JP2001515133A - Detergent composition containing mannanase and soil release polymer - Google Patents

Abstract

  (57) [Summary] The present invention relates to a laundry detergent composition comprising mannanase and a cotton soil release polymer for excellent cleaning and soil release performance.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0001]

FIELD OF THE INVENTION

The present invention relates to a laundry detergent composition comprising mannanase and a cotton soil release polymer. The soil release polymer is a water soluble and / or dispersible modified polyamine having a functionalized backbone moiety and improved stability to bleach.

[0002]

BACKGROUND OF THE INVENTION

Various soil release agents are known in the art for use in home and industrial fabric treatment processes, such as washing, drying fabrics in a hot air dryer, and the like. A variety of soil release agents are commercially available and are currently used in detergent compositions and fabric softeners / antistatic articles and compositions. Such soil release polymers typically include an oligomer or polymer ester "backbone".

Hitherto, the development of effective cotton soil release agents for use in laundry detergents has been elusive. Another attempt at applying the paradigm of tailoring the structure of the soil release polymer to the structure of the fabric, a successful method in the field of polyester soil release polymers, nevertheless yields reasonable results when applied to cotton fabric soil release agents. Issued. However, it has been found that the use of methylcellulose and cotton polysaccharide having modified oligomer units is more effective for polyester than for cotton.
For example, UK 1,314,897, published April 26, 1973, discloses a hydroxypropyl methylcellulose material to prevent wet soil redeposition and improve stain release in washed fabrics. U.S. Pat. No. 3,897,026, issued to Kearney, discloses a cellulose technic obtained from the reaction of an ethylene-maleic anhydride copolymer with a hydroxyl moiety of a cotton polymer having improved soil release and stain resistance. Discloses style materials. US Pat. No. 3,912,681 issued to Dickson describes pH
Disclosed is a composition for applying a non-permanent soil release finish to a cotton fabric with a polycarboxylate polymer of less than 3. U issued to Hinton et al.
S Patent 3,948,838 describes a high molecular weight (500,000 to 1,500,000) polyacrylic polymer for soil release, preferably used in other fabric treatments. US Patent No. 4,559 issued to Leigh et al.
No. 056 discloses a process for treating cotton or synthetic fabrics with a composition comprising an organopolysiloxane elastomer, an organosiloxane oxyalkylene copolymer crosslinker and a siloxane curing catalyst. Other soil release agents that do not contain terephthalate and polyoxyethylene / propylene mixtures are described in Rupert et al., US Pat. Nos. 4,579,681 and 4,614,51.
No. 9 vinyl caprolactam resin. Examples of alkoxylated and quaternized alkoxylated polyamines are disclosed in EP 206,513 as being suitable for use as soil dispersants. WO 97/42288 describes an effective soil release agent for cotton products that can be made from certain modified polyamines that can be used in all cotton products with or without washing in the presence of bleach. ing. In addition to the above techniques, the following discloses various soil release polymers or modified polyamines;
US Pat. No. 5,565,145 issued to Watson et al.
Connor U.S. Pat. No. 4,548,744 issued Oct. 22, 985; Vander Meer U.S. Pat. No. 4,597,8 issued Jul. 1, 1986.
No. 98; Maldonado et al., US Pat.
877,896; Vander Meer, U.S. Pat. No. 4,891,160, issued Jan. 2, 1990; Maldonado et al., U.S. Pat. No. 4,976,879, issued Dec. 11, 1990. Goss issued on May 16, 1995
elink US Pat. No. 5,415,807; Marco et al., US Pat. No. 4,235,735 issued Nov. 25, 1980; WO 95/32272; 1978 published Nov. 30, 1995. Released on December 29, 2016
Patent No. 1,537,288; UK Patent No. 1,498,520 published Jan. 18, 1978; German Patent DE2 issued Jan. 10, 1980
8 29 022; Japanese published JP0631 published on April 27, 1994
3271

[0004] However, the use of such cotton soil release polymers is not sufficiently effective in protecting clothing from staining, especially cosmetic and food stains. actually,
Current cosmetic and food compositions further contain additives such as hydrocolloid gums used as thickeners. Mannan, guar gum and carob are used in some cosmetic and food compositions (Industrial Gum, second edit
ions, RLWhistler, pp. 308, Academic Press, 1973, ISBN 0-12-74-6252-x).
These hydrocolloid gums have very high affinity for cellulosic substances and are known to be difficult to remove. At present, the use of cotton soil release polymers is not sufficient to address this cosmetic / food stain.

[0005] Food and cosmetic stains / soils represent most consumer-related stains / soils.
Food additives such as thickeners / stabilizers. In fact, hydrophilic colloid
Degumm and emulsifiers are commonly used food additives. The term “gum”
Represents a group of industrially useful polysaccharides (long chain polymers) or their derivatives
And hydrates in hot or cold water to form viscous solutions, dispersions or gels.
Gums are classified as natural and modified. Natural gums include seaweed extracts, plant exudates
There are gums from exudates, seeds or roots, and gums obtained by microbial fermentation.
Modified (semi-synthetic) gums include cellulose and starch derivatives and certain synthetic gums.
Such as low methoxyl pectin, propylene glycol alginate, and
Carboxymethyl and hydropropyl guar gum (Gums in Encycloped
ia Chemical Technology 4^thEd., Vol. 12, pp. 842-862, J. Baird, Kelco division o
f Merck). Carbohydrate Chemistry f by R.L.Whistler and J.N.BeMiller
or Food Scientists (Eagan Press-1997), Chap. 4, pp. 63-89 and P. Laslo
Direct Food Additives in Fruit Processing, Bioprinciples and Applicat
See also ions, Vol. 1, Chapter II, pp. 313-325 (1996) Technomie publishing. this
Some of the gums such as guar gum (E412) and carob (E410)
Widely used alone or in combination in many food sectors (Gums in ECT 4 ^th Ed., Vol. 12, pp. 842-862, J. Baird, Kelco division of Merck).

[0006] Guar gum used in these food and cosmetic stains is a legume plant Cy.
Obtained from endosperm of amopsis tetragonoloba. Guar gum (also called guaran) extracted from dicotyledon seeds is composed of 1-4, bD-mannopyranosyl unit backbones and is used as a thickener in dressing and frozen products and cosmetics (H.-D. Belitz, Food Chemistry, pp. 243, English version
of the second edition, Springer-verlag, 1987, ISBN 0-387-15043-9 (US)) & (
Carbohydrate Chemistry for Food Scientists, RLWilstler, eagan press, 1997
, ISBN 0-913250-92-9) & (Industrial Gum, second editions, RLWhistler, pp
.308, Academic Press, 1973, ISBN 0-12-74-6252-x). Locust bean gum (locust bean gum) (also called carob bean gum or St Jon's bread) is also used in the food industry and is extracted from the seeds of evergreen plants grown in the Mediterranean region. Locust bean gum probably differs from the structure of guar gum only by having fewer D-galactosyl side chains, with similar 1-4,
It has a bD-mannopyranosyl main chain. In legume seeds, water-soluble galactomannan is the major storage carbohydrate and in some cases 20% of the total dry weight.
Account for less than%. Galactomannan links α-galactose to mannose residue O-6, which can also be acetylated to varying degrees at mannose residues O-2 and O-3.

[0007] As mentioned above, there is an ongoing need to formulate laundry detergent compositions that exhibit excellent cleaning performance, especially in cosmetics and food stains, and soil release effects. This object has been met by formulating a laundry detergent composition comprising mannanase and a cotton soil release polymer. The performance of the laundry detergent compositions of the present invention is based on builders, especially zeolites, sodium tripolyphosphate and / or laminated silicates, surfactants, preferably nonionic surfactants such as alkyl ethoxylates or alkyl methyl glucamide, conventional It has further been found that these are enhanced by the addition of other soil-release polymers and / or other detergent components selected from mixtures thereof.

[0008] Mannanase has been identified in several Bacillus organisms. For example, Talbot et al
., Appl. Environ. Microbiol., Vol. 56, No. 11, pp. 3505-3510 (1990) has a 162 kD
Bacillu in dimer form with MW of a and an optimum pH of 5.5 to 7.5
Describes β-mannanase from s stearothermophilus. Mendoza
et al., World J. Microbiol. Biotech., Vol. 10, No. 5, pp. 551-555 (1994) show a MW of 38 kDa, optimal activity at pH 5.0 / 55.degree. Ba with pl
Describes β-mannanase from cillus subtilisis. J0304
No. 706 discloses a β-mannanase from Bacillus sp. Which had a MW of 37 +/− 3 kDa, an optimal pH of 8-10 and a pl of 5.3-5.4 as determined by gel filtration. J63056289 describes the production of alkaline and thermostable β-mannanase, which includes, for example, the β-1,4- of mannan.
Hydrolysis of the D-mannopyranoside linkage produces mannooligosaccharides. J63
No. 036774 relates to the Bacillus microorganism FERM P-8856 which produces β-mannanase and β-mannosidase at alkaline pH. Bacillus amyloli
Purified mannanase from quefaciens and its preparation useful for bleaching pulp and paper are disclosed in WO 97/11164. WO 91/18974 describes hemicellulases, such as glucanases, xylanases or mannanases, which are active at extreme pH and temperature, and methods for their production. WO94 / 2
5576 describes an enzyme exhibiting mannanase activity from Aspergillus aculeatus CBS 101.43, which is used for a variety of purposes where degradation or modification of plant or algal cell wall material is desired. WO 93/24622 discloses a mannanase isolated from Trichoderma reesie for bleaching lignocellulosic pulp.

[0009] However, a synergistic combination of mannanase and cotton soil release polymer for superior cleaning and soil release performance in laundry detergent compositions has not been previously recognized.

[0010]

[Summary of the Invention]

The present invention relates to a laundry detergent composition comprising mannanase and a cotton soil release polymer for achieving excellent cleaning and soil release performance.

[0011]

DETAILED DESCRIPTION OF THE INVENTION

An essential element of the laundry detergent composition of the present invention is a mannanase enzyme. Mannanase enzymes The following three mannan degrading enzymes are included in the present invention: EC 3.2.1.25: β-mannosidase, EC 3.2.1.78: Endo-1,4-β-mannosidase (hereinafter referred to as “mannanase”). And EC 3.2.1.100: 1,4-β-mannobiosidase (IUPAC Classification-Enzyme nomenclature, 1992, ISBN 0-12-22716
5-3, Academic Press).

[0012] More preferably, the laundry detergent composition of the present invention comprises β-1 called mannanase.
, 4-mannosidase (EC 3.2.1.78). The terms “mannanase” and “galactomannanase” are publicly known as mannan endo-1,4-β
-Mannosidase, with the alternative names β-mannanase and endo-1,4-mannanase, the following reaction: 1,4-β-D-mannosidic bond in mannan, galactomannan, glucomannan and galactoglucomannan 1 represents a mannanase enzyme defined according to the art as catalyzing the random hydrolysis of

In particular, mannanase (EC 3.2.1.78) constitutes a group of polysaccharases that degrade mannan and is capable of cleaving polyose chains with mannose units, ie mannan, glucomannan, galactomannan and It represents an enzyme capable of cleaving the glucoside bond of galactoglucomannan. Mannan is β-1,4-
Glucomannan is a polysaccharide having a main chain composed of linked mannose, and glucomannan is a polysaccharide having β-1,4-linked mannose and glucose alternately in the main chain or somewhat regularly, and is composed of galactomannan and galactoglucomannan. Is α-1,6-
Mannan and glucomannan with bound galactose side chains. These compounds may be acetylated.

[0014] The degradation of galactomannan and galactoglucomannan is promoted by the total or partial removal of galactose side chains. Furthermore, the degradation of acetylated mannan, glucomannan, galactomannan and galactoglucomannan is
Promoted by total or partial deacetylation. Acetyl groups can be removed with alkali or mannan acetyl esterase. Oligomers released from mannanase or by a combination of mannanase with α-galactosidase and / or mannan acetylesterase can be further degraded in order to release free maltose by β-mannosidase and / or β-glucosidase.

[0015] Mannanase has been identified in several Bacillus organisms. For example, Talbot et al
., Appl. Environ. Microbiol., Vol. 56, No. 11, pp. 3505-3510 (1990) has a 162 kD
Bacillus in a dimeric form with a molecular weight of a and an optimum pH of 5.5 to 7.5
Describes β-mannanase from stearothermophilus. Mendoza e
tal., World J. Microbiol. Biotech., Vol. 10, No. 5, pp. 551-555 (1994) has a molecular weight of 38 kDa, optimal activity at pH 5.0 and 55 ° C., and 4.8. A β-mannanase from Bacillus subtilis with a pl of JP
-0307066 has a molecular weight of 373 kDa as measured by gel filtration, 8 to 1
Disclosed is a β-mannanase from Bacillus sp. Having an optimal pH of 0 and a pl of 5.3-5.4. JP-63056289 describes the production of alkaline and thermostable β-mannanase, which hydrolyzes, for example, the β-1,4-D-mannopyranoside linkage of mannan to produce mannooligosaccharides. JP-63037674 provides β-mannanase and β-
Bacillus microorganism FERM P-8856 producing mannosidase.
JP-08051975 discloses an alkaline β-mannanase from the alkalophilic Bacillus sp. AM-001. Useful for bleaching pulp and paper
Purified mannanase from Bacillus amyloliquefaciens, and its preparation method,
It is disclosed in WO 97/11164. WO 91/18974 has an extreme pH
And hemicellulases such as glucanases, xylanases or mannanases that are active at temperature. WO 94/25576 discloses enzymes from Aspergillus aculeatus CBS 101.43 that exhibit mannanase activity, which may be useful for the degradation or modification of plant or algal cell wall material. WO 93/24622 discloses a mannanase isolated from Trichoderma reseei, which is useful for bleaching lignocellulosic pulp. Hemicellulases that can degrade mannan-containing hemicellulose are described in WO 91/18974, and purified mannanase from Bacillus amyloliquefaciens is described in WO 9/18974.
7/11164.

Specifically, the mannanase enzyme is an alkaline mannanase as described below, most preferably a mannanase derived from a bacterial source. In particular, the detergent composition of the present invention comprises an alkaline mannanase selected from mannanase from Bacillus agaradherens and / or Bacillus subtilisis strain 168, gene yht. The term "alkaline mannanase enzyme" refers to 7-12, preferably 7.5.
At a given pH of １10.5, it is meant to include enzymes having an enzyme activity of at least 10%, preferably at least 25%, more preferably at least 40% of its maximum activity.

Most preferably, the laundry detergent composition of the present invention comprises an alkaline mannanase from Bacillus agaradherens. The mannanase may be: i) a polypeptide produced by Bacillus agaradherens NCIMB 40482 ii) a polypeptide comprising an amino acid sequence as set forth at positions 32-343 of SEQ ID NO: 2, or iii) at least 70 I) is homologous, or is derived from said polypeptide by one or several amino acid substitutions, deletions or additions, or is immunoreactive with a polyclonal antibody against said polypeptide in purified form; Or an analog of the polypeptide defined in ii).

The present invention relates to (a) nucleotide 9 of SEQ ID NO: 1 which has mannanase activity;
7-a polynucleotide molecule encoding for a polypeptide comprising the sequence of nucleotides as set forth at nucleotide 1029; (b) a species homolog of (a); (c) amino acid residue 32 with SEQ ID NO: 2 -A polynucleotide molecule encoding for a polypeptide having mannanase activity that is at least 70% identical to the amino acid sequence of amino acid residue 343; (d) complementary to (a), (b) or (c) And (e) an isolated polypeptide having mannanase activity selected from the group consisting of (a), (b), (c) or (d).

The plasmid pSJ1678, which contains the polynucleotide molecule (DNA sequence) encoding the mannanase of the present invention, is integrated into a strain of Escherichia coli, and is provided by Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascherode.
r Web 1b, D-38124 Braunschweig, Federal Republic of Germany, in accordance with the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for Patent Applications, May 1998
Deposit No. DSM12180 was deposited by the present inventors on 18 March.

A second most preferred enzyme is a mannanase from Bacillus subtilisis strain 168, wherein the mannanase is i) encoded by the coding portion of the DNA sequence set forth in SEQ ID NO: 5 or an analog of that sequence. And / or ii) a polypeptide comprising the amino acid sequence as set forth in SEQ ID NO: 6, or iii) substitution of one or several amino acids which is at least 70% homologous to said polypeptide Derived from the polypeptide by deletion or addition,
Or an analog of the polypeptide defined in ii), which is immunoreactive with a polyclonal antibody against said polypeptide in purified form.

