KR102077984B1 - Composition for preventing and improving skin wrinkles - Google Patents

Abstract

The present invention relates to a composition for improving skin wrinkles comprising a peptide derived from human telomerase as an active ingredient. The composition according to the present invention exhibits an excellent collagen biosynthesis increasing effect by including a human telomerase-derived peptide as an active ingredient. Therefore, it is possible to prevent wrinkles of skin or to improve, maintain or enhance wrinkles through skin collagen biosynthesis.

Description

Composition for preventing and improving skin wrinkles

The present invention relates to a composition for preventing and improving skin wrinkles comprising a peptide derived from human telomerase as an active ingredient.

Skin aging is one of the most evident evidence of aging, and the aging process of skin is usually caused by photo-aging due to continuous exposure to shorter wavelengths of UV, wrinkles, face, neck, forearms Pigment changes such as solar lentigo and spot pigmentation appear on the exposed areas of the back.

The causes of wrinkles can be broadly divided into the generation of wrinkles by natural aging and the generation of wrinkles by UV exposure (photoaging). The mechanism of wrinkle formation by two causes is not known yet. Common phenomena associated with skin changes due to natural aging and photoaging are the reduction and modification of collagen and elastin, the major constituent proteins in the dermis, and the reduction of skin elasticity due to the reduction of the hyaluronic acid, the substrate of the dermis. In particular, according to the research results so far, it is known that the reduction and modification of the main proteins collagen and elastin in the dermis are directly involved in the generation of wrinkles and the decrease of elasticity of the skin.

Collagen is a major substrate protein produced by skin fibroblasts and is present in extracellular epilepsy.The main functions are the skin's mechanical strength, the resistance of connective tissue and the adhesion of tissue, the support of cell adhesion, the cell division and differentiation. Induction of growth or wound healing) is known. This collagen is reduced by age and photoaging by ultraviolet irradiation, which is known to be closely related to the wrinkle formation of the skin. In recent years, extensive research on skin aging has been reported to reveal the important function of collagen in the skin. Active ingredients are known that promote collagen synthesis and have anti-wrinkle effects.

Republic of Korea Patent Publication No. 1020060122844

Accordingly, the present inventors have made efforts to develop a composition that is safer to the human body and has an excellent wrinkle improvement effect. As a result, the present inventors have found that peptides derived from human telomerase may have excellent wrinkle improvement effects and completed the present invention.

One aspect of the invention is to provide a peptide useful for the skin.

One aspect of the present invention is to provide a composition comprising a peptide derived from human telomerase as an active ingredient.

One aspect of the present invention is to provide a peptide having a skin wrinkle improvement effect.

One aspect of the present invention is to provide a peptide useful for enhancing skin elasticity.

One aspect of the present invention is to provide an external composition for skin having the effect of preventing or improving skin wrinkles.

According to an aspect of the present invention, as an active ingredient, a peptide comprising an amino acid sequence of any one or more of SEQ ID NO: 1 to SEQ ID NO: 4, a peptide having 80% or more sequence homology with the peptide sequence, or a fragment thereof The peptide or fragment thereof is provided with a composition for preventing or improving skin wrinkles having collagen biosynthesis.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the fragment may be composed of three or more amino acids.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the peptide may be composed of any one amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 4.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the peptide may be derived from human telomerase.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the composition may be an external composition for skin.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the composition may be a cosmetic composition.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the composition may be a pharmaceutical composition.

In the composition for preventing or improving skin wrinkles according to an aspect of the present invention, the composition may be a food composition.

The composition according to the present invention exhibits an excellent collagen biosynthesis increasing effect by including a human telomerase-derived peptide as an active ingredient. Therefore, it is possible to maintain or promote a healthy skin condition by preventing wrinkles or improving wrinkles of the skin through enhancing collagen biosynthesis.

Figure 1 is a graph showing the results of measuring the collagen synthesis (Collagen synthesis,%) of the peptides according to an aspect of the present invention.
Figure 2 is a graph measuring the cell viability (Cell viability,%) for confirming the toxicity to the cells when the peptides according to the present invention at the maximum concentration value.

The present invention may be variously modified and may have various embodiments. Hereinafter, the present invention will be described in more detail. However, this is not intended to limit the present invention to specific embodiments, it should be understood to include all transformations, equivalents, and substitutes included in the spirit and scope of the present invention. In the following description of the present invention, if it is determined that the detailed description of the related known technology may obscure the gist of the present invention, the detailed description thereof will be omitted.

