 발현 세포인 LNCaP 세포(ATCC, 미국)를 대상으로 수행하였다. PSMA 타겟 항체와 음성 대조군 항체인 Mouse IgG Isotype Control(ThermoFisher, USA, cat.No.02-6502)을 10mM sodium carbonate buffer pH 8.5(Sigma, USA, Cat.No.S2127-500G)를 이용하여 희석한 후, 각 항체 100μg에 pHAb Amine Reactive Dye(Promega, USA, cat.No.G9845) 12μg을 처리하여 1시간동안 conjugation하였다. Conjugation되지 못한 잔여 pHAb dye는 desalting column(ThermoFisher, USA, cat.No. 87766)에 통과시켜 제거하였다.
LNCaP 세포와 PC3 세포는 각 5X105cell/1000μl/well로 6 well 플레이트(Corning,USA cat. No.3516)에 넣은 뒤, 5% CO2, 37℃ incubator에서 24시간동안 10% FBS(Gibco, USA, cat.No. 16000-044)와 1% Penicillin/streptomycin(Gibco, USA, cat no. 15140-122)이 포함된 RPMI 1640(Welgene, 대한민국, cat. No. LM001-05) 배지에서 배양하였다.
pHAb dye가 표지된 인간 PSMA 타겟 후보 항체와 대조군 항체를 10μg/1000μl/well로 LNCaP 세포와 PC3 세포에 처리하였다. pHAb dye 표지된 항체를 처리한 이후 각각 1시간, 24시간동안 5% CO2, 37℃ incubator에서 배양하였다. 1시간, 24시간이 경과한 뒤 세포 내로 이동되지 못한 pHAb dye 표지 항체의 제거를 위하여 1X D-PBS(Welgene, 대한민국, cat.No. LB 001-02) 1ml로 1회 wash하였다. 그 후 1X Trypsin-EDTA Solution(Welgene, 대한민국, cat.No. LS015-01)을 처리하여 세포를 6 well 플레이트(Corning, USA, cat. No.3516)로부터 분리하여 micro Centrifuge Tubes(QSP, 대한민국cat.No.509-GRD-Q)에 옮겨주었다. 세포가 들어있는 tube를 원심분리기(HANIL, 대한민국, MICRO-12)에서 1500rpm으로 5분동안 원심 분리하여 세포 pellet을 얻었다. pellet 상태의 세포에 5% FBS in 1XPBS(pH7.4) 100μl을 넣어 vortex하여 분석 시료를 준비하였다. Flow Cytometer(BD Biosciences, USA, Accuri C6 plus) 장비를 이용하여, 각 time point에서 얻은 시료의 형광 값을 측정하였다. 인간 PSMA 타겟 후보 항체의 세포내 이동에 의한 PE 형광값과 음성 대조군 항체인 mouse IgG-pHAb에 대한 PE 형광값을 하기 표 6에 명시하였다.
처리 시료(10μg/mL) | Mean FL | |
1시간 | 24시간 | |
음성 대조군 | 1691 | 2836 |
인간 PSMA 타겟 후보 항체 | 2014 | 13690 |
24시간 처리 시료에서 음성 대조군 대비 약 5배의 증가된 형광값을 나타냄으로써, 인간 PSMA 타겟 후보 항체가 PSMA가 발현되는 LNCaP의 세포내로 이동하는 것을 확인하였다(도 3).