The present invention relates to (b) (a) a polynucleotide molecule having a mannanase activity and encoding a polypeptide comprising a nucleotide sequence as set forth in SEQ ID NO: 5; (C) at least 70% identical to the amino acid sequence of SEQ ID NO: 6;
A polynucleotide molecule encoding for a polypeptide having mannanase activity; (d) a molecule complementary to (a), (b) or (c); and (e) (a), (b), (c). Or d) the isolated polypeptide having mannanase activity selected from the group consisting of:

Definitions Before describing the present invention in further detail, the following terms will first be defined: The term "ortholog" (or "species homolog") is used to refer to similar polypeptides or proteins of different species. Shows polypeptides or proteins from certain species that have homology. The term "paralog" refers to a polypeptide or protein from a given species that has homology to another polypeptide or protein of the same species.

The term “expression vector” includes a segment encoding a polypeptide of interest, operably linked to additional segments involved in its transcription,
Shown are linear or circular DNA molecules. Such additional segments include promoter and terminator sequences and may optionally include one or more origins of replication, one or more selectable markers, enhancers, polyadenylation signals, and the like. Expression vectors are usually derived from plasmid or viral DNA, or may contain elements of both. The expression vector of the present invention may be any expression vector that can be successfully subjected to recombinant DNA manipulation, and the choice of vector will depend on the host cell into which the vector is to be introduced. Thus, the vector may be an autonomously replicating vector, ie, a vector that exists as an extra chromosome segment (the replication of which is independent of chromosomal replication), ie, a plasmid. Alternatively, the vector may be one which, when introduced into the host cell, is integrated into the host cell genome and replicated along with the chromosome (s) into which it has been integrated. The terms "recombinantly expressed" or "recombinantly expressed" as used herein with reference to the expression of a polypeptide or protein are defined according to standard definitions in the art. Recombinant expression of a protein is usually performed by using an expression vector as described immediately above.

The term “isolated” when applied to a polynucleotide molecule is:
Indicates that the polynucleotide has been removed from its natural genetic environment and is in a form suitable for use in a genetically engineered protein production system without any other foreign or unwanted coding sequences. ing. Such isolated molecules are remote from their natural environment and include cDNA and genomic clones.
The isolated DNA molecules of the present invention do not contain the other genes with which they normally accompany, but may contain native 5 'and 3' untranslated regions such as promoters and terminators. It will be clear to those skilled in the art what are associated regions (eg, Dy
nan and Tijan, Nature, 316, 774-78, 1985).

The term “isolated polynucleotide” is sometimes referred to as “cloned polynucleotide”. When applied to a protein / polypeptide, the term "isolated" indicates that the protein is found under circumstances other than its natural environment. In a preferred form, the isolated protein is substantially free of other proteins, particularly other homologous proteins (ie, "homologous impurities" (see below)). It is preferred to provide the protein in a pure form of at least 40%, more preferably at least 60%. Even more preferably, it is more than 80% pure, more preferably more than 95% pure, as determined in highly pure form, ie by SDS-PAGE.
%, More preferably 99% or more of purity. The term “isolated protein / polypeptide” is sometimes referred to as “purified protein / polypeptide”. The term “homologous impurities” refers to impurities derived from homologous cells from which the polypeptide of the invention was originally obtained (eg, polypeptides other than the polypeptide of the invention). The term "obtained from" as used herein with reference to a particular microbial source refers to a cell in which a polynucleotide and / or polypeptide has been inserted by or from a particular source. Means that it is produced by The term "operably linked" when referring to a DNA segment indicates that the segment is arranged to function for its intended purpose, e.g., transcription begins at the promoter and proceeds from the coding segment to the terminator. I have.

The term “polynucleotide” refers to a single- or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5 ′ to the 3 ′ end. Polynucleotides include RNA and DNA, and are isolated from natural sources, synthesized in vitro, or made from a combination of natural and synthetic molecules. The term "complement of a polynucleotide molecule" refers to a polynucleotide molecule that has a complementary base sequence and reverse orientation as compared to a control sequence. For example, the sequence 5'ATGCACGGGG3 'is complementary to 5'CCCGTGCAT3'. The term "degenerate nucleotide sequence" refers to a sequence of nucleotides that includes one or more degenerate codons (as compared to a control polynucleotide molecule that encodes a polypeptide). Degenerate codons encode similar amino acid residues while having different triplets of nucleotides (ie, GAU and GAC triplets each encode Asp).

[0027] The term "promoter" refers to that portion of a gene whose DNA sequence is involved in binding RNA polymerase and initiating transcription. Promoter sequences are usually, but not necessarily, found in the 5 'non-coding regions of genes. The term "secretory signal sequence" refers to a DNA sequence that encodes, as a component of a larger polypeptide, a polypeptide that directs the larger polypeptide through the secretory pathway of the cell in which it is synthesized ("secreted peptide"). Is shown. Large peptides are usually cleaved to remove secreted peptides during transit through the secretory pathway.

Methods of Using the Sequences of the Invention to Obtain Other Related Sequences The sequence information disclosed herein with respect to the polynucleotide sequence encoding the mannanase of the invention may be used to identify other homologous mannanases. Can be used. For example, the polymerase chain reaction (PCR) can be used to amplify sequences encoding a variety of microbial sources, particularly other homologous mannanases of different Bacillus species.

Assays for Activity Tests The polypeptides of the invention having mannanase activity can be prepared, for example, using 0.2% AZCL galactomannan (Carob), ie, 3%, according to standard test procedures known in the art.
A substrate for the assay of endo-1,4-β-D-mannanase, commercially available from Megazyme as Cat No. 1-AZGMA at US $ 110.00 per gram (Megazyme
's Internet address: http://www.megazyme.com/Purchase/index.html), place the solution to be tested in a 4 mm hole in the agar plate,
Tested for mannanase activity.

Polynucleotides The isolated polynucleotides of the present invention may have SEQ.
ID NO. Hybridizes with a similar size region of one or its complementary sequence. In particular, the polynucleotides of the present invention have SEQ ID NOs under at least moderate stringent conditions, but preferably under highly stringent conditions as described in detail below.
NO. Denatured double-stranded DNA probe containing the entire sequence shown at positions 97-1029 of SEQ ID NO. 1 or SEQ ID NO. 1 having a length of at least about 100 base pairs. Hybridizes with a probe containing one subsequence. Experimental conditions suitable for examining hybridization of nucleotide probes to homologous DNA or RNA sequences under moderate or high stringency conditions are 5 × SSC (sodium chloride / sodium citrate, Sambrook et al., 1989). ) For 10 minutes in a filter pre-soak containing DNA fragments or RNA to be hybridized,
Prehybridization of filters in a solution of × SSC, 5 × Denhardt's solution (Sambrook et al., 1989), 0.5% SDS and 100 μg / ml denatured sonicated salmon sperm DNA (Sambrook et al., 1989), followed by Random priming at a concentration of 10 ng / ml (Feinberg, APand Vogelstein, B. (1983) Anal. Biochem. 132: 6-13)
), Hybridization for 12 hours at about 45 ° C. in the same solution containing a ³² P-dCTP-labeled (specific activity of 1 × 109 cpm / μg or more) probe. The filter is then filtered at least 60 ° C (medium stringency), more preferably at least 6 ° C.
At 5 ° C. (medium / high stringency), even more preferably at least 70 ° C. (high stringency) and even more preferably at least 75 ° C. (very high stringency)
Wash twice with 2 × SSC, 0.5% SDS for 30 minutes. The molecules to which the oligonucleotide probes hybridize under these conditions are detected using x-ray films.

As mentioned above, the isolated polynucleotides of the present invention include DNA and RNA. Methods for isolating DNA and RNA are well known in the art. DNA and RNA encoding the gene of interest can be obtained from Gene Bank by methods known in the art.
Alternatively, it can be cloned in a DNA library. A polynucleotide encoding a polypeptide having mannanase activity of the invention is then identified and isolated, for example, by hybridization or PCR. The invention further provides corresponding polypeptides and polynucleotides (orthologs or paralogs) from different bacterial strains. Of particular interest are mannanase polypeptides from Gram-positive alkalophilic strains, including Bacillus species.

The species homolog of the polypeptide having mannanase activity of the present invention can be cloned using conventional cloning techniques, using the information and compositions provided by the present invention. For example, a DNA sequence of the present invention can be cloned using chromosomal DNA obtained from a cell type that expresses the protein.
Suitable DNA sources can be identified by probing Northern blots with probes designed from the sequences disclosed herein. A library is then generated from the chromosomal DNA of the positive cell line. Then, the DNA sequence of the present invention encoding the polypeptide having mannanase activity can be prepared by various methods, for example,
It can be isolated by probing with a probe designed from the sequences disclosed herein and in the claims, or with one or more sets of degenerate probes based on the disclosed sequences. The DNA sequence of the present invention can be prepared by polymerase chain reaction or PCR (
(Mullis, US Pat. No. 4,683,202) and may be cloned utilizing primers designed from the sequences disclosed herein. As an additional method, DNA libraries can be used to transform or transfect host cells, and expression of the DNA of interest can be cloned from B. agaradherens, NCIMB 40482 and described in Materials and Methods, and Example 1. It can be detected with an antibody to mannanase expressed and purified as described (monoclonal or polyclonal) or by an activity test for a polypeptide having mannanase activity.

The DNA sequence cloned in the plasmid pSJ1678 present in Escherichia coli DSM12180 and / or the mannanase-encoding part of the analog DNA sequence according to the invention may be a bacterial species Ba that produces an enzyme having mannan-degrading activity.
The strain may be cloned from a strain of Cillus agaradherens, preferably strain NCIMB 40482, or other or related organisms as described herein. On the other hand, a similar sequence is Escherichia coli DSM12180 (attached SEQ.
ID No. 1 is considered to be identical to the DNA sequence obtained from the plasmid present in, for example, a subsequence thereof and / or does not give rise to other amino acid sequences of the mannanase encoded by the DNA sequence. May be constructed by introducing nucleotide substitutions that correspond to the codon usage of the host organism for production of the enzyme, or by introducing nucleotide substitutions that result in a different amino acid sequence (ie, a variant of the mannan degrading enzyme of the invention).

Amino acid No. of polypeptide SEQ ID NO: 2 The sequence at 32-343 is the mature mannanase sequence. The present invention also provides a mannanase polypeptide substantially homologous to the polypeptide of SEQ ID NO: 2 and a species homolog (paralog or ortholog) thereof. The term “substantially homologous” refers to amino acid No. 2 of SEQ ID NO: 2.
A polypeptide having 70%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90% sequence identity with the sequence set forth in 32-343, or an ortholog or paralog thereof. Is used here to represent Such a polypeptide is designated as amino acid No. of SEQ ID NO: 2. It is more preferably at least 95%, most preferably at least 98% identical to the sequence set forth in 32-343 or its orthologs or paralogs. Percent sequence identity is reported by Needleman, SB, which is incorporated herein by reference in its entirety.
and Wunsch, CD (1970), Journal of Molecular Biology, 48, 443-453, a Program Manual for the Wisconsin Pachage known in the art, such as GAP, supplied in the GCG program package.
, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison
, Wisconsin, USA 53711). GAP was set for polypeptide sequence comparison with the following setting: GAP creation penalty of 3.0
nalty) and a GAP extension penalty of 0.1
). The sequence identity of the polynucleotide molecules was set as follows for DNA sequence comparison:
. The GAP creation penalty of 0 and the GAP extension penalty of 0.3 are examined in a similar manner using GAP.

The enzyme preparation according to the invention can be carried out from microorganisms, preferably from bacteria, archea or fungi, in particular from Bacillus, preferably Bacillus agaradherens species, and Bacillus agaradherens with all species based on aligned 16S rDNA sequences. It is preferably performed from a bacterium, such as a bacterium belonging to an alkalophilic Bacillus strain selected from the group consisting of highly related Bacillus species which are preferably at least 95%, even more preferably at least 98% homologous. Substantially homologous proteins and polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably small in nature, ie, conservative amino acid substitutions (see Table 2) and other substitutions that do not significantly affect the folding or activity of the protein or polypeptide; Small deletions of about 30 amino acids; amino-terminal methionine residues, small amino- or carboxyl-terminal extensions such as small linker peptides within about 20-25 residues, or purifications such as polyhistidine moieties, protein A ( Small extension that promotes (affinity labeling) (Nilsson et al., EMBO J., 4: 1075, 1985)
Nilsson et al., Methods Enzymol., 198: 3, 1991; generally Ford et al., Protei
n Expression and Purification 2: 95-107,1991; incorporated herein by reference). DNA encoding affinity labels are commercially available (eg, Pharmacia Biotec).
h, Piscataway, NJ; New England Biolabs, Beverly, MA). However, even though it is preferred that the changes be small in nature, such changes may cause amino-
Alternatively, it may be large in nature, such as a fusion of large polypeptides of up to 300 amino acids or more as both carboxyl-terminal extensions.

Table 1 Conservative amino acid substitution Basicity: arginine, lysine, histidine Acidity: glutamic acid, aspartic acid Polarity: glutamine, asparagine Hydrophobic: leucine, isoleucine, valine Aromatic: phenylalanine, tryptophan, tyrosine Small: glycine, alanine, Serine, threonine, methionine

In addition to the 20 standard amino acids, non-standard amino acids (eg, 4-hydroxyproline, 6-N-methyllysine, 2-aminoisobutyric acid, isovaline and α-methylserine) are also included in the amino acid residues of the polypeptide according to the invention. It may be used instead.
A limited number of non-conservative amino acids, amino acids not encoded by the genetic code, and unnatural amino acids may be used in place of amino acid residues. "Unnatural amino acids"
It has been modified after protein synthesis and / or has a different chemical structure in the side chain than standard amino acids. Unnatural amino acids are chemically synthesized or, preferably, are commercially available, and include pipecolic acid, thiazolidine carboxylic acid, dehydroproline, 3- and 4-methylproline, and 3,3-dimethylproline.

Essential amino acids in the mannanase polypeptides of the present invention may be determined by site-directed mutagenesis or alanine scanning mutagenesis (Cunningham and Wells, Sci.
ence, 244: 1081-1085, 1989) can be identified according to procedures known in the art. In the latter technique, a single alanine mutation is introduced at every residue in the molecule, and the resulting mutant molecule has a biological activity (ie, mannanase activity) to identify amino acid residues that are important for the activity of the molecule. Tested for Hilton et al
See also, J. Biol. Chem., 271: 4699-4708, 1996. The active site of the enzyme or other biological interactions, as well as mutations of the putative contact site amino acids, may be associated with the physical physics of the structure as revealed by techniques such as nuclear magnetic resonance, crystallographic techniques, electron diffraction or photoaffinity labeling. Can be determined by statistical analysis. For example, de Vos et al, Science, 255: 306-312,1992
Smith et al., J. Mol. Biol., 224: 899-904, 1992; Wlodaver et al., FEBS Lett.
309: 59-64,1992. Identification of essential amino acids can also be deduced from analysis of the homology of the polypeptides according to the invention to related polypeptides.

[0039] Numerous amino acid substitutions are described in Reidhaar-Olson and Sauer (Science, 241: 53-57, 1988).
Mutation, recombination and / or rearrangement as disclosed by Bowie and Sauer (Proc. Natl. Acad. Sci. USA, 86: 2152-2156, 1989), WO 95/17413 or WO 95/22625. Shuffling can then be performed and tested using known methods of related screening procedures. Briefly, these authors randomize two or more positions simultaneously in a polypeptide or perform recombination / rearrangement of different mutations (WO95 / 17413, WO95 / 22625), followed by functionalization. Disclosed are methods for selecting for a polypeptide and then sequencing the mutated polypeptide to determine the range of allowable substitutions at each position. Other methods that can be used include phage display (eg, Lowman et al.,
Biochem. 30: 10832-10837, 1991; US Patent No. 5,223,409 to Ladner et al.
Huse, WIPO publication WO 92/06204) and region-directed mutagenesis (De
rbyshire et al., Gene, 46: 145, 1986; Ner et al., DNA, 7: 127, 1988).