Peptides described in SEQ ID NO: 1 to SEQ ID NO: 4 are shown in Table 1 below. SEQ ID NO: 5 is the sequence of human telomerase full length protein. The “name” in Table 1 below is to identify peptides. In another aspect of the present invention, at least one of the peptides set forth in SEQ ID NO: 1 to SEQ ID NO: 4 includes a "synthetic peptide" synthesized by selecting a peptide at a corresponding position among the peptides contained in telomerase. As used herein, the term "pep" refers to a peptide having any one of SEQ ID NO: 1 to SEQ ID NO: 4, or a peptide having 80% or more sequence homology with the sequence, or a fragment thereof.

SEQ ID NO: name Telomerase Phase Location order Length One. pep-RIA-109 [617-620] LTSR 4 aa 2. pep-RIA-129 [613-615] RPA 3 aa 3. pep-RIA-134 [614-620] PALLTSR 7 aa 4. pep-RIA-136 [614-618] PALLT 5 aa 5. Telomerase [1-1132] MPRAPRCRAVRSLLRSHYREVLPLATFVRR LGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTW KMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQ VNSLQTV CTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD 1132 aa

One aspect of the present invention provides a peptide comprising SEQ ID NO: 1 to 4 or a polynucleotide encoding a peptide or fragment thereof having 80% or more sequence homology with the peptide sequence. The polynucleotides can be used to mass produce peptides. For example, a large amount of peptides can be produced by culturing a vector containing a polynucleotide encoding a peptide into a host cell.

The peptides disclosed herein may include peptides having at least 80%, at least 85%, at least 90%, at least 95%, or at least 96% homology with the peptides of SEQ ID NOs: 1-4. In addition, a peptide disclosed herein may be a peptide comprising SEQ ID NOs: 1-4 or a peptide having at least 80% sequence homology with the peptide sequence, or fragments thereof, at least one amino acid, at least two amino acids, at least three Amino acids, at least 4 amino acids, at least 5 amino acids, at least 6 amino acids, or at least 7 amino acids may be included.

In one aspect of the invention, amino acid changes belong to a property that allows the physicochemical properties of the peptide to be altered. For example, amino acid changes can be made, such as improving the thermal stability of the peptide, altering substrate specificity, changing the optimal pH, and the like.

As used herein, "amino acid" includes not only the 22 standard amino acids naturally incorporated into the peptide, but also D-isomers and modified amino acids. Accordingly, in one aspect of the invention the peptide may be a peptide comprising D-amino acids. Meanwhile, in another aspect of the present invention, the peptide may include non-standard amino acid or the like which has been post-translational modified. Examples of post-translational modifications include phosphorylation, glycosylation, acylation (including, for example, acetylation, myristoylation, and palmitoylation), alkylation ), Carboxylation, hydroxylation, glycation, biotinylation, ubiquitinylation, changes in chemical properties (e.g., beta-elimination deimidization) , Deamidation) and structural changes (eg, formation of disulfide bridges). It also includes changes in amino acids, such as changes in amino groups, carboxy groups or side chains, caused by chemical reactions that occur in the process of binding with crosslinkers to form peptide conjugates.

Peptides disclosed herein can be wild-type peptides identified and isolated from a natural source. On the other hand, a peptide disclosed herein is substituted, deleted and / or one or more amino acids compared to the peptide comprising SEQ ID NO: 1 to 4 or a peptide having at least 80% sequence homology with the peptide sequence, or fragments thereof Or artificial variants comprising inserted amino acid sequences. Amino acid changes in the wild type polypeptide as well as in artificial variants include conservative amino acid substitutions that do not significantly affect the folding and / or activity of the protein. Examples of conservative substitutions include basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (leucine, isoleucine, valine and methionine), aromatic amino acids (phenylalanine, Tryptophan and tyrosine), and small amino acids (glycine, alanine, serine and threonine). Amino acid substitutions that generally do not alter specific activity are known in the art. The most common exchanges are Ala / Ser, Val / Ile, Asp / Glu, Thr / Ser, Ala / Gly, Ala / Thr, Ser / Asn, Ala / Val, Ser / Gly, Tyr / Phe, Ala / Pro, Lys / Arg, Asp / Asn, Leu / Ile, Leu / Val, Ala / Glu, and Asp / Gly, and vice versa.