실시예
9:
PSMA
타겟
항체의 전립선암 세포주에서 발현되는
PSMA와의
결합 확인을 위한
유세포
분석
PSMA 타겟 항체의 인간 전립선암 세포인 LNCaP(ATCC, 미국)에서 발현되는 PSMA와의 결합 여부 확인을 위하여 Flow cytometry 실험을 수행하였다. 본 실시예에서 LNCaP 세포와 함께 사용한 PC3는 PSMA가 발현되지 않는 인간 전립선암 세포주로, 음성 대조를 위한 세포주로 사용하였다. PSMA 타겟 항체 10μg/mL, 1μg/ml을 LNCaP 세포와 PC3 세포에 처리하고, 음성 대조군 항체인 Mouse IgG Isotype Control(ThermoFisher, USA, cat.No.02-6502)을 10μg/mL 농도로 위의 2종의 세포주에 각각 처리한 뒤, 4℃에서 incubation하였다. 이때, 항체는 5% FBS(Gibco, 미국, cat no. 16000-044)를 포함하는 DPBS(Welgene, 대한민국, Cat. No. LB 001-02)로 희석하여 처리하였다. 이후, 5% FBS가 포함된 DPBS를 이용하여 3번의 세척 과정을 거친 세포를 Flow cytometry(BD Biosciences, USA, Accuri C6 plus)로 분석하였다. 음성 대조군은 전립선암 세포주의 PSMA 발현 유무와 무관하게 일정한 형광값을 나타내었다. 반면, 인간 PSMA 타겟 항체는 PSMA가 발현되는 LNCaP 세포에서만 항체의 농도 의존적으로 형광값이 증가하였다(표 7 및 도 4).
처리 시료 | Mean FL | ||
PC3 | LNCaP | ||
음성 대조군 10μg/mL | 3931 | 3444 | |
인간 PSMA 타겟 후보 항체 | 1μg/mL | 2004 | 7259 |
10μg/mL | 1416 | 20724 |
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
<110> GW Vitek CO.,LTD.
<120> Anti-PSMA Antibody and Uses Thereof
<130> P21-B266
<160> 10
<170> KoPatentIn 3.0
<210> 1
<211> 10
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRH1
<400> 1
Gly Tyr Ala Phe Ser Ser Ser Trp Met Asn
1 5 10
<210> 2
<211> 17
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRH2
<400> 2
Arg Ile Tyr Pro Ala Asp Gly Asp Thr Asn Tyr Asn Gly Lys Phe Lys
1 5 10 15
Gly
<210> 3
<211> 13
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRH3
<400> 3
Cys Gly Trp Asp Gly Gly Val Tyr Tyr Ala Met Asp Tyr
1 5 10
<210> 4
<211> 15
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRL1
<400> 4
Arg Ala Ser Lys Ser Val Thr Thr Ser Gly Tyr Ser Tyr Met His
1 5 10 15
<210> 5
<211> 7
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRL2
<400> 5
Leu Ala Ser Asn Leu Glu Ser
1 5
<210> 6
<211> 9
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRL3
<400> 6
Gln His Ser Arg Glu Leu Pro Arg Thr
1 5
<210> 7
<211> 122
<212> PRT
<213> Artificial Sequence
<220>
<223> Heavy Chain Variable Region
<400> 7
Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ala Phe Ser Ser Ser
20 25 30
Trp Met Asn Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Arg Ile Tyr Pro Ala Asp Gly Asp Thr Asn Tyr Asn Gly Lys Phe
50 55 60
Lys Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr
65 70 75 80
Met Gln Leu Ser Ser Leu Thr Ser Val Asp Ser Ala Val Tyr Phe Cys
85 90 95
Ala Arg Cys Gly Trp Asp Gly Gly Val Tyr Tyr Ala Met Asp Tyr Trp
100 105 110
Gly Gln Gly Thr Ser Val Thr Val Ser Ser
115 120
<210> 8
<211> 111
<212> PRT
<213> Artificial Sequence
<220>
<223> Light Chain Variable Region
<400> 8
Asp Ile Val Met Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly
1 5 10 15
Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Lys Ser Val Thr Thr Ser
20 25 30
Gly Tyr Ser Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro
35 40 45
Lys Leu Leu Ile Tyr Leu Ala Ser Asn Leu Glu Ser Gly Val Pro Ala
50 55 60