The mutagenesis / rearrangement method as described above can be combined with a high-throughput automated screening method to detect the activity of the mutated polypeptide cloned in the host cell. The mutated DNA molecule encoding for the active polypeptide can be recovered from the host cell and rapidly sequenced using current equipment.
These methods allow rapid determination of the importance of individual amino acid residues in a polypeptide of interest and can be applied to polypeptides of unknown structure. Using the above method, one of skill in the art would identify and / or identify various polypeptides that were substantially homologous to residues 32-343 of SEQ ID NO: 2 and retained the mannanase activity of the wild-type protein. Can be made.

Protein Production The proteins and polypeptides of the present invention, including full chain proteins, fragments thereof and fusion proteins, can be produced in genetically engineered host cells according to conventional techniques. Suitable host cells are cell types that can be transformed or transfected with foreign DNA and grown in culture, including bacteria, fungal cells, and higher eukaryotic cells that have been cultured. Bacterial cells, especially cultured cells of Gram-positive organisms, are preferred. For example, Bacillus subtilis, Bacillus lentus, Bacillus b
revis, Bacillus stearothermophilus, Bacillus alkalophilus, Bacillus a
myloliquefacience, Bacillus coagulans, Bacillus circulans, Bacillus lau
tus, Bacillus thuringiensis, Bacillus licheniformis and Bacillus agara
Gram-positive cells of the genus Bacillus of the group consisting of dherens, especially Bacillus agaradherens, are particularly preferred.

Techniques for manipulating cloned DNA molecules to introduce foreign DNA into various host cells are described in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd.
ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; Au
subel et al. (eds.), Current Protocols in Molecular Biology, John Wiley and
Sons, Inc., NY, 1987; "Bacillus subtilis and other Gram-Positive Bacteria"
, Sonensheim et al., 1993, American Society for Microbiology, Washington DC
, Which are incorporated herein by reference. Generally, the DNA sequence encoding the mannanase of the present invention is operably linked to other genetic elements required for its expression, usually including a transcription promoter and terminator, in an expression vector. Vectors will also usually include one or more selectable markers and one or more origins of replication, although those of skill in the art will appreciate that in some systems,
It will also be appreciated that the selectable marker may be provided on a separate vector so that the replication of the foreign DNA is effected by integration into the host cell genome. The selection of promoters, terminators, selectable markers, vectors and other elements is a matter of ordinary design within the level of ordinary skill in the art. Many such elements are described in the literature and are available from commercial sources.

To direct a polypeptide into the secretory pathway of a host cell, a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is formed in the expression vector. The secretory signal sequence may be that of the polypeptide, or may be derived from other secreted proteins or synthesized de novo. Numerous suitable secretion signal sequences are known in the art, and
For a complete description of secretion in Bacillus host cells, see "Bacillus subtilis
and other Gram-Positive Bacteria ", Sonensheim et al., 1993, American Socie
ty for Microbiology, Washington DC and Cutting, SM (eds.) "Molecular B
Reference is made to "Iological Methods for Bacillus", John Wiley and Sons, 1990.
The secretory signal sequence is joined to the DNA sequence in the correct reading frame. Although secretory signal sequences are usually located 5 'to the DNA sequence encoding the polypeptide of interest, certain signal sequences may be located elsewhere in the DNA sequence of interest (eg,
Welch et al., US Pat. No. 5,037,743; Holland et al., US Pat.
No. 143,830).

[0044] The transformed or transfected host cells are cultured in a medium containing nutrients and other components necessary for the growth of the selected host cells according to conventional procedures. A variety of suitable media are known in the art, including defined media and complex media, and typically contain a carbon source, a nitrogen source, essential amino acids, vitamins and minerals. The medium may also contain components such as growth factors or serum, if necessary.
Growth media is usually selected for cells containing exogenously added DNA, for example, by drug selection or lack of essential nutrients, which is supplemented by a selectable marker placed on the expression vector, or Co-transfected inside.

Protein Isolation When the expressed recombinant polypeptide is secreted, the polypeptide may be purified from the growth medium. Preferably, the expression host cells are removed from the medium (eg, by centrifugation) prior to purification of the polypeptide. When the expressed recombinant polypeptide is not secreted from the host cell, the host cell is preferably disrupted, releasing the polypeptide into an aqueous "extract", which is the first step in such purification techniques. It is. Preferably, the expression host cells are collected from the medium before cell disruption (eg, by centrifugation). Cell disruption can be achieved by conventional techniques, for example by lysozyme digestion or by exposing the cells to high pressure. For a detailed description of such cell disruption techniques, see (Robert K. Scobes, Protein Purification, Second edition, Springer-Verlag
)reference.

[0046] Whether the expressed recombinant polypeptide (or chimeric polypeptide) is secreted or not, it can be purified using fractionation and / or conventional purification methods and media. Ammonium sulfate precipitation and acid or chaotrope extraction may be used for sample fractionation. Exemplary purification steps include hydroxyapatite,
There are size exclusion, FPLC and reversed phase high performance liquid chromatography. Suitable anion exchange media include derivatized dextrin, agarose, cellulose, polyacrylamide, specialty silica, and the like. PEI, DEAE, QAE and Q derivatives are preferred, and DEAE Fast-Flow Sepharose (Pharmacia, Piscataway, NJ) is particularly preferred. Exemplary chromatography media include media derived with phenyl, butyl, or octyl groups, such as Phenyl-Sepharose FF (Pharmacia), Toyopearl
butyl 650 (Toso Haas, Montgomeryville, PA), Octyl-Sepharose (Pharmacia) and the like; or polyacrylic resin such as Amberchrom CG 71 (Toso Haas). Suitable solid supports include glass beads, silica-based resins, cellulose resins,
There are agarose beads, cross-linked agarose beads, polystyrene beads, cross-linked polyacrylamide resins and the like, which are insoluble under the conditions in which they are used. These supports may be modified with an amino group, a carboxyl group, a sulfhydryl group, a hydroxyl group, and / or a reactive group capable of binding the protein with a carbohydrate moiety. Examples of coupling chemistry include cyanogen bromide activation, N-hydroxysuccinimide activation, epoxide activation, sulfhydryl activation, hydrazine activation, and carboxyl and amino derivatives for carbodiimide coupling chemistry. These and other solid media are well known and widely used in the art, and are available from commercial sources. The choice of a specific method is a matter of ordinary design and is determined in part by the nature of the support chosen. For example, Affinity Chromatography: Principles
& Methods, Pharmacia LKB Biotechnology, Uppsala, Sweden, 1988.

The polypeptide of the present invention or a fragment thereof may be produced by chemical synthesis. The polypeptides of the invention may be monomeric or multimeric, glucosylated or non-glycosylated, pegylated or non-pegylated, and may or may not contain an initial methionine amino acid residue. You may.

[0048] Based on the sequence information disclosed herein, the mannanases of the present invention may be encoded by SEQ ID NO. The DNA sequence shown in 1, at least positions 97 to 1029
The full-length DNA sequence including the DNA sequence at the position is cloned. Cloning is carried out by standard procedures known in the art, such as: ■ preparing a genomic library from Bacillus strains, in particular strain B. agaradherens, NCIMB 40482; ■ placing such a library on a suitable substrate plate ■ SEQ ID NO. A clone containing the polynucleotide sequence of the present invention is identified by standard hybridization techniques using a probe based on SEQ ID NO. Inverse PCR using primers based on sequence information from
A clone is identified from the Bacillus agaradherens, NCIMB 40482 genomic library by a tactic. For more information on inverse PCR, see MJMcPherson et al.
("PCR A practical approach" Information Press Ltd, Oxford England).

The sequence information disclosed herein (SEQ ID NO. 1, SEQ ID N.
O. According to 2), the homologous mannanase of the invention is encoded by a similar strategy using genomic libraries from related microorganisms, in particular genomic libraries from other strains of the genus Bacillus, such as alkalophilic species of Bacillus. Isolating a homologous polynucleotide sequence is a routine task for those skilled in the art. On the other hand, DNA encoding the mannan or galactomannan degrading enzyme of the present invention
Is the DNA obtained from the plasmid present in Escherichia coli DSM12180.
Through the use of synthetic oligonucleotide probes made based on the NA sequence, they can be successfully cloned from a suitable source, such as any of the above organisms.

Thus, the polynucleotide molecule of the present invention is Escherichia coli DSM12
180, and a plasmid obtained by cloning as described above has been deposited. Moreover, the present invention relates to the strain Escherichia coli DSM12180
The present invention also relates to an isolated substantially pure biological culture. In this context, the term "enzyme preparation" refers to a conventional enzyme fermentation product, which is likely to be isolated and purified from a single species of microorganism (such preparations usually contain several different enzyme activities) A single-component enzyme, preferably an enzyme derived from a bacterial or fungal species using conventional recombinant techniques, wherein the enzyme has been fermented and then possibly separately isolated and purified and comprises a different species, preferably A mixture of fungal or bacterial species); a fermentation product of a microorganism that serves as a host cell for the expression of recombinant mannanase, provided that the microorganism is another enzyme that is a natural fermentation product of the microorganism, such as a pectolytic enzyme; Protease or cellulase), ie, an enzyme complex normally produced by the corresponding natural microorganism.

In the method for producing the enzyme preparation of the present invention, a microorganism capable of producing mannanase under conditions capable of producing the enzyme, such as a wild-type strain, is cultured, and the enzyme is recovered from the culture. The cultivation is performed using conventional fermentation techniques, for example, in a shake flask or fermentor with agitation in a growth medium that induces the production of the mannanase enzyme, while ensuring sufficient aeration. The growth medium may contain conventional N sources such as peptone, yeast extract or casamino acids, small amounts of conventional C sources such as dextrose or sucrose, and inducers such as guar gum or carob gum. Good. Recovery can be by conventional techniques, such as separation of biomass and supernatant by centrifugation or filtration, recovery of the supernatant, or disruption of the cell if the enzyme of interest is inside the cell, possibly subsequent to that described in EP 0 406 314. Purification or crystallization as described in WO 97/15660 can be performed.

Immunocross- Reactivity Polyclonal antibodies used in examining immune cross-reactivity may be produced by using purified mannanase enzyme. More specifically, the antiserum against mannanase of the present invention is described in N. Axelsen et al. In: A Manual of Quantitative Immun.
oelectrophoresis, Blackwell Scientific Publications, 1973, Chapter 23 or
A. Johnstone and R. Thorpe, Immunochemistry in Practice, Blackwell Scientifi
c Made by immunizing rabbits (or other rodents) according to the procedures described in Publications, 1982 (more specifically, pages 27-31). Purified immunoglobulins are for example salt precipitated ((NH ₄ ) ₂ SO ₄ ), followed by dialysis and eg DEAE-Sephad
Obtained from antisera by ion exchange chromatography on ex. Immunochemical characterization of proteins was performed using Ouchterlony double diffusion analysis (O. Ouchterlony in: Ha
ndbook of Experimental Immunology (DMWeir, Ed.), Blackwell Scientific Pu
blications, 1967, pp. 655-706), cross immunoelectrophoresis (N. Axelsen et al., supra, C
hapters 3 and 4) or rocket immunoelectrophoresis (N. Axelsen et al., Chapter 2)
Can be performed by

Examples of useful bacteria that produce the enzymes or enzyme preparations of the present invention are preferably Baci
Gram-positive bacteria from the llus / Lactobacillus subclass, preferably strains from the genus Bacillus, more preferably strains of Bacillus agaradherens, especially strain Bacillus agaradherens,
NCIMB 40482. The present invention includes an isolated mannanase having the properties described above and containing no homologous impurities and produced using conventional recombinant techniques.

Determination of the catalytic activity of mannanase (ManU) Colorimetric assay: Substrate: 0.2% AZCL-galactomannan from Carob in 0.1 M glycine buffer at pH 10.0 (Megazyme, Australia). Assays are performed in 1.5 ml Eppendorf microtubes on a thermomixer under temperature control at 40 ° C. with stirring. Incubation of 0.750 ml of substrate for 20 minutes with 0.05 ml of enzyme is stopped by centrifugation at 15000 rpm for 4 minutes. The color of the supernatant is measured at 600 nm in a 1 cm cuvette.
One ManU (mannanase unit) indicates 0.24 abs at 1 cm.

Obtained strain of Bacillus agaradherens mannanase NCIMB 40482 Bacillus agaradherens NCIMB 40482 contains a DNA sequence encoding a mannanase enzyme. E. coli strain: E. coli SJ2 cells (Diderichsen, B., Wedsted, U., Hedegaard, L.
Cloning of aldB encoding tolactate decarboxylase, J. Bacteriol.
, 172,4315-4321) and prepare the BIO-RAD as described by the supplier.
Was transformed by electroporation using a Gene Pulser ^™ electroporator. B. subtilis PL2306: This strain is a strain of Bs with disrupted apr and npr genes broken in the transcription unit of the known Bacillus subtilis cellulase gene.
ubtilis DN1885 (Diderichsen, B., Wedsted, U., Hedegaard, L., Jensen, BR
, Sjoholm, C. (1990), Extracellular enzyme from Bacillus brevis, α-acetolactate decal
Cloning of aldB encoding J-boxylase, J. Bacteriol., 172,4315-43
21) The cells are cellulase-negative cells. Destruction is essentially (Eds.AL
.Sonenshein, JAHoch and Richard Losick (1993), Bacillus subtilis and oth
er Gram-Positive Bacteria, American Society for microbiology, p.618). Prepare competent cells and prepare them in Yasbin, RE, Wilson, GAand Young, FE (1975
) Transformation and transfection in lysogenic strains of Bacillus subtil
is: evidence for selective induction of prophage in competent cells, J.Bac
teriol., 121, 296-304.

The plasmid pSJ1678 (WO94 / 19, incorporated herein by reference in its entirety).
PMOL944: This plasmid essentially contains the kanamycin resistance gene, an element capable of growing the plasmid in Bacillus subtilis, and contains the B. licheniformis AT
PUB110 derivative with a strong promoter and signal peptide cloned from the amyL gene of CC14580. The signal peptide is
DNA encoding the mature part of the protein, fused to its signal peptide
Contains a SacII site which makes it convenient for cloning. This leads to the expression of the preprotein towards the outside of the cell. The plasmid was constructed by conventional genetic engineering techniques as described briefly below.

Construction of pMOL944 The pUB110 plasmid (McKenzie, T, et al., 1986, Plasmid, 15: 93-103) was cut with the unique restriction enzyme Ncil. Plasmid pDN1981 (PLJorgensen
et al., 1990, Gene, 96, p. 37-41), the PCR fragment amplified from the amyL promoter was cut with Ncil, inserted into Ncil-cut pUB110,
The plasmid pSJ2624 was obtained.

The two PCR primers used have the following sequence: # LWN5494 5′-GTCGCCGGGGGCGGCCGCTATCAAAT
TGGTAACTGTATATCCAGC-3 '# LWN5495 5'-GTCGCCCGGGAGCTCTGATCAGGT
ACCAAGCTTGTCGACCTGCAGAATGAGGCAGCAAGA
AGAT-3 '

Primer # LWN5494 inserts a NotI site into the plasmid. The plasmid pSJ2624 was then cut with SacI and NotI and pD
The new PCR fragment amplified with the amyL promoter encoded by N1981 was digested with SacI and NotI, and this DNA fragment was inserted into SacI-NotI digested pSJ2624 to obtain plasmid pSJ2670.

This cloning was carried out with a similar promoter, but in the opposite direction, with the first amy
Replaces L promoter cloning. The two primers used for PCR amplification have the following sequences:
AAGCTTGTCGACCTGCAGAATGAGGCAGCAAGAAGA
T-3 '# LWN5939 5'-GTCGGGGCTCTTCAATTGGTAAC
TGTATCTCAGC-3 '

The plasmid pSJ2670 was cut with the restriction enzymes PstI and BclI, encoding the alkaline amylase SP722 (disclosed in the international patent application published as WO 95/26397, which is hereby incorporated by reference in its entirety). The PCR fragment amplified from the cloned DNA sequence
The plasmid was cut with I and inserted to obtain plasmid pMOL944. The two primers used for PCR amplification have the following sequences: # LWN7864 5'-AACAGCTGATCACCGACTGATCTTTT
TAGCTTGGCAC-3 '# LWN7901 5'-AACTGCAGCCGCGGCACATCATAAAA
TGGGACAAATGGG-3 'Primer # LWN7901 inserts a SacII site into the plasmid.