In addition, another aspect of the present invention provides a composition comprising a peptide derived from a human protein as described above or a peptide or a fragment thereof having 80% or more sequence homology with the peptide sequence as an active ingredient.

As the skin ages, the secretion of various hormones that regulate metabolism internally decreases, and the function of immune cells and the activity of cells decreases, thereby reducing the biosynthesis of immune proteins and bioconstituent proteins necessary for the living body. In addition, due to the destruction of the ozone layer, the amount of ultraviolet rays reaching the surface of the sun's rays increases and environmental pollution is further intensified, leading to an increase in free radicals and active harmful oxygen, thereby reducing the thickness of the skin and increasing wrinkles. This can lead to a number of changes, including reduced elasticity. Therefore, as the aging progresses, symptoms of changing or decreasing the content and arrangement of collagen, elastin, hyaluronic acid, and glycoproteins constituting the skin appear. In other words, the biosynthesis of the substrate material is reduced by the reduction of cellular activity and micro-inflammation due to naturally occurring endogenous aging, and the external factors such as the increase of stress caused by various harmful environments and the increase of reactive oxygen species caused by sunlight. As a result, decomposition and degeneration are accelerated, and the skin matrix is destroyed and thinned, and various symptoms of skin aging appear.

Telomere is a genetic material repeatedly present at the end of a chromosome and is known to prevent damage to the chromosome or binding to another chromosome. Each time a cell divides, the telomeres become slightly shorter. After a certain number of cell divisions, the telomeres become very short, and the cells stop dividing and die. On the other hand, elongation of telomeres is known to prolong cell lifespan. For example, cancer cells secrete an enzyme called telomerase, which prevents telomeres from shortening, so that cancer cells can continue to proliferate without dying.

Accordingly, one aspect of the present invention is a peptide derived from a human protein, by providing a composition comprising a peptide of SEQ ID NO: 1 to 4, a peptide having a sequence homology of 80% or more with the peptide sequence or fragments thereof as an active ingredient, When applied or administered to the skin, biosynthesis of collagen in the skin reduced by aging can be enhanced. As a result, the composition according to the present invention may prevent or improve wrinkle formation of the skin, maintain or improve skin elasticity, and thus prevent or improve aging of the skin.

The composition according to an aspect of the present invention comprises a peptide of SEQ ID NO: 1 to 4 or a peptide having a sequence homology of 80% or more with the peptide sequence or a fragment thereof as an active ingredient, 0.1 μg / mg to 1 mg / mg, specifically 1 Μg / mg to 0.5 mg / mg, more specifically 10 μg / mg to 0.1 mg / mg. When included in the above range is not only suitable for showing the intended effect of the present invention, it can satisfy both the stability and safety of the composition, it may be appropriate to include in the above range in terms of cost-effectiveness.

The composition according to one aspect of the present invention can be applied to all animals including humans, dogs, chickens, pigs, cows, sheep, guinea pigs or monkeys.

The pharmaceutical composition according to one aspect of the present invention may be administered orally, rectal, transdermal, intravenous, intramuscular, intraperitoneal, intramedullary, intradural or subcutaneous.

Formulations for oral administration may be, but are not limited to, tablets, pills, soft or hard capsules, granules, powders, solutions or emulsions. Formulations for parenteral administration may be, but are not limited to, injections, drops, lotions, ointments, gels, creams, suspensions, emulsions, suppositories, patches or sprays.

Pharmaceutical compositions according to one aspect of the invention may include additives such as diluents, excipients, lubricants, binders, disintegrants, buffers, dispersants, surfactants, colorants, flavoring or sweetening agents as needed. Pharmaceutical compositions according to one aspect of the invention may be prepared by conventional methods in the art.

The active ingredient of the pharmaceutical composition according to one aspect of the present invention will vary depending on the age, sex, weight, pathology and severity of the subject to be administered, the route of administration or the judgment of the prescriber. Dosage determination based on these factors is within the level of one of skill in the art, and its daily dosage may be, for example, 0.1 μg / kg / day to 1 g / kg / day, specifically 1 μg / kg / day to 10 mg / kg Per day, more specifically 10 μg / kg / day to 1 mg / kg / day, and more specifically 50 μg / kg / day to 100 μg / kg / day, but is not limited thereto. The pharmaceutical composition according to one aspect of the present invention may be administered once to three times a day, but is not limited thereto.