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His
65 70 75 80
Pro Val Glu Glu Glu Asp Ala Ala Thr Tyr Tyr Cys Gln His Ser Arg
85 90 95
Glu Leu Pro Arg Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
100 105 110
<210> 9
<211> 366
<212> DNA
<213> Artificial Sequence
<220>
<223> Heavy Chain Variable Region
<400> 9
gaggtccagc tgcaacaatc tggacctgag ctggtgaagc ctggggcctc agtgaagatt 60
tcctgcaaag cttctggcta cgcattcagt agctcttgga tgaactgggt gaagcagagg 120
cctggacagg gtcttgagtg gattggacgg atttatcctg cagatggaga tactaactac 180
aatgggaagt tcaagggcaa ggccacactg actgcagaca aatcctccag cacagcctac 240
atgcagctca gcagcctgac ctctgtggac tctgcggtct atttctgtgc aagatgcggc 300
tgggacgggg gggtttacta tgctatggac tactggggtc aaggaacctc agtcaccgtc 360
tcctca 366
<210> 10
<211> 333
<212> DNA
<213> Artificial Sequence
<220>
<223> Light Chain Variable Region
<400> 10
gacattgtga tgacccagtc tcctgcttcc ttagctgtat ctctggggca gagggccacc 60
atctcatgca gggccagcaa aagtgtcact acatctggct atagttatat gcactggtac 120
caacagaaac caggacagcc acccaaactc ctcatctatc ttgcatccaa cctagaatct 180
ggggtccctg ccaggttcag tggcagtggg tctgggacag acttcaccct caacatccat 240
cctgtggagg aggaggatgc tgcaacctat tactgtcagc acagtaggga gcttcctcgg 300
acgttcggtg gaggcaccaa gctggaaatc aaa 333
Claims (21)
- 다음을 포함하는 항-PSMA(prostate-specific membrane antigen) 항체 또는 이의 항원 결합 단편:
서열번호 1의 아미노산 서열을 포함하는 중쇄(heavy chain) CDR1, 서열번호 2의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 3의 아미노산 서열을 포함하는 중쇄 CDR3; 및
서열번호 4의 아미노산 서열을 포함하는 경쇄(light chain) CDR1, 서열번호 5의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR3.
- 제1항에 있어서, 서열번호 7의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 항-PSMA 항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 단클론 항체인 것을 특징으로 하는 항-PSMA 항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 상기 항원 결합 단편은 상기 항-PSMA 항체의 scFv, (scFv)2, scFv-Fc, Fab, Fab' 및 F(ab')2로 이루어진 군에서 선택되는 것을 특징으로 하는 항-PSMA 항체 또는 이의 항원 결합 단편.
- 제1항 내지 제4항에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 코딩하는 핵산.
- 제5항에 따른 핵산을 포함하는 재조합 발현벡터.
- 제6항에 따른 재조합 발현벡터로 형질전환된 숙주세포.
- 제7항에 있어서, 원숭이 신장 세포7(monkey kidney cells; COS7) 세포, NSO 세포, SP2/0 세포, 차이니즈 햄스터 난소(Chinese hamster ovary; CHO) 세포, W138, 어린 햄스터 신장(baby hamster kidney; BHK) 세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK293 세포, 바실러스 서브틸리스(Bacillus subtilis), 스트렙토마이세스 속(Streptomyces sp.), 슈도모나스 속(Pseudomonas sp.), 프로테우스 미라빌리스(Proteus mirabilis) 또는 스타필로코쿠스 속(Staphylococcus sp.), 아스페르길러스 속(Aspergillus sp.), 피치아 파스토리스(Pichia pastoris), 사카로마이세스 세레비지애(Saccharomyces cerevisiae), 쉬조사카로마세스 속(Schizosaccharomyces sp.) 및 뉴로스포라 크라사(Neurosporacrassa)로 구성된 군에서 선택되는 것을 특징으로 하는 숙주세포.
- 제7항에 따른 숙주세포를 배양하는 단계를 포함하는 항-PSMA 항체 또는 이의 항원 결합 단편의 제조 방법.
- 제1항에 따른 항-PSMA 항체 또는 이의 항원 결합 단편에 약물이 접합된 항체-약물 접합체(antibody-drug conjugate; ADC).
- 제10항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 링커를 통하여 약물과 결합되는 것을 특징으로 하는 항체-약물 접합체.
- 제11항에 있어서, 상기 링커는 절단성 링커 또는 비절단성 링커인 것을 특징으로 하는 항체-약물 접합체.