Cloning of Mannanase Gene from Bacillus agaradherens Genomic DNA Preparation : Strain Bacillus agaradherens NCIMB 40482 was grown in liquid medium as described in WO 94/01532. Cells were collected after incubation at 30 ° C. and 300 rpm for 16 hours, and genomic DNA was collected from Pitcher et al. (Pitcher, DG, Saunders, NA).
, Owen, RJ (1989), Rapid extraction of bacterial genomic DNA with guanidium thiocyanate, Lett. Appl. Microbiol., 8, 151-156).

Construction of Genomic Library : Genomic DNA was partially digested with the restriction enzyme Sau3A, and size-fractionated by electrophoresis on a 0.7% agarose gel. Fragments 2 and 7 kb in size were subjected to DEAE-
Isolated by electrophoresis on cellulose paper (Dretzen, G., Bellard, M., Sassone-Co
rsi, P., Chambon, P. (1981), Reliable method for recovery of DNA fragments from agarose and acrylamide gels, Anal. Biochem., 112, 295-298). The isolated DNA fragment was ligated to BamHI-cut pSJ1678 plasmid DNA, and the ligation mixture was used to transform E. coli SJ2.

Identification of Positive Clones : The E. coli DNA library constructed as described above was ligated with 0.2% AZCL-
Screened on LB agar plates containing galactomannan (Magazyme) and 9 μg / ml chloramphenicol and incubated overnight at 37 ° C. Clones displaying mannanase activity appeared as blue diffuse halos. Plasmid DNA from one of these clones was incubated with 1 ml of overnight culture broth (cells incubated at 37 ° C. in TY containing 9 μg / ml chloramphenicol with shaking at 250 rpm) by Qiagen plasmid spin preps. Isolated. This clone (MB525) was further characterized by DNA sequencing of the cloned Sau3A DNA fragment. DNA sequencing was performed by primer walking using a Taq Deoxy End Cycle Sequencing Kit (Perkin-Elmer, USA), a fluorescently labeled terminator and appropriate oligonucleotides as primers.
ng). Analysis of sequence data is described by Devereux et al. (1984) Nucleic Acids Res., 12, 387-395.
It went according to. The sequence encoding mannanase is shown in SEQ ID NO: 1. The derived protein sequence is shown in SEQ ID NO: 2.

Subcloning and Expression of Mannanase in B. subtilis : The mannanase-encoding DNA sequence of the present invention was PCR amplified using a PCR primer set consisting of the following two oligonucleotides: mannanase. Up. SacII 5'-CAT TCT GCA G CC GCG G CA GCA AGT A
CA GGC TTT TAT GTT GAT GG-3 'mannanase. under. NotI 5'-GAC GAC GTA CAA GCG GCC GC CCT
TT CCC TAA CAT GAT GAT ATT TTC G-3 'Restriction sites SacII and NotII are underlined.

Chromosomal DNA isolated from B. agaradherens NCIMB 40482 as described above was used as a template in a PCR reaction using Amplitaq DNA polymerase (Perkin Elmer) according to the manufacturer's instructions. The PCR reaction was performed with 200 μM of each dNTP,
2.5 units of AmpliTaq polymerase (Perkin Elmer, Cetus, USA) and 100 units
PCR buffer (10 mM Tris-HC, pH 8.3) containing pmol of each primer
1, 50 mM KCl, 1.5 mM MgCl ₂ , 0.01% (w / v) gelatin)
Started inside. The PCR reaction was performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94 ° C. for 1 minute followed by 30 PCR cycles performed using a cycle profile of denaturation at 94 ° C. for 30 seconds, 1 hour at 60 ° C.
Annealing for 2 minutes and extension at 72 ° C. for 2 minutes. Aliquot 5 μL of the amplification product to 0
. Analysis was performed by electrophoresis on a 7% agarose gel (NuSieve, FMC). Size 1
. The appearance of a 4 kb DNA fragment indicated proper amplification of the gene segment.

Subcloning of PCR Fragments A 45 μL portion of the PCR product obtained as described above was purified using the QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. Purified DNA
Elution was performed with 50 μL of 10 mM Tris-HCl 8.5. 5 μg of pMOL944 and 25 μL of the purified PCR fragment were combined with SacII and No.
Cleavage at tI, electrophoresed on 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gel, excise relevant fragments from gel and QlAquick according to manufacturer's instructions.
Purification was performed using a gel extraction kit (Quigen, USA). Then, the isolated PCR
The DNA fragment was ligated to SacII-NotI cut and purified pMOL944. Ligation was performed overnight at 16 ° C. using 0.5 μg of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany). The ligation mixture was used to transform competent B. subtilis PL2306. Transformed cells were placed on LBPG-10 μg / ml kanamycin plates. Three
After 18 hours of incubation at 7 ° C., colonies were visible on the plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broth. One such positive clone was re-lined several times on agar plates as described above and this clone was named MB594. Clone MB594 was grown overnight at 37 ° C. in TY-10 μg / ml kanamycin and the following day cells 1
ml and use Qi according to the manufacturer's recommendations for B. subtilis plasmid preparation.
Plasmids were isolated from the cells with the aprep Spin Plasmid Miniprep Kit # 27106. When this DNA was subjected to DNA sequencing, it showed a DNA sequence corresponding to the mature portion of mannanase, that is, positions 94 to 1404 of attached SEQ ID NO: 3. The determined mature protein is shown in SEQ ID NO: 4. SEQ I
It will be apparent that the 3 'end of the mannanase encoded by the sequence of D NO: 1 has been changed to that shown in SEQ ID NO: 3 due to the design of the lower primer used in the PCR. . The amino acid sequence obtained is shown in SEQ.
D NO: 4 and the C-terminus of SEQ ID NO: 2 (SHHVRE
IGVQFSAADNSSGQTALYVDNVTLR) has SEQ ID NO
: 4 at the C-terminus (IIMLK).

Medium : TY (Ausubel, FM et al. (Eds.), "Current protocols in Molecular Biology",
John Wiley and Sons, 1995) LB agar (Ausubel, FM et al. (Eds.), "Current protocols in Molecular Biolo
gy ", John Wiley and Sons, 1995) LBPG was 0.5% glucose and 0.05M potassium phosphate, pH 7.0.
LB agar (see above) supplemented with. The BPX medium is described in EP05050680 (WO91 / 09129).

Expression, Purification and Characterization of Mannanase from Bacillus agaradherens Clone MB594, obtained as described above in the section on materials and methods,
Grow in 25 × 200 ml BPX medium containing 10 μg / ml kanamycin in two 500 ml baffled shake flasks at 7 ° C., 300 rpm. 6500 shake flask culture of clone MB594 (batch # 9813)
ml was collected and the pH was adjusted to 5.5. 146 ml of cationic agent (C521) and 292 ml of anionic agent (A130) were added during agitation for aggregation. Agglomerated material was separated by centrifugation at 9000 rpm for 20 minutes at 6 ° C. using a Sorval RC 3B centrifuge. The supernatant is clarified using a Whatman glass filter GF / D,
Finally, the cells were centrifuged in a filtron with a cutoff of 10 kDa. 750 ml of this concentrate was adjusted to pH 7.5 using sodium hydroxide. The clear solution was mixed with 900 ml Q-equilibrated with 50 mmol Tris, pH 7.5.
Anion exchange chromatography was performed using a Sepharose column. Fractions with mannanase activity were eluted using a sodium chloride gradient. The pure enzyme showed a single band on SDS-PAGE with a molecular weight of 38 kDa.
The amino acid sequence of the mannanase enzyme, ie, the translated DNA sequence, is as shown in SEQ ID NO:
: 2.

Determination of the kinetic constants : Substrate: Locust bean gum (Carob) and reducing sugar assay (PHBAH), Locust bean gum (G-0753) from Sigma Different concentrations of locust bean gum and incubation at 40 ° C., pH 10 for 20 minutes at pH 10. The kinetic measurements used showed Kcat: 467 / sec Km: 0.08 g / L MW: 38 kDa pl (isoelectric point): 4.2. The optimum temperature of mannanase was found to be 60 ° C. The pH activity profile showed a maximum activity of pH 8-10. Tris in DSC differential scanning calorimetry
A melting point of 77 ° C. at pH 7.5 in s-buffer indicated that the enzyme was very thermostable. 0.2% AZCL-galactomannan from Carob as substrate and 40 ° C.
Detergent compatibility using incubation as described above shows excellent compatibility with conventional liquid detergents and good compatibility with conventional powder detergents.

Acquisition of Bacillus subtilis mannanase 168 Bacillus subtilis β-mannanase was purified and characterized as follows: Ba
The cillus subtilis genome was examined for homology to known Bacillus species β-mannanase gene sequences (Mendoza et al., Biochemica et Biophysica Acta, 1243: 55
2-554, 1995). The coding region of ydhT of unknown product showed 58% similarity to known Bacillus β-mannanase. The following oligonucleotide: 5'-GCT
CAA TTG GCG CAT ACT GTG TCG CCT GTG-
3 'and 5'-GAC GGA TCC CGG ATT CAC TCA
ACG ATT GGCG-3 'was designed to amplify the sequence coding for the mature part of the putative β-mannanase. Using the entire genomic DNA from Bacillus subtilis strain 1A95 as a template, the ydhT mature region was amplified using the primers described above. PCR was performed using AMPLITAQ DNA polymerase (Perkin Elmer, App.
lied Biosystems, Foster City, Calif.). Following an initial melting period of 5 minutes at 95 ° C., 25 cycles of the following program: melting at 95 ° C. for 1 minute, annealing at 55 ° C. for 2 minutes, and 72 ° C.
For 2 minutes. After the last cycle, the reaction was maintained at 72 ° C. for 10 minutes until complete extension. The PCR product is a QlAquick PCR purification kit (Qiagen, Chatswo
rth, CA).

The mature ydhT region from Bacillus subtilis strain 1A95 was inserted into the expression vector pPG1524 (described previously) as described below. Amplified one
The 028 bp fragment was cut with MfeI and BamHI. Expression vector pPG1
527 was cut with EcoRI and BamHI. Restriction products are QlAquick PCR
Purification was performed using a purification kit (Qiagen, Chatsworth, CA). T4D for two fragments
Ligated (13 hours, 16 ° C.) using NA ligase and competent E.col
i strain DH5-α was used to transform. D. Ampicillin resistant colonies
Cultured for NA production. The DNA was then characterized by restriction analysis. Plasmid pPG3200 contains the mature region of the ydhT gene. The plasmid pPG3200 was then used to competently compete with Bacillus subtilis strain PG632 (Sa
unders et al., 1992).

Seven kanamycin resistant Bacillus subtilis colonies and one PG632
A control clone was picked and 1 ml of 25% maltrin, 10 mM MnC
20/20 supplemented with 120 μl of l ₂ and 20 μl of 50 mg / ml kanamycin
/ 5 medium (20 g / L tryptone, 20 g / L yeast extract, 5 g / L NaCl
) Grow in 20 ml. Clones were transformed at 250 r for protein expression.
Grow overnight in 250 ml baffled flasks with shaking at pm and 37 ° C. Cells were sedimented at 14,000 rpm for 15 minutes. Each supernatant 1
μL was diluted with 99 μL of 50 mM sodium acetate (pH 6.0). 1 μL of this diluted solution was mixed with endo-1,4-β-mannanase Beta-Ma according to the manufacturer's instructions.
Assays were performed using nnazyme Tabs (Megazyme, Ireland). Absorbance measured by Beckman DU
Read at 590 nm on a 640 spectrophotometer. Clone 7 showed a maximum absorbance of 1.67. The PG632 control showed no absorbance at 590 nm.

The supernatant was purified on a 10-20% Tris-glycine gel (Novex, San Diego, Ca) using SDS-
Analysis by PAGE confirmed the expected protein size of 38 kDa. Samples were prepared as follows. 500 μL sample of ydhT clone 7 and P
G632 supernatant was sedimented with 55.5 μL of 100% trichloroacetic acid (Sigma) and 5%
After washing with 100 μL of trichloroacetic acid, Tris-glycine SDS sample buffer (Nov
ex) Resuspended in 50 μL and boiled for 5 minutes. 1 μL of each sample is 9 at 30 mA.
Electrophoresed on gel for 0 min. The large band protein is yd
In the case of hT clone 7, a run at 38 kDa was observed. A 10 L fermentation of Bacillus subtilis ydhT clone 7 was performed in a B. Braun Biostat C fermenter. Fermentation conditions were as follows. Cells were grown for 18 hours at 37 ° C. in a rich medium similar to 20/20/5. At the end of the fermentation run, the cells were removed and the supernatant was concentrated to 1 L using a tangential flow filtration system. Β- in concentrated supernatant
The final yield of mannanase was found to be 3 g / L.

The purification of β-mannanase from the fermentation supernatant was carried out as follows: 500 ml of supernatant
Was centrifuged at 10,000 rpm at 4 ° C. for 10 minutes. Then, the centrifuged supernatant was added to Spectrapor 12,000 to 14,000 mol. wt. Cut-off membrane (Spectr
um), exchange twice with 4 L of 10 mM potassium phosphate (pH 7.2) to obtain 4
Dialysis at 0 ° C overnight. The dialyzed supernatant was centrifuged at 10,000 rpm at 4 ° C. for 10 minutes. A 200 ml Q Sepharose fast flow (Pharmacia) anion exchange column was equilibrated with 1 L of 10 mM potassium phosphate (pH 7.2) at 20 ° C., and the supernatant was 300 m
1 was placed on the column. 210 ml (sample A) and 175 ml (sample B
) Were collected. Two fractions were assayed as above, except that the sample was 50 mM sodium acetate (pH
6.0) When diluted with 199 μL, they exhibited absorbances of 0.38 and 0.52, respectively. Add 2 μL of each sample to Tris-glycine SDS sample buffer (Nov
ex, CA), and boiled for 5 minutes. 10-20% of the obtained sample
Electrophoresis was performed on a Tris-glycine gel (Novex, Ca) at 30 mA for 90 minutes. A major band corresponding to 38 kDa was present in each sample and accounted for over 95% of total protein. BCA protein assay (Pierce) was performed on both samples using bovine serum albumin as a standard according to the manufacturer's instructions. Samples A and B contained 1.3 mg / ml and 1.6 mg / ml, respectively, of β-mannanase. The protein was identified by ion spray mass spectrometry and amino terminal amino acid sequence analysis.

The purified β-mannanase sample was used to characterize enzymatic activity as follows. In all assays, as described earlier, end-
1,4-β-mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) was used. The activity in the pH range 3.0-9.0 was examined in 50 mM citrate phosphate buffer,
Activity measurements at pH 9.5 were performed in 50 mM CAPSO (Sigma) and pH 10.
In the range of 0 to 11.0, 50 mM CAPS buffer was used. Bacillus subtilis
It was found that the optimal pH of β-mannanase was pH 6.0 to 6.5. The temperature activity profile was examined in a 50 mM citrate phosphate buffer (pH 6.5).
The enzyme showed optimal activity at 40-45 ° C. Bacillus subtilis β-mannanase retained significant activity below 15 ° C and above 80 ° C. The specific activity for β-1,4-galactomannan was 160,00 using endo-1,4-β-mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) according to the manufacturer's instructions.
0 μmol / min · mg β-mannanase. Bacillus subtili
s The nucleotide and amino acid sequence of β-mannanase is shown in SEQ ID NO:
: Indicated by 5 and 6.

The mannanase may be present in the present invention at a pure enzyme level of preferably 0.0001 to 2%, more preferably 0.0005 to 0.1%, most preferably 0.001 to 0.02% by weight of the composition. In the composition.

The enzymes of the present invention also include a cellulose binding domain (CBD) in addition to the enzyme core containing the catalytic domain, wherein the cellulose binding domain and the enzyme core (catalytically active domain) of the enzyme are operably linked. Have been. The cellulose binding domain (CBD) may be present as an endogenous portion of the encoded enzyme, or other sources of CBD may be introduced into the enzyme to form an enzyme hybrid. In this context, the term “cellulose binding domain” is defined by Peter Tomme
et al. "Cellulose-Binding Domains: Classification and Properties" in "Enz
ymatic Degradation of Insoluble Carbohydrates ", John N. Saddler and Michae
l Understood as defined in H. Penner (Eds.), ACS Symposium Series, No. 618, 1996. In this definition, more than 120 cellulose-binding domains consist of 10 families (
IX), and CBD is used for cellulase, xylanase, mannanase,
It has been found to be found in various enzymes such as arabinofuranosidase, acetylesterase and chitinase. CBD is also found in non-hydrolyzable polysaccharide binding proteins in algae, such as the red alga Porphyra purpurea; Tomme et al.
See above. However, most CBDs are from cellulases and xylanases, and CBDs are found at or at the N and C termini of proteins. Enzyme hybrids are known in the art (eg, WO 90/00609).
And EO95 / 16782), incorporating into the host cell a DNA construct comprising at least a fragment of the DNA encoding the cellulose binding domain linked with or without a linker to the DNA sequence encoding the mannanase enzyme. May be grown to express the fusion gene.
The enzyme hybrid is described by the formula: CBD-MR-X where CBD is at least the N of the amino acid sequence corresponding to the cellulose binding domain.
Terminal and C-terminal regions; MR is an intermediate region (linker), a bond, or preferably a short linking group of about 2 to about 100 carbon atoms, more preferably 2 to 40 carbon atoms. Or preferably about 2 to about 100 amino acids, more preferably 2 to 40 amino acids; X is the N-terminal and C-terminal regions of the enzyme of the invention.