The topical skin composition according to one aspect of the present invention may be provided in any formulation suitable for topical application. For example, it may be provided in the form of a solution, an emulsion obtained by dispersing an oil phase in an aqueous phase, an emulsion obtained by dispersing an aqueous phase in an oil phase, a suspension, a solid, a gel, a powder, a paste, a foam, or an aerosol. Such formulations may be prepared according to conventional methods in the art.

In addition, the cosmetic composition according to an aspect of the present invention may be provided in the form of injection liquid. The cosmetic composition of this injectable formulation is injectable via a shock wave caused by a high speed spray in a syringe with one needle, a syringe with a plurality of needles, a patch, a microneedle or a microjet method or by applying a laser beam to an aluminum foil. It may be injected into the skin through a variety of delivery mechanisms, for example, a mechanism for spraying. According to the method using the laser, since the needle is not used, it is possible to prevent pain during the injection and a wound due to the use of the needle. As such, according to the injection formulation, the active ingredient included in the cosmetic composition may be directly delivered to a target site such as skin, thereby maximizing the effect. In addition, according to the method using a laser, since the needle is not used, it is possible to prevent pain during the injection and a wound due to the use of the needle.

Cosmetic composition according to an aspect of the present invention may include other ingredients that can give a synergistic effect to the main effect, preferably within a range that does not impair the main effect. In addition, the cosmetic composition according to an aspect of the present invention is a moisturizer, an emulsifier, a surfactant, a ultraviolet absorber, a preservative, a bactericide, an antioxidant, a pH adjuster, an organic or inorganic pigment, a fragrance, a cooling agent or a restriction agent. It may include. The blending amount of the above components can be easily selected by those skilled in the art within the range that does not impair the object and effect of the present invention, the blending amount is 0.01 to 5% by weight, specifically 0.01 to 3% by weight based on the total weight of the cosmetic composition Can be.

The formulation of the food composition according to one aspect of the present invention is not particularly limited, but may be, for example, formulated into tablets, granules, powders, solutions, solid preparations, and the like. Each formulation may be appropriately selected by the person skilled in the art according to the formulation or purpose of use, in addition to the active ingredient, may be appropriately selected without difficulty, and synergistic effects may occur when simultaneously applied with other raw materials.

Determination of the dosage of the active ingredient is within the level of those skilled in the art, and its daily dosage may be, for example, specifically 1 μg / kg / day to 10 mg / kg / day, more specifically 10 μg / kg / day To 1 mg / kg / day, and more specifically, 50 μg / kg / day to 100 μg / kg / day, but is not limited thereto, and various factors such as age, health condition, and complications of the subject to be administered. It may vary.

Hereinafter, the configuration and effects of the present invention will be described in more detail with reference to Examples and Experimental Examples. However, the following examples and experimental examples are provided only for the purpose of illustration in order to help the understanding of the present invention, but the scope and scope of the present invention is not limited thereto.

Example 1 Synthesis of Peptides

Peptides having the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 4 were prepared according to the solid phase peptide synthesis known in the art. Specifically, peptides were synthesized by coupling amino acids from the C-terminus one by one through Fmoc solid phase synthesis (SPPS) using ASP48S (Peptron, Inc., Daejeon, Korea). As follows, the first amino acid at the C-terminus of the peptides was attached to the resin. For example:

NH ₂ -Lys (Boc) -2-chloro-Trityl Resin

NH ₂ -Ala-2-chloro-Trityl Resin

NH ₂ -Arg (Pbf) -2-chloro-Trityl Resin

All amino acid feedstocks used for peptide synthesis were protected by Fmoc with N-term and all residues removed from acid with Trt, Boc, t-Bu (t-butylester), Pbf (2,2,4,6, 7-pentamethyl dihydro-benzofuran-5-sulfonyl) and the like were used. For example:

Fmoc-Ala-OH, Fmoc-Arg (Pbf) -OH, Fmoc-Glu (OtBu) -OH, Fmoc-Pro-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Phe-OH, Fmoc- Ser (tBu) -OH, Fmoc-Thr (tBu) -OH, Fmoc-Lys (Boc) -OH, Fmoc-Gln (Trt) -OH, Fmoc-Trp (Boc) -OH, Fmoc-Met-OH, Fmoc -Asn (Trt) -OH, Fmoc-Tyr (tBu) -OH, Fmoc-Ahx-OH, Trt-Mercaptoacetic acid.