- 제10항에 있어서, 상기 약물은 화학요법제, 독소, 마이크로 RNA(miRNA), siRNA, shRNA 또는 방사성 동위원소인 것을 특징으로 하는 항체-약물 접합체.
- 제1항에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 이중특이 항체(bispecific antibody).
- 제14항에 있어서, 상기 이중특이 항체는 항-PSMA 항체 또는 이의 항원 결합 단편과, 암 관련 항원 또는 면역관문 단백질 항원 또는 면역효능세포 특이적 표적분자에 대한 결합능을 가지는 항체로 이루어진 것을 특징으로 하는 이중특이 항체.
- 제1항 내지 제4항에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 키메라 항원 수용체(chimeric antigen receptor; CAR).
- 제16항의 키메라 항원 수용체를 함유하는 면역세포.
- 제17항에 있어서, 상기 면역세포는 T 세포 또는 NK 세포인 것을 특징으로 하는 면역세포.
- 제1항 내지 제4항에 따른 항-PSMA 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물.
- 제1항 내지 제4항의 항-PSMA 항체 또는 이의 항원 결합 단편, 제10항의 항체-약물 접합체, 제14항의 이중특이 항체 또는 제16항의 키메라 항원 수용체를 포함하는 암의 예방 또는 치료용 약학 조성물.
- 제20항에 있어서, 상기 암은 PSMA가 발현 또는 과발현된 것을 특징으로 하는 암의 예방 또는 치료용 약학 조성물.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020210165641A KR20230078152A (ko) | 2021-11-26 | 2021-11-26 | Psma에 특이적으로 결합하는 항체 및 그의 용도 |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020210165641A KR20230078152A (ko) | 2021-11-26 | 2021-11-26 | Psma에 특이적으로 결합하는 항체 및 그의 용도 |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20230078152A true KR20230078152A (ko) | 2023-06-02 |
Family
ID=86755984
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020210165641A KR20230078152A (ko) | 2021-11-26 | 2021-11-26 | Psma에 특이적으로 결합하는 항체 및 그의 용도 |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR20230078152A (ko) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117736331A (zh) * | 2024-02-04 | 2024-03-22 | 南昌大学第一附属医院 | 一种特异性结合psma胞外段的单克隆抗体及其应用 |
-
2021
- 2021-11-26 KR KR1020210165641A patent/KR20230078152A/ko unknown
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117736331A (zh) * | 2024-02-04 | 2024-03-22 | 南昌大学第一附属医院 | 一种特异性结合psma胞外段的单克隆抗体及其应用 |
CN117736331B (zh) * | 2024-02-04 | 2024-05-07 | 南昌大学第一附属医院 | 一种特异性结合psma胞外段的单克隆抗体及其应用 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101529810B1 (ko) | 항체-약물 접합체 | |
RU2745451C1 (ru) | Антитела к человеческому интерлейкину-2 и их применение | |
JP7158548B2 (ja) | Muc1に特異的に結合する抗体及びその用途 | |
KR20180104148A (ko) | 개선된 내재화 특징을 갖는 다중특이적 항원-결합 분자 | |
KR20210125511A (ko) | 항-cd228 항체 및 항체-약물 컨쥬게이트 | |
KR20240035378A (ko) | 항-넥틴-4 항체 엑사테칸 접합체 | |
CN116568337A (zh) | 抗cd228抗体和抗体-药物缀合物 | |
KR20230078152A (ko) | Psma에 특이적으로 결합하는 항체 및 그의 용도 | |
JP7240417B2 (ja) | C-metに特異的に結合する抗体及びその用途 | |
KR20220082776A (ko) | 항-tigit 항체 및 이의 용도 | |
CA3023088A1 (en) | Novel anti-tnfrsf21 antibodies and methods of use | |
WO2023222068A1 (en) | Anti-cd200r1 antibodies | |
KR102357951B1 (ko) | 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도 | |
KR20230066257A (ko) | 리지스틴 특이적 항체 및 이의 용도 |