The enzymes may be of any suitable origin, such as of plant, animal, bacterial, fungal and yeast origin. The origin may also be mesophilic or extremophilic (cryophilic, eutrophic, thermophilic, barophilic, alkaline, acidophilic, halophilic, etc.). Purified or unpurified forms of these enzymes may also be used. At present, it is customary to modify wild-type enzymes by protein / genetic engineering techniques to maximize performance efficacy with the cleaning compositions of the present invention. For example, variants are designed to increase the compatibility of the enzyme with the common components of such compositions. On the other hand, the optimal pH of the enzyme variant,
Variants may be designed such that bleed or chelant stability, catalytic activity, etc., are tailored to a particular cleaning application.

In particular, attention should be paid to amino acids that are susceptible to oxidation in terms of bleach stability and surface charge in terms of surfactant compatibility. The isoelectric point of such enzymes may be modified by substitution of some charged amino acids, for example, increasing the isoelectric point helps to improve compatibility with anionic surfactants. Enzyme stability may be further enhanced, for example, by forming additional salt bridges and reinforcing metal binding sites to increase the stability of the chelant.

Soil- releasing polymer The laundry detergent composition of the present invention comprises 0.0001 to 20% by weight, preferably 0.001%.
It usually contains 1 to 15%, more preferably 0.01 to 10%, of a cotton polyethylene imine soil release polymer. A preferred cotton polyethylenimine soil release polymer is W. Co., filed April 25, 1997 by Procter & Gamble.
Polyamine backbones corresponding to the following formula, as described in O97 / 42288

Embedded image (Having a modified polyamine formula V _{(n + 1)} W _m Y _n Z), or a polyamine backbone corresponding to the following formula:

Embedded image Including (modified polyamine formula _{V (n-k + 1)} W m Y n Y 'k Z (k has n or less is)), water-soluble or dispersible modified polyamine cotton soil release agent;
The polyamine backbone before modification has a molecular weight of about 200 daltons or more; wherein: i) the V unit is a terminal unit having the formula:

Embedded image ii) W units are backbone units having the formula:

Embedded image iii) Y units are branching units having the formula:

Embedded image iv) Z units are terminal units having the formula:

Embedded imageIn the above formula, the main chain linking R unit is C₂-C₁₂Alkylene, C₄-C₁₂Alkenylene,
C₃-C₁₂Hydroxyalkylene, C₄-C₁₂Dihydroxyalkylene, C₈-
C₁₂Dialkylarylene,-(R¹O)_xR¹-,-(R¹O)_xR⁵(OR ¹ )_x-,-(CH₂CH (OR²) CH₂O)_z-(R¹O)_yR¹(OCH ₂ CH (OR²) CH₂)_w-, -C (O) (R⁴)_rC (O)-, -CH₂C
H (OR²) CH₂-And mixtures thereof; R¹Is
C₂-C₆Alkylene and mixtures thereof; R²Is hydrogen,-(R¹O) _x B and mixtures thereof; R³Is C₁-C₁₈Alkyl, C₇-C₁₂Ants
Alkyl, C₇-C₁₂Alkyl-substituted aryl, C₆-C₁₂Aryl and its
Mixtures thereof; R⁴Is C₁-C₁₂Alkylene, C₄-C₁₂Alkenylene,
C₈-C₁₂Arylalkylene, C₆-C_TenWith arylene and their mixtures
There; R⁵Is C₁-C₁₂Alkylene, C₃-C₁₂Hydroxyalkylene, C₄-
C₁₂Dihydroxyalkylene, C₈-C₁₂Dialkylarylene, -C (O)-
, -C (O) NHR⁶NHC (O)-, -R¹(OR¹)-, -C (O) (R⁴ )_rC (O)-, -CH₂CH (OH) CH₂-, -CH₂CH (OH) CH₂ O (R¹O)_yR¹-OCH₂CH (OH) CH₂-And their mixtures
R⁶Is C₂-C₁₂Alkylene or C₆-C₁₂Is an arylene; the E unit is
Hydrogen, C₁-C_{twenty two}Alkyl, C₃-C_{twenty two}Alkenyl, C₇-C_{twenty two}Arylalkyl
Le, C₂-C_{twenty two}Hydroxyalkyl,-(CH₂)_pCO₂M,-(CH₂)_q SO₃M, -CH (CH₂CO₂M) CO₂M,-(CH₂)_pPO₃M,-(
R¹O)_xB, -C (O) R³Selected from the group consisting of and mixtures thereof
With the proviso that when any E unit of a nitrogen is hydrogen, the nitrogen is not an N-oxide.
B is hydrogen, C₁-C₆Alkyl,-(CH₂)_qSO₃M,-(CH₂)_p CO₂M,-(CH₂)_q(CHSO₃M) CH₂SO₃M,-(CH₂)_q(
CHSO₂M) -CH₂SO₃M,-(CH₂)_pPO₃M, -PO₃M and
M is hydrogen or a sufficient amount of water to satisfy the charge balance
X is a water-soluble anion; k and k 'are from 1 to about 15
M has a value of 4 to about 400; n has a value of 0 to about 200;
p has a value of 1 to 6; q has a value of 0 to 6; r has a value of 0 or 1
W has a value of 0 or 1; x has a value of 1-100; y is 0-10
Has a value of 0; z has a value of 0 or 1.

[0082] These polyamines contain either a linear or cyclic backbone. The polyamine backbone may also include polyamine branches to a greater or lesser degree. Generally, the polyamine backbone described herein is substituted, quaternized, oxidized, or modified at each nitrogen of the polyamine chain, as described below as a unit thereof. You.

For the purposes of the present invention, the term “modification” refers to replacing the backbone-NH hydrogen atom with an E unit (substitution), quaternizing the backbone nitrogen (quaternization), or Oxidation of nitrogen to N-oxide (oxidation) is defined. The terms "modification" and "substitution" are used interchangeably when referring to the process of replacing a hydrogen atom attached to a main chain nitrogen with an E unit. Although quaternization or oxidation may occur without substitution under some circumstances, it is preferred that substitution involves oxidation or quaternization of at least one backbone nitrogen.

The linear or acyclic polyamine backbone that comprises the cotton soil release agent of the present invention has the following general formula:

Embedded image The backbone before modification comprises primary, secondary and tertiary amine nitrogens connected by R "link" units. The cyclic polyamine backbone making up the cotton soil release agent of the present invention has the following general formula:

Embedded image The backbone before modification comprises primary, secondary and tertiary amine nitrogens connected by R "link" units.

For the purposes of the present invention, the primary amine nitrogens that make up the main or branched chains, when modified, are designated as V or Z “terminal” units. For example, when a primary amine moiety located at the end of a major polyamine backbone or branch having the structure: H ₂ NR]-is modified according to the present invention, it is a V "terminal" unit, or simply Displayed as V units. However, for the purposes of the present invention, some or all of the primary amine moiety may remain unmodified, subject to the restrictions further described below. These unmodified primary amine moieties remain "terminal" units due to their position in the backbone. Similarly, having the following structure, primary amine moiety, located at the end of the main polyamine backbone: When -NH ₂ is modified according to the present invention, it is displayed as Z "terminal" unit, or simply Z units. This unit may be left unmodified according to the restrictions further described below.

Similarly, the secondary amine nitrogen making up the main or branched chain, when modified, becomes
It is designated as a "backbone" unit. For example, the main components of the main and branched chains of the present invention, having the following structure, a secondary amine moiety:

Embedded image When modified according to the present invention, it is designated as a W "backbone" unit, or simply as a W unit. However, for the purposes of the present invention, some or all of the secondary amine moiety may remain unmodified. These unmodified secondary amine moieties remain "backbone" units, thanks to their position in the backbone.

Similarly, the tertiary amine nitrogen making up the main or branched chain, when modified,
It is referred to as a Y "branch" unit. For example, a tertiary amine moiety, which is a polyamine backbone or other branch or ring branch point, having the following structure:

Embedded image When modified according to the present invention, it is designated as a Y "branch" unit, or simply as a Y unit. However, for the purposes of the present invention, some or all of the tertiary amine moiety may be left unmodified. These unmodified tertiary amine moieties remain "branched" units due to their position in the backbone. The R units associated with the V, W, and Y unit nitrogens that serve to link the polyamine nitrogen are described below.

The final modified structure of the polyamines of the present invention therefore has the following general formula for linear polyamine cotton soil release polymers: V _{(n + 1)} W _m Y _n z cyclic polyamine cotton soil release polymers the following general _{formula: V (n-k + 1} ) can be represented by _{W m Y n Y 'k Z} . In the case of a ring-containing polyamine, a Y ′ unit of the following formula:

Embedded image Serves as a branch point of a main chain or a branched ring. For each Y ′ unit, there is a Y unit having the formula:

Embedded image This forms the point of attachment of the ring to the main polymer chain or branch. In the unique case where the backbone is a complete ring, the polyamine backbone has the formula:

Embedded image Thus free of Z terminal _{unit, V nk W m Y n Y} 'k above wherein k having the formula is the number of ring forming branching units. Preferably, the polyamine backbone of the present invention contains no rings.

In the case of acyclic polyamines, the ratio of index n to index m relates to the relative degree of branching. The fully unbranched linear modified polyamine according to the invention has the formula: VW _m Z, ie n is 0. The larger the value of n (the lower the ratio of m to n),
The degree of branching in the molecule increases. Typically, the value of m will range from a minimum of 4 to about 400, but it is also preferred when the value of m is large, especially when the value of index n is very low or near zero.

Each of the primary, secondary or tertiary polyamine nitrogens, when modified according to the present invention, can further be represented as a member of one of three general classes of simple substitution, quaternization or oxidation. Unmodified polyamine nitrogen units are classified as V, W, Y or Z units, depending on whether they are primary, secondary or tertiary nitrogen. That is, for the purposes of the present invention, an unmodified primary amine nitrogen is a V or Z unit, an unmodified secondary amine nitrogen is a W unit, and an unmodified tertiary amine nitrogen is a Y unit.

The modified primary amine moiety is designated as a V “terminal” unit having one of three forms: a) A simple substituted unit having the following structure :

Embedded image b) quaternized units having the following structure :

Embedded image (Where X is a suitable charge-balancing counter ion); and c) an oxidized unit having the structure :

Embedded image

The modified secondary amine moiety is represented as a W “backbone” unit having one of three forms: a) A simple substituted unit having the following structure :

Embedded image b) quaternized units having the following structure :

Embedded image (Where X is a suitable charge-balancing counter ion); and c) an oxidized unit having the structure :

Embedded image

The modified tertiary amine moiety is represented as a Y “branched” unit having one of three forms: a) an unmodified unit having the following structure :

Embedded image b) quaternized units having the following structure :

Embedded image (Where X is a suitable charge-balancing counter ion); and c) an oxidized unit having the structure :

Embedded image

Certain modified primary amine moieties are designated as Z “terminal” units having one of three forms: a) Simple substituted units having the following structure :

Embedded image b) quaternized units having the following structure :

Embedded image (Where X is a suitable charge-balancing counter ion); and c) an oxidized unit having the structure :

Embedded image

When any position on a nitrogen is unsubstituted or unmodified, hydrogen is understood to be a substitute for E. For example, primary amine units having one E unit in the form of a hydroxyethyl moiety is a V terminal unit having the formula _{(HOCH 2} CH ₂₎ HN-.

For the purposes of the present invention, there are two types of chain end units, V and Z units.
Z "terminal" units are derived from terminal primary amino moiety of the structure -NH _2. Acyclic polyamine backbones according to the present invention have only one Z unit, and cyclic polyamines have no Z units. Unless the Z unit is modified to form an N-oxide, Z "
The "terminal" unit can be replaced by any of the following E units: The Z unit nitrogen is N-
If oxidized to an oxide, the nitrogen must be modified so that E is not hydrogen.

The polyamines of the present invention have a backbone R “link” that acts to connect the nitrogen atoms of the backbone.
Includes units. The R units consist of units referred to as "hydrocarbyl R" units and "oxy R" units for the purposes of the present invention. The “hydrocarbyl R” unit is
C ₂ -C ₁₂ alkylene, C ₄ -C ₁₂ alkenylene, C ₃ -C ₁₂ hydroxyalkylene (the hydroxyl moiety may be any position on the R unit chain other than the carbon atom directly bonded to the polyamine main chain nitrogen. C ₄ -C ₁₂ dihydroxyalkylene (the hydroxyl moiety occupies any two carbon atoms on the R unit chain other than the carbon atom directly attached to the polyamine backbone nitrogen); C ₈ -C ₁₂ dialkylarylene (for the purposes of the present invention, an arylene moiety having two alkyl substituents as part of the connecting chain). For example, a dialkylarylene unit has the formula:

Embedded imageThe above units need not be 1,4-substituted and are 1,2 or 1,3-substituted C₂-C₁₂ Alkylene, preferably ethylene, 1,2-propylene, and mixtures thereof
And more preferably ethylene. "Oxy" R units include-(R¹O
)_xR⁵(OR¹)_x-,-(CH₂CH (OR²) CH₂O)_z(R¹O)_y R¹(OCH₂CH (OR²) CH₂)_w-, -CH₂CH (OR²) CH₂-
,-(R¹O)_xR¹-And mixtures thereof. Preferred R units are C₂-
C₁₂Alkylene, C₃-C₁₂Hydroxyalkylene, C₄-C₁₂Dihydroxya
Lucylene, C₈-C₁₂Dialkylarylene,-(R¹O)_xR¹-, -CH₂ CH (OR²) CH₂-,-(CH₂CH (OH) CH₂O)_z(R¹O)_yR ¹ (OCH₂CH (OH) CH₂)_w-,-(R¹O)_xR⁵(OR¹)_x-so
And a more preferred R unit is C₂-C₁₂Alkylene, C₃-C₁₂Hydroxyal
Kiren, C₄-C₁₂Dihydroxyalkylene,-(R¹O)_xR¹-,-(R¹ O)_xR⁵(OR¹)_x-,-(CH₂CH (OH) CH₂O)_z(R¹O)_y R¹(OCH₂CH (OH) CH₂)_w-And mixtures thereof,
The preferred R unit is C₂-C₁₂Alkylene, C₃Hydroxyalkylene and its
Mixtures of these, most preferred are C₂-C₁₂Alkylene. Of the present invention
Most preferred backbones contain at least 50% of R units which are ethylene.

The R ¹ unit is a C ₂ -C ₆ alkylene and mixtures thereof, preferably ethylene. R ² is _{^{hydrogen, - (R 1 O) x}} B, preferably hydrogen. R ³ is _C 1 -C _{18 alkyl,} C 7 -C _{12 arylalkylene,} C 7 -C ₁₂ alkyl substituted _aryl, C 6 -C ₁₂ aryl, and mixtures thereof, preferably _C 1 -C ₁₂ alkyl, _{C 7} - C ₁₂ arylalkylene, more preferably C ₁ -C ₁₂ alkyl, most preferably methyl. R ³ units serve as part of the following E unit. R ⁴ is _C 1 -C _{12 alkylene,} C 4 -C _{12 alkenylene,} C 8 -C _{12 arylalkylene,} C 6 -C ₁₀ arylene, preferably _C 1 -C ₁₀ alkylene, _{C 8} -
C ₁₂ arylalkylene, more preferably C ₂ -C ₈ alkylene, most preferably ethylene or butylene. R ⁵ is C ₁ -C ₁₂ alkylene, C ₃ -C ₁₂ hydroxyalkylene, C ₄ -C ₁₂ dihydroxyalkylene, C ₈ -C ₁₂ dialkylarylene, —C (O) —, —
C (O) NHR ⁶ NHC (O)-, -C (O) (R ⁴ ) _r C (O)-, -R ¹ (
OR ¹ )-, -CH ₂ CH (OH) CH ₂ O (R ¹ O) _y R ¹ OCH ₂ CH (O
_{^{H) CH 2 -, - C}} (O) (R 4) r C (O) -, - CH 2 CH (OH) CH 2 - and is, ^{R 5} is preferably ethylene, -C (O) -, - C (O) NHR ⁶ NH
^{C (O) -, - R} 1 (OR 1) -, - CH 2 CH (OH) CH 2 -, - CH 2 C
_{^{H (OH) CH 2 O (}} R 1 O) y R 1 OCH 2 CH (OH) CH 2 -, more preferably _{-CH 2 CH (OH) CH 2} - is. R ⁶ is C ₂ -C ₁₂ alkylene or C ₆ -C ₁₂ arylene.