Coupling reagent is HBTU [2- (1H-Benzotriazole-1-yl) -1,1,3,3-tetamethylaminium hexafluorophosphate] / HOBt [N-Hydroxxybenzotriazole] / NMM [4-Methylmorpholine] It was. Fmoc removal was performed using piperidine in DMF in 20% of DMF. The cleavage cocktail (Tlea (trifluoroacetic acid) / TIS (triisopropylsilane) / EDT (ethanedithiol) / H ₂ O = 92.5 / 2.5 / 2.5 / 2.5) was used to isolate the synthesized peptide from Resin and remove the protecting group of the residue. It was.

Each peptide was synthesized by repeating the process of reacting the amino acids with each other, washing with a solvent, and then deprotecting the amino acids using the state in which the amino acid protecting group was bound to the solid support. The synthesized peptide was separated from the resin and then purified by HPLC, and confirmed by MS and lyophilized.

As a telomerase-derived peptide, a peptide having 16 amino acid sequences of EARPALLTSRLRFIPK (SEQ ID NO: 6) will be described below.

1) Coupling

Amino acid (8 equivalents) protected by NH ₂ -Lys (Boc) -2-chloro-Trityl Resin and coupling reagent HBTU (8 equivalents) / HOBt (8 equivalents) / NMM (16 equivalents) were dissolved in DMF and added. Reaction was performed at room temperature for 2 hours, and washed with DMF, MeOH, and DMF in that order.

2) Fmoc deprotection

Piperidine in DMF at 20% was added thereto, reacted twice at room temperature for 5 minutes, and washed with DMF, MeOH, and DMF in that order.

3) Peptide base skeleton NH2-E (OtBu) -AR (Pbf) -PALLT (tBu) -S (tBu) -R (Pbf) LR (Pbf) -FIPK (Boc)- 2-chloro-Trityl Resin) was made.

4) Cleavage: A cleavage cocktail was added to the synthesized peptide Resin to separate the peptide from Resin.

5) Cooling diethyl ether is added to the obtained mixture, followed by centrifugation to precipitate the obtained peptide.

6) After purification by Prep-HPLC, the molecular weight was confirmed by LC / MS and frozen to prepare a powder.

Example 2: Preparation of Formulations

The peptide in the form of a lyophilized powder obtained according to the method described in Example 1 was dissolved in phosphate buffer (PBS) and used. Correction of purity of the peptide (purity: 97.3%, content: 85.3%) was performed to prepare an experimental dosage solution at a concentration of 40 mM with phosphate buffer solution (PBS) as an excipient immediately before administration.

Example 3: Experimental effect of collagen biosynthesis of peptides

1) Cell Culture

Human dermal fibroblasts (Gibco Cat. Number: C-013-5C) were prepared to confirm the collagen biosynthesis enhancing effect of the peptides. Prepared human dermal fibroblasts were cultured under Medium condition of Medium 106 medium by adding LSGS (Low Serum Growth Supplement) under 37 ° C., 5% CO ₂ , and passaged by Trypsinization to use 4-10 generation cells for the experiment. .

2) Confirm the effect of increasing collagen synthesis

Human dermal fibroblasts cultured as above were put into 5 24- 10 ⁴ / well in a 24-well plate and incubated for 14-16 hours. After removing the culture medium and washing with phosphate buffer solution (PBS), each 5 μM, 50 μM, 250 μM peptide was added to Medium 106 medium without LSGS (Low Serum Growth Supplement) to treat 5% CO ₂ , 37 Incubated for 24 hours at ℃. The cultures were collected and the amount of collagen was measured using ELISA (Procollagen type IC-peptide EIA kit) method. The ELISA method is described as follows. 100 μl of the antibody-POD conjugated solution was added to the 96-well and incubated at 37 ° C. for 3 hours. After removing the culture solution from the 96-well and washing with washing buffer, 100 μl of color development reagent (TMBZ) was added thereto, and incubated at room temperature for 15 minutes, followed by 100 μl of 1N sulfuric acid. Then measured at 450 nm with ELISA reader. The experimental results are shown in FIG.