Preferred “oxy” R units are R¹, R²And R⁵Units are further defined
You. Preferred "oxy" R units are preferred R¹, R²And R⁵Including unit
You. The preferred cotton soil release agent of the present invention is ethylene R¹When the unit is small
50%. Preferred R¹, R²And R⁵The units are “oxy” R units
Combined to form the preferred "oxy" R units as described below. i)-(CH₂CH₂O)_xR⁵(OCH₂CH₂)_x-More preferred R in ⁵ Is replaced by-(CH₂CH₂O)_xCH₂CHOHCH₂(OCH₂CH ₂ )_xIi)-(CH₂CH (OR²) CH₂O)_z-(R¹O)_yR¹O (CH₂C
H (OR²) CH₂)_w-Preferred R in¹And R²Is replaced by-(CH ₂ CH (OH) CH₂O)_z-(CH₂CH₂O)_yCH₂CH₂O (CH₂C
H (OH) CH₂)_w-Iii) -CH₂CH (OR²) CH₂-Preferred R in²Replaces -CH ₂ CH (OH) CH₂-Is formed.

E unit is hydrogen, C₁-C_{twenty two}Alkyl, C₃-C_{twenty two}Alkenyl, C₇-C_{twenty two}Ants
Alkyl, C₂-C_{twenty two}Hydroxyalkyl,-(CH₂)_pCO₂M,-
(CH₂)_qSO₃M, -CH (CH₂CO₂M) CO₂M,-(CH₂)_pP
O₃M,-(R¹O)_mB, -C (O) R³, Preferably hydrogen, C₂-C_{twenty two}Hid
Roxyalkylene, benzyl, C₁-C_{twenty two}Alkylene,-(R¹O)_mB, -C
(O) R³,-(CH₂)_pCO₂M,-(CH₂)_qSO₃M, -CH (CH ₂ CO₂M) CO₂M, more preferably C₁-C_{twenty two}Alkylene,-(R¹O)_x B, -C (O) R³,-(CH₂)_pCO₂M,-(CH₂)_qSO₃M, -C
H (CH₂CO₂M) CO₂M, most preferably C₁-C_{twenty two}Alkylene,-(R ¹ O)_xB and -C (O) R³Selected from the group consisting of: Modification or substitution
When not performed with nitrogen, a hydrogen atom remains as a part representing E.

When a V, W or Z unit is oxidized, ie when the nitrogen is an N-oxide, the E unit is not a hydrogen atom. For example, the backbone or branch does not contain units of the following structure:

Embedded image In addition, when a V, W or Z unit is oxidized, ie when the nitrogen is an N-oxide, the E unit is not a carbonyl moiety directly attached to the nitrogen atom. According to the present invention, the E unit-C (O) R ³ moiety is not attached to the N-oxide modified nitrogen,
That is, there is no N-oxide amide having the following structure, nor a combination thereof:

Embedded image

B is hydrogen, C₁-C₆Alkyl,-(CH₂)_qSO₃M,-(CH₂)_pC
O₂M,-(CH₂)_q(CHSO₃M) CH₂SO₃M,-(CH₂)_q(C
HSO₂M) CH₂SO₃M,-(CH₂)_pPO₃M, -PO₃M, preferably
Is hydrogen,-(CH₂)_qSO₃M,-(CH₂)_q(CHSO₃M) CH₂SO ₃ M,-(CH₂)_q(CHSO₂M) CH₂SO₃M, more preferably hydrogen
Or-(CH₂)_qSO₃M.

M is hydrogen or a water-soluble cation in an amount sufficient to satisfy the charge balance. For example, the sodium cation - _{(CH 2)} p CO ₂ M and - _{(CH 2)} satisfies equal _{q SO 3 M, - (CH} 2) p CO 2 Na , and - _{(CH 2)} q S
It becomes O ₃ Na part. Two or more monovalent cations (sodium, potassium, etc.)
They can be combined to satisfy the required chemical charge balance. However,
Two or more anionic groups are charged balanced by divalent cations, or
The above monovalent cation may be required to satisfy the charge requirement of the polyanion group. For example, a-(CH ₂ ) _p PO ₃ M moiety substituted with a sodium atom is
Has the formula-(CH ₂ ) _p PO ₃ Na ₃ . A divalent cation such as calcium (Ca ²⁺ ) or magnesium (Mg ²⁺ ) may be used in place of or combined with other suitable monovalent water-soluble cations. Preferred cations are sodium and potassium, more preferably sodium.

X is a water-soluble anion such as chlorine (Cl ⁻ ), bromine (Br ⁻ ) and iodine (I ⁻ ), or X is sulfuric acid (SO ₄ ²⁻ ) and metsulfuric acid (CH ₃ SO ₃₎ ^- ) Is a negatively charged group.

The formula index has the following values: p has a value of 1 to 6; q has a value of 0 to 6; r has a value of 0 or 1; w has a value of 0 or 1 X is 1
Y has a value of 0-100; z has a value of 0 or 1; k is less than or equal to a value of n; m has a value of 4 to about 400; ~ About 20
Has a value of 0; m + n has a value of at least 5.

Preferred cotton soil release agents of the present invention comprise less than about 50% of the R groups, preferably about
Less than 20%, more preferably less than 5%, are "oxy" R units, most preferably
Has a polyamine backbone in which the R units do not contain any "oxy" R units. The most preferred cotton soil release agent containing no "oxy" R units is the R group
Less than 50% have a polyamine backbone containing 4 or more carbon atoms. For example,
Ethylene, 1,2-propylene and 1,3-propylene have no more than 3 carbon atoms
The preferred "hydrocarbyl" R units are included. That is, the main chain R unit is C ₂ -C₁₂Alkylene, preferably C₂-C₃Alkylene, most preferably ethylene
It's time for

The cotton soil release agent of the present invention has a modified homogeneous and non-uniform polyamine backbone, wherein not more than 100% of the —NH units are modified. For purposes of the present invention, the term "homogeneous polyamine backbone" is defined as a polyamine backbone having identical R units (ie, all ethylene). However, this definition does not exclude polyamines with other foreign units, including polymer backbones that are present due to the artificial nature of the chosen chemical synthesis method. For example, even though ethanolamine is used as an "initiator" in the synthesis of polyethyleneimine,
It is known to those skilled in the art that samples of polyethyleneimine containing one hydroxyethyl moiety due to the polymerization "initiator" are considered to have a uniform polyamine backbone for the purposes of the present invention. A polyamine main chain having all ethylene R units without a branched Y unit is a uniform main chain. A polyamine backbone with all ethylene R units is a uniform backbone, regardless of the degree of branching or the number of cyclic branches present.

For the purposes of the present invention, the term “heterogeneous polymer backbone” relates to a polyamine backbone that is a complex of various R unit lengths and R unit types. For example, a heterogeneous backbone contains R units that are a mixture of ethylene and 1,2-propylene units. For purposes of the present invention, a mixture of "hydrocarbyl" and "oxy" R units is not required to provide a heterogeneous backbone. Appropriate manipulation of the "R unit chain length" can give a trader the ability to control the solubility and fabric durability of the cotton soil release agent of the present invention.

The preferred cotton soil release polymers of the present invention are oxidized to a homogeneous polyamine backbone, wholly or partially substituted with polyethyleneoxy moieties, all or partially quaternized amines, all or partially N-oxides. Containing nitrogen, and mixtures thereof. However, not all backbone amine nitrogens need to be similarly modified, the choice of modification being left to the specific needs of the trader. The degree of ethoxylation is also determined by the specific requirements of the trader.

Preferred polyamines constituting the main chain of the compound of the present invention are usually polyalkyleneamines (PAA), polyalkylenimines (PAI), preferably polyethyleneamine (PEA), polyethyleneimine (PEI), or parent PAA, PAI
, PEA or PEI linked by moieties with longer R units than PEA or PEI. A common polyalkyleneamine (PAA) is tetrabutylenepentamine. PEA is obtained by the reaction of ammonia and ethylene dichloride followed by fractional distillation. Typical PEAs obtained are triethylenetetramine (TETA) and tetraethylenepentamine (TEPA). Mixtures derived together with pentamine, i.e. hexamine, heptamine, octamine and possibly nonamine, are difficult to separate by distillation, cyclic amines,
In particular, they may contain other substances such as piperazines. Cyclic amines having side chains where a nitrogen atom is present may also be present. The method for producing PEA is described.
Dickinson US Pat. No. 2,792,372 issued May 14, 957.
See issue specification.

A preferred amine polymer backbone consists of R units, which are also C ₂ alkylene (ethylene) units, also known as polyethylene imines (PEI). Preferred PEI
Has at least moderate branching, ie, the ratio of m to n is less than 4: 1,
PEI having an m to n ratio of about 2: 1 is most preferred. Preferred backbones before modification have the general formula:

Embedded image In the above formula, m and n are as defined above. The preferred PEI before modification is about 200
It has a molecular weight of Dalton or more.

The relative proportions of primary, secondary and tertiary amine units in the polyamine backbone vary depending on the process, especially in the case of PEI. Each hydrogen atom bonded to each nitrogen atom of the polyamine backbone represents a site available for subsequent substitution, quaternization or oxidation.

These polyamines can be produced, for example, by polymerizing ethyleneimine in the presence of a catalyst such as carbon dioxide, sodium bisulfite, sulfuric acid, hydrogen peroxide, hydrochloric acid, acetic acid and the like. Specific methods for producing these polyamine backbones include:
U.S. Pat. No. 2,182,306 to Ulrich et al., Issued on Dec. 5, 939; U.S. Pat. No. 3,033,746 to Mayle et al., Issued on May 8, 1962.
No. 2,208, issued Jul. 16, 1940 to Esselmann et al.
No. 2,095; Crowther US Pat. No. 2,8, issued Sep. 17, 1957.
No. 6,839; and US Pat. No. 2,553,696 issued May 21, 1951 to Wilson, all of which are incorporated herein by reference.

Examples of modified cotton soil release polymers of the present invention that include PEI are shown in Formulas IV
Formula I shows that all substitutable nitrogens are polyoxyalkyleneoxy units-(CH ₂ CH₂O)₂₀Preferred core containing a PEI backbone, modified by replacement of hydrogen by H
FIG. 4 shows a tonto soil release polymer having the following formula:

Embedded image Formula II shows that all substitutable nitrogens are polyoxyalkyleneoxy units-(CH ₂ CH₂O)₇Cotton soil containing PEI backbone modified by replacement of hydrogen by H
And shows a release polymer having the formula:

Embedded image This is an example of a cotton soil release polymer that is fully modified with one type of part.

Formula III describes a cotton soil release polymer comprising a PEI backbone, wherein all substitutable primary amine nitrogens have been modified by replacement of hydrogen by a polyoxyalkyleneoxy unit — (CH ₂ CH ₂ O) ₇ H. As shown, the molecule is then modified by oxidation of all oxidizable primary and secondary nitrogens to N-oxides, and the cotton soil releaser has the formula:

Embedded image

Formula IV illustrates a cotton soil release polymer comprising a PEI backbone in which all backbone hydrogen atoms have been replaced and some backbone amine units have been quaternized. The substituent is a polyoxyalkyleneoxy unit — (CH ₂ CH ₂ O) ₇ H or a methyl group. The modified PEI cotton soil release polymer has the following formula:

Embedded image

Formula V shows that the backbone nitrogen is substituted (ie, — (CH ₂ CH ₂ O) ₇ H or methyl),
PEI modified by quaternization, oxidation to N-oxide or a combination thereof
1 shows a cotton soil release polymer comprising a backbone. The resulting cotton soil release polymer has the formula:

Embedded image

In the above examples, not all nitrogens of a unit class are identically modified. In accordance with the present invention, one skilled in the art may ethoxylate some of the secondary amine nitrogens while oxidizing other secondary amine nitrogens to N-oxides. This is also true for primary amine nitrogens in that one can choose to modify all or part of the primary amine nitrogen with one or more substituents before oxidation or quaternization. Any possible combination of E groups can be replaced by primary and secondary amine nitrogens, with the limitations mentioned above.

The trader may take advantage of the possibility of modifying the polyamine backbone of the present invention to oxidize the backbone only in minimal amounts. For example, bleaching "tempering"
) May be performed before or after prescription. For the purposes of the present invention, the term "bleach tempering" is defined as treating the modified polyamine with sufficient bleach to oxidize the backbone for the conditions of the formulation. To illustrate, the polyamine backbone does not necessarily require bleach-stable quaternization or complete modification by N-oxidation. If a sample of the modified polyamine backbone is in a suitable bleaching system (eg,
(Nonanoyloxybenzenesulfonate / perborate), any main chain nitrogen that can be oxidized under these conditions is oxidized. However, due to the very structural nature of the backbone, some or all of the prebleached nitrogen may remain unchanged. If this tempering occurs, one may be confident that mixing the modified polyamine with the bleaching system will result in the polyamine consuming little bleach. Bleach prescribers will recognize that bleach tempering has its limitations and that weak tempering bleach should not be used in place of prescription bleach. In another embodiment, the merchant may attempt to add excess bleach to the laundry detergent composition during formulation so that proper in-situ bleach "tempering" can occur during storage and handling of the formulation.

A preferred embodiment of the present invention includes the use of a polyhydroxy fatty acid amide surfactant in combination with the modified polyamines described herein. This combination of a nonionic surfactant and a modified polyamine is particularly useful at low pH formulations, ie, at a pH of less than about 10. The polyhydroxy fatty acid amides suitable for use in the low pH aspects of the present invention may be combined with other suitable detersive surfactants such as anionic, amphoteric, zwitterionic surfactants and mixtures thereof.

Preferred for the purposes of the present invention are polyethyleneimine 1800E7 and its amine oxide derivatives, polyethyleneimine 1200E7 and its oxidized and / or quaternized derivatives, as described in Examples 1 to 4 of WO 97/42288, Cotton polyethylene imine soil release polymer selected from polyethylene imine 600E20 and / or mixtures thereof.

Detergent Ingredients The laundry detergent compositions of the present invention must contain at least one additional detergent ingredient. The exact nature of these additional components, and their level of incorporation, will depend on the physical form of the composition and the nature of the cleaning operation in which it is used. The laundry detergent composition according to the invention is preferably a builder, especially a zeolite, sodium tripolyphosphate and / or laminated silicate, a surfactant, preferably a nonionic surfactant such as an alkyl ethoxylate or an alkyl methyl glucamide, conventional And other detergent ingredients selected from the typical soil release polymers and / or mixtures thereof.

The laundry detergent compositions according to the present invention include liquids, pastes, gels, bar soaps, tablets,
There are sprays, foams, powders or granules. Granular compositions may be in "compact" form, and liquid compositions may be in "concentrated" form.

The compositions of the present invention include, for example, hand and machine laundry detergent compositions, such as laundry additive compositions, and compositions suitable for dipping and / or pre-treating soiled fabrics, rinse-added fabric softener compositions. Prescribed as a product.

When formulated as a composition suitable for use in a washing machine method, the compositions of the present invention preferably comprise both a surfactant and a builder compound, and preferably an organic polymeric compound, a bleach, It further contains one or more detergent components selected from enzymes, foam inhibitors, dispersants, lime soap dispersants, soil suspending and redeposition inhibitors, and corrosion inhibitors. Laundry compositions can also contain softening agents as additional detergent components. Such a composition containing mannanase and a cotton soil release polymer, when formulated as a laundry detergent composition, can provide fabric cleaning, stain removal, whiteness maintenance and color appearance. The compositions of the present invention can also be used in solid or liquid form as detergent-added products. Such additive products are to enhance or enhance the performance of conventional detergent compositions and may be added at any stage of the cleaning process.

If necessary, the density of the laundry detergent composition is 4% for the composition measured at 20 ° C.
It is 100 to 1200 g / L, preferably 500 to 950 g / L. The "compact" form of the composition is best reflected in terms of density and composition in terms of the amount of inorganic filler salt; inorganic filler salts are conventional components of detergent compositions in powder form; conventional detergent compositions In such products, the filler salt is present in a substantial amount, typically 17-35% by weight of the total composition. In a compact composition, the filler salt does not exceed 15% by weight of the total composition;
Preferably it is present in an amount not exceeding 10%, most preferably not exceeding 5% of the composition. The inorganic filler salt as meant in the present composition is selected from the alkali and alkaline earth metal salts of sulfates and chlorides. A preferred filler salt is sodium sulfate.

The liquid detergent composition according to the invention may be in “concentrated form”, in which case the liquid detergent composition according to the invention contains a small amount of water compared to conventional liquid detergents. Typically, the water content of the concentrated liquid detergent is preferably less than 40% by weight of the detergent composition, more preferably less than 30%, and most preferably less than 20%. Detergent compounds suitable for use in the present invention are selected from the group consisting of:

[0128]Surfactant system Preferably, the laundry detergent composition according to the present invention is characterized in that the surfactant is nonionic and
// anionic and / or cationic and / or amphoteric and / or
Further adds a surfactant system, which can be selected from bipolar and / or semi-polar surfactants.
Can be included. In particular, the laundry detergent composition of the present invention comprises a mannanase enzyme and
In addition to the cotton soil release polymer, preferably C₈-C₂₀Chain length, preferably
C₁₂-C₁₆, And alkyl ethoxy with a degree of ethoxylation of 2 to 9, preferably 3 to 7.
A xylated nonionic surfactant, or C₈-C₂₀, Preferably C₁₂-C ₁₈ An alkylmethylglucamide surfactant having an alkyl chain length of This
Such compositions have good cleaning performance, especially in cosmetics and food stains, and
It was surprisingly found that a good soil release effect was exhibited. Other surfactants are typically present at a level of 0.1-60% by weight. Further
Preferred loading levels are 1-35% by weight of the laundry detergent composition according to the invention, most preferred.
Preferably, it is 1 to 30% by weight. The surfactant is preferably treated to be compatible with the enzyme components present in the composition.
Be sent In liquid or gel compositions, the surfactants are most preferably
Promote the stability of, or at least degrade, the enzyme in the composition of
It is prescribed as follows.

Polyethylene, polypropylene and polybutylene oxide condensates of alkylphenols are suitable for use as the nonionic surfactant of the surfactant system of the present invention, with polyethylene oxide condensates being preferred. These compounds include the condensation products of alkyl phenols with alkyl phenols having an alkyl group of from about 6 to about 14, preferably from about 8 to about 14, carbon atoms in a linear or branched configuration. In a preferred embodiment, the ethylene oxide is present in an amount corresponding to about 2 to about 25 moles, more preferably about 3 to about 15 moles of ethylene oxide per mole of alkylphenol. Commercially available nonionic surfactants of this type include GAF Cor
Igepal ^™ CO-630 from poration, all Rohm & Haas Compan
Triton ^™ X-45, X-114, X-100 and X-1 sold by y
02. These surfactants are commonly referred to as alkylphenol alkoxylates (eg, alkylphenol ethoxylates).

[0130] Primary and secondary fatty alcohols are combined with about 1 to about 25 moles of ethylene oxide.
The condensation product is used as a nonionic surfactant in the nonionic surfactant system of the present invention.
Suitable for The alkyl chain of the aliphatic alcohol is linear or branched, primary or
It is secondary and usually has about 8 to about 22 carbon atoms. About 8 to about 20 carbon atoms
More preferably an alcohol having an alkyl group of about 10 to about 18 carbon atoms;
Condensation products with about 2 to about 10 moles of ethylene oxide per mole of alcohol are preferred.
Good. About 2 to about 7 moles of ethylene oxide per mole of alcohol, most preferably
Alternatively, 2 to 5 moles of ethylene oxide are present in the above condensation product. This Thailand
Examples of commercially available nonionic surfactants include Union Carbide Corporation
Sold by Tergitol^TM15-S-9 (C₁₁-C_FifteenStraight chain alcohol and ethylene oxide
Condensation product with 9 mol of oxide), Tergitol^TM24-L-6 NMW (C₁₂-C₁₄First-class alcohol
A narrow molecular weight distribution condensation product of ethylene glycol and 6 moles of ethylene oxide); Shell Chemic
Neodol sold by al Company^TM45-9 (C₁₄-C_FifteenStraight-chain alcohols and ethi
Condensation product with 9 mol of lenoxide), Neodol^TM23-3 (C₁₂-C₁₃Straight-chain alcohol
Product of ethylene oxide and 3.0 moles of ethylene oxide), Neodol^TM45-7 (C₁₄-C_FifteenStraight chain
Condensation product of alcohol and 7 mol of ethylene oxide), Neodol^TM45-5 (C₁₄-C _Fifteen Condensation product of linear alcohol and 5 mol of ethylene oxide); The Procter & Ga
Kyro sold by mble Company^TMEOB (C₁₃-C_FifteenAlcohol and Echile
Condensation product with 9 moles of peroxide); Genapol LA O3O sold by Hoechst
Or O50 (C₁₂-C₁₄Condensation of alcohol with 3 or 5 moles of ethylene oxide
Product). The preferred range of HLB in these products is 8-11, the most preferred.
Preferably it is 8-10.

The nonionic surfactants of the surfactant system of the present invention include hydrophobic groups having about 6 to about 30 carbon atoms, preferably about 10 to about 16 carbon atoms, and about 1.3 to about 10 carbon atoms. ,
Llenado published January 21, 1986, having a polysaccharide having preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7 saccharide units, such as the hydrophilic group of a polyglycoside. Also useful are the alkyl polysaccharides disclosed in US Pat. No. 4,565,647. Reducing sugars having 5 or 6 carbon atoms can also be used, for example, glucose, galactose and galactosyl moieties can be used in place of the glucosyl moiety (optionally a hydrophobic group is attached to the 2, 3, 4 position, etc. to form a glucoside or Give glucose or galactose instead of galactoside). For example, an intersugar linkage may be present between one position of the additional saccharide unit and positions 2, 3, 4, and / or 6 of the preceding saccharide unit.

Preferred alkyl polyglycosides have the formula: R ² O (C _n H _2n O) _t (glycosyl) _{x where} R ² is alkyl, alkylphenyl, hydroxyalkyl, hydroxyalkylphenyl and (Alkyl groups have about 10 to about 18, preferably about 12 to about 14 carbon atoms); n is 2 or 3, preferably 2; t is 0 to about 10, preferably 0; x is about 1
. 3 to about 10, preferably about 1.3 to about 3, most preferably about 1.3 to about 2.7.
It is. Glycosyl is preferably derived from glucose. To make these compounds, an alcohol or alkyl polyethoxy alcohol is first formed and then reacted with glucose or a source of glucose to form glucoside (1).
Bond). Additional glycosyl units may also be linked between their 1-position and the preceding glycosyl unit at positions 2, 3, 4, and / or 6, preferably predominantly at position 2.

The condensation products of ethylene oxide with a hydrophobic base formed by the condensation of propylene oxide with propylene glycol are also suitable for use as the additional nonionic surfactant system of the present invention. The hydrophobic portion of these compounds is preferably about 1500
It has a molecular weight of ~ 1800 and is water-insoluble. The addition of a polyoxyethylene moiety to this hydrophobic moiety tends to increase the overall water solubility of the molecule, and the liquidity of the product is such that the polyoxyethylene content is up to about 50% of the total weight of the condensation product. Again, this corresponds to condensation with up to about 40 moles of ethylene oxide. Examples of compounds of this type include certain commercially available Plurafac ^™ LF sold by BASF
There are 404 and Pluronic ^™ surfactants.

As the nonionic surfactant of the nonionic surfactant system of the present invention, a product obtained from the reaction of propylene oxide with ethylenediamine and a condensation product of ethylene oxide are also suitable for use. The hydrophobic portion of these products consists of the reaction product of ethylenediamine and excess propylene oxide, usually from about 2500 to about 300
It has a molecular weight of 0. The hydrophobic moiety is condensed with ethylene oxide to an extent that the condensation product contains about 40 to about 80% by weight polyoxyethylene and has a molecular weight of about 5000 to about 11,000. Examples of nonionic surfactants of this type include certain commercial Tetronic ^™ compounds sold by BASF.

The nonionic surfactants of the surfactant system of the present invention include polyethylene oxide condensates of alkylphenols, primary and secondary aliphatic alcohols and about 1 to about 25.
Condensation products with moles of ethylene oxide, alkyl polysaccharides, and mixtures thereof are preferred for use. _C 8 -C ₁₄ alkyl phenol ethoxylates having from 3 to 15 ethoxy groups, _C 8 -C ₁₈ alcohol ethoxylates having from 2 to 10 ethoxy groups (preferably C ₁₀ average), and mixtures thereof are most preferred.

Highly preferred nonionic surfactants are polyhydroxy fatty acid amide surfactants of the formula:

Embedded image Or the formula ^{R 1} is H, or ^{R 1} is C _1-4 hydrocarbyl, 2-hydroxyethyl, 2-hydroxypropyl or a mixture thereof, ^{R 2} is C _5-31 hydrocarbyl, Z is A polyhydroxyhydrocarbyl having a linear hydrocarbyl chain and at least three hydroxyls directly attached to the chain, or an alkoxylated derivative thereof. Preferably, R ¹ is methyl, R ² is a linear C _11-15 alkyl or C _16-18 alkyl or alkenyl chain, such as coconut alkyl, or a mixture thereof, and Z is glucose, It is derived from reducing sugars such as fructose, maltose and lactose.

Suitable anionic surfactants used are described in “The Journal of the American O.
il Chemists Society ", 52 (1975 ), C 8 -C 20 carboxylic acids which are sulfonated with gaseous SO ₃ according Pp.323-329 (i.e., fatty acids), including straight-chain esters of, linear alkylbenzene sulfonates, alkyl It is an ester sulfonate surfactant.
Suitable starting materials include natural fatty substances such as those derived from tallow, palm oil and the like.

Alkyl ester sulfonate surfactants particularly preferred for laundry applications include:
There are alkyl ester sulfonate surfactants of the following structural formula:

Embedded image Wherein R ³ is C ₈ -C ₂₀ hydrocarbyl, preferably alkyl, or a combination thereof, R ⁴ is C ₁ -C ₆ hydrocarbyl, preferably alkyl, or a combination thereof, and M is an alkyl ester sulfonate. Is a cation that forms a water-soluble salt with the cation. Suitable salt-forming cations include metals such as sodium, potassium and lithium, substituted or unsubstituted ammonium cations, for example, monoethanolamine, diethanolamine and triethanolamine. Preferably, R ³ is C ₁₀ -C ₁₆ alkyl and R ⁴ is methyl, ethyl or isopropyl. Methyl ester sulfonates wherein R ³ is C ₁₀ -C ₁₆ alkyl are particularly preferred.

Other suitable anionic surfactants include alkyl sulfate surfactants, which are water-soluble salts or acids of the formula ROSO ₃ M, wherein R is preferably C ₁₀ -C ₂₄ hydrocarbyl, preferably alkyl or hydroxyalkyl having a C ₁₀ -C ₂₀ alkyl moiety, more preferably C ₁₂ -C ₁₈ alkyl or hydroxyalkyl, M is H or a cation, e.g., an alkali metal cation (e.g. sodium, potassium, lithium), ammonium or Substituted ammonium (eg,
Quaternary ammonium cations such as methyl-, dimethyl- and trimethyl-ammonium cations, and tetramethylammonium and dimethylpiperidinium cations, and quaternary ammonium cations derived from alkylamines such as ethylamine, diethylamine, triethylamine, and And mixtures thereof). Typically, C ₁₂ -C ₁₆ alkyl chains are preferred at low wash temperatures (eg, below about 50 ° C.) and C ₁₆ -C ₁₈ alkyl chains are preferred at high wash temperatures (eg, above about 50 ° C.).

Other anionic surfactants useful for cleaning purposes are also included in the detergent compositions of the present invention.
Can be done. These include soap salts (eg, sodium, potassium,
Ammonium and substituted ammonium salts such as mono, di and triethanol
Amine salts), C₈-C_{twenty two}Primary or secondary alkane sulfonate, C₈-C _{twenty four} Olefin sulphonates, for example British Patent Specification 1,082,179
Sulfonation of pyrolysis products of alkaline earth metal citrate as described in
A sulfonated polycarboxylic acid produced by₈-C_{twenty four}Alkyl polyglycol
L-ether sulfate (containing up to 10 moles of ethylene oxide); alkyl
Glycerol sulfonate, fatty acylglycerol sulfonate, fatty oley
Luglycerol sulfate, alkyl phenol ethylene oxide ether
Sulfate, paraffin sulfonate, alkyl phosphate, acyl isethio
Isethionates such as catenates, N-acyl taurates, alkyl sacsimine
And sulfosuccinates, monoesters of sulfosuccinates (especially saturated
And unsaturated C₁₂-C₁₈Monoesters) and diesters of sulfosuccinates
(Especially saturated and unsaturated C₆-C₁₂Diester), acyl sarcosinate, al
Sulfates of alkyl polysaccharides, such as sulfates of killed polyglucosides (noni
On-non-sulfate compounds are described below), branched primary alkylsulfates
Fate, and the formula RO (CH₂CH₂O)_k-CH₂COO⁻M⁺(R is C₈ -C_{twenty two}Alkyl, k is an integer from 1 to 10, and M is a soluble salt-forming cation
Are alkylpolyethoxycarboxylates. In tall oil
Rosin, hydrogenated rosin, resin acids and rosins present or derived therefrom
Resin acids and hydrogenated resin acids, such as hydrogenated resin acids, are also suitable.

Another example is “Surface Active Agents and Detergents” (Vol. I and II, Schwart
z, Perry and Berch). Various such surfactants include 197
Laughlin et al., U.S. Pat. No. 3,929,678, issued Dec. 30, 5th, is also generally disclosed in column 23, line 58 to column 29, line 23 (for reference). Incorporated herein).

When included in the present compositions, the laundry detergent compositions of the present invention typically comprise from about 1 to about 40% by weight, preferably from about 3 to about 20% of such anionic surfactant. Contains.

Highly preferred anionic surfactants include alkylalkoxylated sulfate surfactants that are water-soluble salts or acids of the formula RO (A) _m SO ₃ M, where R is an unsubstituted C _10-. C ₂₄ alkyl or C ₁₀ -C ₂₄ hydroxyalkyl group having an alkyl moiety, preferably a C ₁₂ -C ₂₀ alkyl or hydroxyalkyl, more preferably C ₁₂ -C ₁₈ alkyl or hydroxyalkyl, a is an ethoxy or propoxy unit And m is greater than zero, typically from about 0.5 to about 6, more preferably from about 0.5 to about 3, and M is H or a cation, such as a metal cation (eg, sodium, potassium, lithium , Calcium, magnesium, etc.), ammonium or substituted ammonium cations. Alkyl ethoxylated sulfates and alkyl propoxylated sulfates are contemplated by the present invention. Specific examples of substituted ammonium cations are derived from methyl, dimethyl, trimethyl-ammonium cations, and quaternary ammonium cations such as tetramethylammonium and dimethylpiperidinium cations, and alkylamines such as ethylamine, diethylamine, triethylamine. And mixtures thereof. Exemplary surfactants include C ₁₂ -C ₁₈ alkyl polyethoxylate (1.0) sulfate (C ₁₂ -C ₁₈ E (1.0) M), C _12-
C ₁₈ alkyl polyethoxylate (2.25) sulfate (C ₁₂ -C ₁₈ E (2
. 25) M), C ₁₂ -C ₁₈ alkyl polyethoxylate (3.0) sulfate (C ₁₂ -C ₁₈ E (3.0) M) and C ₁₂ -C ₁₈ alkyl polyethoxylate (
4.0) a sulfate _{(C 12 -C 18 E (4.0} ) M), M is selected for convenience from sodium and potassium.