Peptides pep-RIA-109, pep-RIA-129, pep-RIA-134 and pep-RIA-136 as shown in FIG. 1 increased collagen synthesis by 119%, 114%, 118% and 123% at 50 μM It can be seen. That is, the collagen synthesis rate is increased by about 114-123% in all cases in which the peptide is added at a concentration of 50 μM when the control is 100% when no peptide is added according to one aspect of the present invention. Appeared. This means that the peptide according to one aspect of the present invention increases collagen biosynthesis, thereby improving skin wrinkles and elasticity.

Example 4: Cytotoxicity Experiments of Peptides

To determine the cytotoxicity of the peptides, human dermal fibroblasts (Gibco Cat. Number: C-013-5C) were placed in a 96-well plate with 1 x 10 ⁴ cells per well and incubated for 12 hours.

After removing the culture medium and washed with PBS, each 500 μM peptide was treated in Medium 106 medium without LSGS (Low Serum Growth Supplement) and incubated at 5% CO ₂ , 37 ° C for 24 hours. After 24 hours, 10 μl of MTT solution (3- (4,5-Dimethylthiazol-2-yl) -2,5-diphenyltetrazoliumbromide; 5 mg / ml) was added and 5% CO ₂ , 2 hours at 37 ° C. Incubated for The medium was removed, 100 μl of DMSO (dimethylsulfoxide) was added, shaken at room temperature for 10 minutes, and absorbance was measured using a microplate reader at 570 nm. Cell survival rate (%) was confirmed using the measured values.

The survival rate of the cells was calculated by the following equation.

OD ₅₇₀ treated: 570 nm absorbance of peptide treated wells

OD ₅₇₀ untreated: 570 nm absorbance of the peptide untreated well

OD ₅₇₀ blank: 570 nm absorbance of wells treated with cell culture media only

Experimental results peptides were 5 μM, 50 μM as shown in FIG. It can be seen that in all cases added 250 μM did not cause cytotoxicity.

Cosmetic Formulation Example: Manufacturing Softener and Cream

According to a conventional method in the following composition was prepared a flexible lotion and cream containing the peptide of the present invention as an active ingredient in the formulation example.

Formulation Example 1 Flexible Cosmetics

 Formulation Example 2 Cream

<110> KAEL-GEMVAX CO., LTD.          KIM, Sangjae <120> Composition for preventing and improving skin wrinkles <130> 13P393 / IND <160> 6 <170> PatentIn version 3.2 <210> 1 <211> 4 <212> PRT <213> Homo sapiens <400> 1 Leu Thr Ser Arg   One <210> 2 <211> 3 <212> PRT <213> Homo sapiens <400> 2 Arg Pro Ala   One <210> 3 <211> 7 <212> PRT <213> Homo sapiens <400> 3 Pro Ala Leu Leu Thr Ser Arg   1 5 <210> 4 <211> 5 <212> PRT <213> Homo sapiens <400> 4 Pro Ala Leu Leu Thr   1 5 <210> 5 <211> 1132 <212> PRT <213> Homo sapiens <400> 5 Met Pro Arg Ala Pro Arg Cys Arg Ala Val Arg Ser Leu Leu Arg Ser   1 5 10 15 His Tyr Arg Glu Val Leu Pro Leu Ala Thr Phe Val Arg Arg Leu Gly              20 25 30 Pro Gln Gly Trp Arg Leu Val Gln Arg Gly Asp Pro Ala Ala Phe Arg          35 40 45 Ala Leu Val Ala Gln Cys Leu Val Cys Val Pro Trp Asp Ala Arg Pro      50 55 60 Pro Pro Ala Ala Pro Ser Phe Arg Gln Val Ser Cys Leu Lys Glu Leu  65 70 75 80 Val Ala Arg Val Leu Gln Arg Leu Cys Glu Arg Gly Ala Lys Asn Val                  85 90 95 Leu Ala Phe Gly Phe Ala Leu Leu Asp Gly Ala Arg Gly Gly Pro Pro             100 105 110 Glu Ala Phe Thr Thr Ser Ser Val Arg Ser Tyr Leu Pro Asn Thr Val Thr         115 120 125 Asp Ala Leu Arg Gly Ser Gly Ala Trp Gly Leu Leu Leu Arg Arg Val     130 135 140 Gly Asp Asp Val Leu Val His Leu Leu Ala Arg Cys Ala Leu Phe Val 145 150 155 160 Leu Val Ala Pro Ser Cys Ala Tyr Gln Val Cys Gly Pro Pro Leu Tyr                 165 170 175 Gln Leu Gly Ala Ala Thr Gln Ala Arg Pro Pro Pro His Ala Ser Gly             180 185 190 Pro Arg Arg Arg Leu Gly Cys Glu Arg Ala Trp Asn His Ser Val Arg         195 200 205 Glu Ala Gly Val Pro Leu Gly Leu Pro Ala Pro Gly Ala Arg Arg Arg     210 215 220 Gly Gly Ser Ala Ser Arg Ser Leu Pro Leu Pro Lys Arg Pro Arg Arg 225 230 235 240 Gly Ala Ala Pro Glu Pro Glu Arg Thr Pro Val Gly Gln Gly Ser Trp                 245 250 255 Ala His Pro Gly Arg Thr Arg Gly Pro Ser Asp Arg Gly Phe Cys Val             260 265 270 Val Ser Pro Ala Arg Pro Ala Glu Glu Ala Thr Ser Leu Glu Gly Ala         275 280 285 Leu Ser Gly Thr Arg His Ser His Pro Ser Val Gly Arg Gln His His     290 295 300 Ala Gly Pro Pro Ser Thr Ser Arg Pro Pro Arg Pro Trp Asp Thr Pro 305 310 315 320 Cys Pro Pro Val Tyr Ala Glu Thr Lys His Phe Leu Tyr Ser Ser Gly                 325 330 335 Asp Lys Glu Gln Leu Arg Pro Ser Phe Leu Leu Ser Ser Leu Arg Pro             340 345 350 Ser Leu Thr Gly Ala Arg Arg Leu Val Glu Thr Ile Phe Leu Gly Ser         355 360 365 Arg Pro Trp Met Pro Gly Thr Pro Arg Arg Leu Pro Arg Leu Pro Gln     370 375 380 Arg Tyr Trp Gln Met Arg Pro Leu Phe Leu Glu Leu Leu Gly Asn His 385 390 395 400 Ala Gln Cys Pro Tyr Gly Val Leu Leu Lys Thr His Cys Pro Leu Arg                 405 410 415 Ala Ala Val Thr Pro Ala Ala Gly Val Cys Ala Arg Glu Lys Pro Gln             420 425 430 Gly Ser Val Ala Ala Pro Glu Glu Glu Asp Thr Asp Pro Arg Arg Leu         435 440 445 Val Gln Leu Leu Arg Gln His Ser Ser Pro Trp Gln Val Tyr Gly Phe     450 455 460 Val Arg Ala Cys Leu Arg Arg Leu Val Pro Pro Gly Leu Trp Gly Ser 465 470 475 480 Arg His Asn Glu Arg Arg Phe Leu Arg Asn Thr Lys Lys Phe Ile Ser                 485 490 495 Leu Gly Lys His Ala Lys Leu Ser Leu Gln Glu Leu Thr Trp Lys Met             500 505 510 Ser Val Arg Asp Cys Ala Trp Leu Arg Arg Ser Pro Gly Val Gly Cys         515 520 525 Val Pro Ala Ala Glu His Arg Leu Arg Glu Glu Ile Leu Ala Lys Phe     530 535 540 Leu His Trp Leu Met Ser Val Tyr Val Val Glu Leu Leu Arg Ser Phe 545 550 555 560 Phe Tyr Val Thr Glu Thr Thr Phe Gln Lys Asn Arg Leu Phe Phe Tyr                 565 570 575 Arg Lys Ser Val Trp Ser Lys Leu Gln Ser Ile Gly Ile Arg Gln His             580 585 590 Leu Lys Arg Val Gln Leu Arg Glu Leu Ser Glu Ala Glu Val Arg Gln         595 600 605 His Arg Glu Ala Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile     610 615 620 Pro Lys Pro Asp Gly Leu Arg Pro Ile Val Asn Met Asp Tyr Val Val 625 630 635 640 Gly Ala Arg Thr Phe Arg Arg Glu Lys Arg Ala Glu Arg Leu Thr Ser                 645 650 655 Arg Val Lys Ala Leu Phe Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg             660 665 670 Pro Gly Leu Leu Gly Ala Ser Val Leu Gly Leu Asp Asp Ile His Arg         675 680 685 Ala Trp Arg Thr Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro     690 695 700 Glu Leu Tyr Phe Val Lys Val Asp Val Thr Gly Ala Tyr Asp Thr Ile 705 710 715 720 Pro Gln Asp Arg Leu Thr Glu Val Ile Ala Ser Ile Ile Lys Pro Gln                 725 730 735 Asn Thr Tyr Cys Val Arg Arg Tyr Ala Val Val Gln Lys Ala Ala His             740 745 750 Gly His Val Arg Lys Ala Phe Lys Ser His Val Ser Thr Leu Thr Asp         755 760 765 Leu Gln Pro Tyr Met Arg Gln Phe Val Ala His Leu Gln Glu Thr Ser     770 775 780 Pro Leu Arg Asp Ala Val Val Ile Glu Gln Ser Ser Ser Leu Asn Glu 785 790 795 800 Ala Ser Ser Gly Leu Phe Asp Val Phe Leu Arg Phe Met Cys His His                 805 810 815 Ala Val Arg Ile Arg Gly Lys Ser Tyr Val Gln Cys Gln Gly Ile Pro             820 825 830 Gln Gly Ser Ile Leu Ser Thr Leu Leu Cys Ser Leu Cys Tyr Gly Asp         835 840 845 Met Glu Asn Lys Leu Phe Ala Gly Ile Arg Arg Asp Gly Leu Leu Leu     850 855 860 Arg Leu Val Asp Asp Phe Leu Leu Val Thr Pro His Leu Thr His Ala 865 870 875 880 Lys Thr Phe Leu Arg Thr Leu Val Arg Gly Val Pro Glu Tyr Gly Cys                 885 890 895 Val Val Asn Leu Arg Lys Thr Val Val Asn Phe Pro Val Glu Asp Glu             900 905 910 Ala Leu Gly Gly Thr Ala Phe Val Gln Met Pro Ala His Gly Leu Phe         915 920 925 Pro Trp Cys Gly Leu Leu Leu Asp Thr Arg Thr Leu Glu Val Gln Ser     930 935 940 Asp Tyr Ser Ser Tyr Ala Arg Thr Ser Ile Arg Ala Ser Leu Thr Phe 945 950 955 960 Asn Arg Gly Phe Lys Ala Gly Arg Asn Met Arg Arg Lys Leu Phe Gly                 965 970 975 Val Leu Arg Leu Lys Cys His Ser Leu Phe Leu Asp Leu Gln Val Asn             980 985 990 Ser Leu Gln Thr Val Cys Thr Asn Ile Tyr Lys Ile Leu Leu Leu Gln         995 1000 1005 Ala Tyr Arg Phe His Ala Cys Val Leu Gln Leu Pro Phe His Gln Gln    1010 1015 1020 Val Trp Lys Asn Pro Thr Phe Phe Leu Arg Val Ile Ser Asp Thr Ala 1025 1030 1035 1040 Ser Leu Cys Tyr Ser Ile Leu Lys Ala Lys Asn Ala Gly Met Ser Leu                1045 1050 1055 Gly Ala Lys Gly Ala Ala Gly Pro Leu Pro Ser Glu Ala Val Gln Trp            1060 1065 1070 Leu Cys His Gln Ala Phe Leu Leu Lys Leu Thr Arg His Arg Val Thr        1075 1080 1085 Tyr Val Pro Leu Leu Gly Ser Leu Arg Thr Ala Gln Thr Gln Leu Ser    1090 1095 1100 Arg Lys Leu Pro Gly Thr Thr Leu Thr Ala Leu Glu Ala Ala Ala Asn 1105 1110 1115 1120 Pro Ala Leu Pro Ser Asp Phe Lys Thr Ile Leu Asp                1125 1130 <210> 6 <211> 16 <212> PRT <213> Homo sapiens <400> 6 Glu Ala Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile Pro Lys   1 5 10 15

Claims (9)

As an active ingredient,
A composition for preventing or improving skin wrinkles, comprising a peptide consisting of the amino acid sequence of any one of SEQ ID NO: 1 to SEQ ID NO: 4. As an active ingredient,
Cosmetic composition for enhancing collagen biosynthesis comprising a peptide consisting of the amino acid sequence of any one of SEQ ID NO: 1 to SEQ ID NO: 4. delete delete The composition of claim 1 or 2, wherein the peptide is derived from human telomerase. The composition of claim 1, wherein the composition is a topical skin composition. The composition of claim 1, wherein the composition is a cosmetic composition. The composition of claim 1, wherein the composition is a pharmaceutical composition. The composition of claim 1, wherein the composition is a food composition.

Images