[0144] Cationic detersive surfactants suitable for use in the laundry detergent compositions of the present invention include one
It has a long-chain hydrocarbyl group. Such cationic surfactants
Examples include ammonium surfactants such as alkyltrimethylammonium halo
There are genoides, and surfactants having the formula: [R²(OR³)_y] [R⁴(OR³)_y]₂R⁵N⁺X⁻ R in the above formula²Is an alkyl having about 8 to about 18 carbon atoms in the alkyl chain or
An alkylbenzyl group; each R³Is -CH₂CH₂-, -CH₂CH (CH₃ )-, -CH₂CH (CH₂OH)-, -CH₂CH₂CH₂-And their
Selected from the group consisting of mixtures; each R⁴Is C₁-C₄Alkyl, C₁-C₄Hi
Droxyalkyl, two R⁴Benzyl ring structure formed by linking groups, -CH ₂ CHOH-CHOHCOR⁶CHOHCH₂OH (R⁶Is about 1000 or less
Hexose or hexose polymer having a molecular weight), and y is 0.
R is selected from the group consisting of hydrogen; R⁵Is R⁴Is the same as R² + R⁵Is an alkyl chain having a total number of carbon atoms of about 18 or less;
0 and the sum of y values is from 0 to about 15; X is any suitable anion
It is.

A quaternary ammonium surfactant suitable for the present invention has the following formula (I):

Embedded image Wherein R ₁ is short chain length alkyl (C ₆ -C ₁₀ ) or alkylamidoalkyl of formula (II):

Embedded image Wherein y is 2-4, preferably 3 .; wherein R ₂ is H or C ₁ -C ₃ alkyl; x is 0-4, preferably 0-2, most preferably 0. Wherein R ₃ , R ₄ and R ₅ are the same or different and are a short-chain alkyl (C ₁ -C ₃ ) or an alkoxylated alkyl of the following formula III:

Embedded image (R ⁶ is C ₁ -C ₄ and z is 1 or 2) wherein X ⁻ is a counter ion, preferably a halide such as chloride or methyl sulfate.

Preferred quaternary ammonium surfactants are those of the formula wherein R ₁ is C ₈ , C ₁₀ or a mixture thereof, x = 0, R ₃ , R ₄ ＣＨCH ₃ and R ₅ ＣＨCH ₂ CH ₂ OH. I
As defined in

Highly preferred cationic surfactants are useful in the present compositions having the formula:
Is a water-soluble quaternary ammonium compound: R₁R₂R₃R₄N⁺X⁻ (I) R in the above formula₁Is C₈-C₁₆Alkyl, R₂, R₃And R₄Are each independent
Then C₁-C₄Alkyl, C₁-C₄Hydroxyalkyl, benzyl and-(
C₂H₄₀)_xH (x has a value of 2 to 5) and X is an anion. R₂ , R₃Or R₄At most one must be benzyl. R₁The preferred alkyl chain length for₁₂-C_FifteenIn particular, the alkyl group is
A mixture of chain lengths derived from coconut or palm kernel fat, or
Synthetically derived by refin build-up or oxo alcohol synthesis. R ₂ , R₃And R₄Preferred groups for are methyl and hydroxyethyl groups
, Anion X is selected from halide, methosulfate, acetate and phosphate ions.

Examples of quaternary ammonium compounds of the formula (i) suitable for use in the present invention are: coconut trimethylammonium chloride or bromide coconut methyldihydroxyethylammonium chloride or bromide decyltriethylammonium chloride decyldimethylhydroxyethylammonium chloride or bromide C _12-15 dimethyl hydroxyethyl ammonium chloride or bromide coconut dimethyl hydroxyethyl ammonium chloride or bromide myristyl trimethyl ammonium methyl sulphate lauryl dimethyl benzyl ammonium chloride or bromide lauryl dimethyl (ethenoxy) ₄ ammonium chloride or bromide choline esters (R ₁ is CH _{2 -CH 2 -O-C (=} O -C a _{12-14 alkyl, R 2, R 3, R} 4 is methyl, the compound of formula (i)) compounds of dialkyl imidazoline (Formula (i))

Other cationic surfactants useful in the present invention are described in US Pat. No. 4,228,044 to Cambre, issued Oct. 14, 1980, and EP 0 0
No. 00,224.

Typical cationic fabric softening components include water-insoluble quaternary ammonium fabric softening activators or their corresponding amine precursors, with dilong chain alkyl ammonium chloride or methyl sulfate being the most commonly used. I have. Among these, preferred cationic softeners include: 1) ditallow dimethyl ammonium chloride (DTDMAC) 2) dihydrogenated tallow dimethyl ammonium chloride 3) dihydrogenated tallow dimethyl ammonium methyl sulfate 4) distearyl dimethyl ammonium Chloride 5) Dioleyldimethylammonium chloride 6) Dipalmitylhydroxyethylmethylammonium chloride 7) Stearylbenzyldimethylammonium chloride 8) Tallow trimethylammonium chloride 9) Hydrogenated tallow trimethylammonium chloride 10) _C12-14 alkyl hydroxyethyldimethylammonium chloride 11) C _12-18 alkyl dihydroxyethyl methyl ammonium chloride 12) di (stearoyl oxyethyl Dimethylammonium chloride (DSOEDMAC) 13) di (tallow oxyethyl) dimethyl ammonium chloride 14) ditallow imidazolinium methylsulfate 15) 1- (2-tallow-ylamide ethyl) -2-tallow-yl imidazolinium methylsulfate

[0151] Biodegradable quaternary ammonium compounds have been provided as an alternative to the traditionally used dilong chain alkyl ammonium chloride and methyl sulfate. Such a quaternary ammonium compound has a long-chain alkyl (alkenyl) group in which a functional group such as a carboxy group is interposed. The above substances and fabric softening compositions containing them are described in EP-A-0,040,562 and EP-A-0,
It has been disclosed in numerous documents such as 239,910.

The quaternary ammonium compound and its amine precursor are represented by the following formula (I) or (II)
)have:

Embedded image The formula Q is -O-C (O) -, - C (O) -O -, - O-C (O) -O-, -NR 4 -C (O) -, - C (O) - NR ⁴ - is selected from; ^{R 1} is _{(CH 2)} is n ^{-Q-T 2} or ^{T 3;} is ^{R 2} is _{(CH 2)} m ^{-Q-T 4} or ^{T 5} or ^{R 3,;} R ³ is C ₁ -C ₄ alkyl, C ₁ -C ₄ hydroxyalkyl or H; R ⁴ is H, C ₁ -C ₄ alkyl or C ₁ -C ₄ hydroxyalkyl; T ¹ , T ² , T ³ , T ⁴ , T ⁵ are independently C ₁₁ -C ₂₂ alkyl or alkenyl; n and m are integers from 1 to 4; and X ⁻ is a softener compatible anion. Non-limiting examples of softener compatible anions include chloride or methyl sulfate.

The alkyl or alkenyl chains T ¹ , T ² , T ³ , T ⁴ , T ⁵ are at least 11
And preferably at least 16 carbon atoms.
The chain may be straight or branched. Tallow is a convenient and inexpensive source of long-chain alkyl and alkenyl materials. Compounds in which T ¹ , T ² , T ³ , T ⁴ , T ⁵ represent a mixture of long chain substances typical of tallow are particularly preferred.

Specific examples of quaternary ammonium compounds suitable for use in the present aqueous fabric softening composition include: 1) N, N-di (tallowyloxyethyl) -N, N-dimethylammonium chloride 2) N, N, N-dimethylammonium chloride N-di (tallowyloxyethyl) -N-methyl, N- (2-hydroxyethyl) ammonium methyl sulfate 3) N, N-di (2-tallowyloxy-2-oxoethyl) -N, N-dimethylammonium Chloride 4) N, N-di (2-tallowyloxyethylcarbonyloxyethyl) -N, N-dimethylammonium chloride 5) N- (2-tallowyloxy-2-ethyl) -N- (2-tallowyl) Oxy-2-oxoethyl) -N, N-dimethylammonium chloride 6) N, N, N-tri (tallowyloxyethyl) -N-methyl Ammonium chloride 7) N- (2-Tallowyloxy-2-oxoethyl) -N- (tallowyl-N, N-dimethylammonium chloride) 8) 1,2-Ditaloyloxy-3-trimethylammoniopropane chloride and There are mixtures of the above substances.

When included in the present compositions, the laundry detergent compositions of the present invention typically comprise from 0.2 to
It contains about 25% by weight, preferably about 1 to about 8%, of such a cationic surfactant.

The laundry detergent compositions of the present invention may also contain amphoteric, zwitterionic and semipolar surfactants, as well as nonionic and / or anionic surfactants other than those already described herein. .

[0157] Amphoteric surfactants are also suitable for use in the laundry detergent compositions of the present invention. These surfactants can be broadly described as aliphatic derivatives of secondary or tertiary amines, or aliphatic derivatives of heterocyclic secondary and tertiary amines, wherein the aliphatic group is linear or It may be a branched chain. One of the aliphatic substituents has at least about 8 carbon atoms, typically from about 8 to about 18 carbon atoms, and at least one has an anionic water-soluble group, such as carboxy, sulfonic acid, sulfuric acid. Group. For examples of amphoteric surfactants, see Laughlin et al., US Pat.
See JP 3,929,678, column 19, lines 18-35. When included in the present compositions, the laundry detergent compositions of the present invention typically comprise from 0.2 to
It contains about 15% by weight, preferably about 1 to about 10%, of such amphoteric surfactants.

[0158] Zwitterionic surfactants are also suitable for use in laundry detergent compositions. These surfactants can be broadly described as derivatives of secondary and tertiary amines, derivatives of heterocyclic secondary and tertiary amines, or derivatives of quaternary ammonium, quaternary phosphonium or tertiary sulfonium compounds. . For examples of zwitterionic surfactants, see
Laughlin et al., US Pat. No. 3,929,6, issued Dec. 30, 1975.
See column 19, line 38 to column 22, line 48 of the specification. When included in the present compositions, the laundry detergent compositions of the present invention typically comprise from 0.2 to
It contains about 15% by weight, preferably about 1 to about 10%, of such a zwitterionic surfactant.

The semi-polar nonionic surfactant comprises two alkyl moieties selected from the group consisting of one alkyl moiety having about 10 to about 18 carbon atoms, an alkyl group having about 1 to about 3 carbon atoms, and a hydroxyalkyl group. Water-soluble amine oxide; about 10 to about 1 carbon atoms
A water-soluble phosphine oxide having two alkyl moieties selected from the group consisting of one alkyl moiety of about 8 carbon atoms, an alkyl group of about 1 to about 3 carbon atoms, and a hydroxyalkyl group; one alkyl moiety of about 10 to about 18 carbon atoms. Particular categories of nonionic surfactants, including water-soluble sulfoxides having a moiety selected from the group consisting of alkyl and hydroxyalkyl moieties of about 1 to about 3 carbon atoms.

Semipolar nonionic detergent surfactants include amine oxide surfactants having the formula:

Embedded image Wherein R ³ is an alkyl, hydroxyalkyl, alkylphenyl group having about 8 to about 22 carbon atoms or a mixture thereof; R ⁴ is an alkylene, hydroxyalkylene group having about 2 to about 3 carbon atoms or Mixtures thereof;
x is 0 to about 3; each R ⁵ is an alkyl or hydroxyalkyl group having about 1 to about 3 carbon atoms, or a polyethylene oxide group having about 1 to about 3 ethylene oxide groups. The R ⁵ groups may be linked together, for example via an oxygen or nitrogen atom, to form a ring structure. Among these amine oxide surfactants are, in particular, C ₁₀ -C ₁₈ alkyldimethylamine oxide and C ₈ -C ₁₂ alkoxyethyldihydroxyethylamine oxide. When included in the present compositions, the cleaning compositions of the present invention typically have a pH of 0.5.
It contains from 2 to about 15% by weight, preferably from about 1 to about 10%, of such semipolar nonionic surfactants.

The laundry detergent composition of the present invention may comprise a co-interface selected from the group of primary or tertiary amines.
It may further comprise a cosurfactant. Primary amines suitable for use in the present invention include those of formula R₁NH₂Amine
Where R₁Is C₆-C₁₂, Preferably C₆-C_TenAlkyl chain, or R₄X (CH ₂ )_nAnd X is -O-, -C (O) NH- or -NH-, and R is₄Is C ₆ -C₁₂An alkyl chain, and n is 1 to 5, preferably 3. R₁Alkyl chain
May be linear or branched and may have an ethylene oxide of 12 or less, preferably less than 5.
A sid moiety may be interposed. Preferred amines according to the above formula are n-alkylamines. Suitable for use in the present invention
The amines were 1-hexylamine, 1-octylamine, 1-decylamine and
And laurylamine. Other preferred primary amines include C₈-C_Ten Oxypropylamine, octyloxypropylamine, 2-ethylhexylo
Xypropylamine, laurylamidopropylamine and amidopropylamido
There is a

Tertiary amines suitable for use in the present invention include tertiary amines having the formula R ₁ R ₂ R ₃ N, wherein R ₁ and R ₂ are a C ₁ -C ₈ alkyl chain or

Embedded image And R ₃ is a C ₆ -C ₁₂ , preferably a C ₆ -C ₁₀ alkyl chain, or R ₃ is R ₄ X (CH ₂ ) _n (X is —O—, —C (O) NH -Or -NH-), R ₄ is C ₄ -C ₁₂ and n is 1-5, preferably 2-3.
R ₅ is H or C ₁ -C ₂ alkyl, and x is 1-6. R ₃ and R ₄ may be linear or branched, and the R ₃ alkyl chain may have no more than 12, preferably no more than 5, ethylene oxide moieties.

Preferred tertiary amines are R₁Is C₆-C₁₂In the alkyl chain, R₂And R₃Is C ₁ -C₃Alkyl or

Embedded image (Wherein R ₅ is H or CH ₃ and x = 1 to 2), and is R ₁ R ₂ R ₃ N. Amidoamines of the following formula are also preferred:

Embedded image Wherein R ₁ is C ₆ -C ₁₂ alkyl, n is 2 to 4, preferably n is 3, and R ₂ and R ₃ are C ₁ -C ₄ .

Most preferred amines of the present invention include 1-octylamine, 1-hexylamine, 1-decylamine, 1-dodecylamine, C _8-10 oxypropylamine, N-
Coco-1,3-diaminopropane, coconut alkyldimethylamine, lauryldimethylamine, laurylbis (hydroxyethyl) amine, cocobis (hydroxyethyl) amine, 2 mol propoxylated laurylamine, 2 mol propoxylated octylamine, laurylamide dimethylamine, there is C _8-10 dimethylamine and C ₁₀ amidopropyl dimethylamine. The most preferred amines for use in the composition are 1-hexylamine, 1-octylamine, 1-decylamine, 1-dodecylamine. Particularly desirable is n
-Dodecyl dimethylamine, bishydroxyethyl coconut alkylamine, 7
Ethoxylated oleylamine, laurylamidopropylamine and cocoamidopropylamine.

Bleaching Agent The laundry detergent composition of the present invention comprises hydrogen peroxide, PB1, PB4, and a particle size of 400.
Bleaching agents such as ~ 800 microns of percarbonate may be further included.
These bleach components can include one or more oxygen bleaches and, depending on the bleach selected, one or more bleach activators. When present,
The oxygen bleaching compound is typically present at a level of about 1 to about 25%. The bleach component for use in the present invention can be any bleach useful in detergent compositions, including oxygen bleaches and others known in the art. Bleaches suitable for the present invention are activated or deactivated bleaches.

[0166] One category of oxygen bleaches that can be used includes polycarboxylic acid bleaches and salts thereof. Suitable examples of this class of agents include magnesium monoperoxyphthalate hexahydrate, magnesium salt of m-chloroperbenzoic acid, 4-nonylamino-4
-Oxoperoxybutyric acid and diperoxidedecanedioic acid. Such bleaching agents are disclosed in US Pat. No. 4,483,781, US Patent Application No. 740,446,
It is disclosed in European Patent Application 0,133,354 and US Patent 4,412,934. Highly preferred bleaches include US Pat. No. 4,634,5.
There is also 6-nonylamino-6-oxoperoxycaproic acid as described in US Pat.

Another category of bleaches that can be used is halogen bleaches. Examples of hypohalous acid bleaches include, for example, trichloroisocyanuric acid, sodium and potassium dichloroisocyanurates, N-chloro and N-bromoalkanesulfonamides. Such substances are usually added at 0.5 to 10% by weight, preferably 1 to 5% by weight of the final product.

Hydrogen peroxide releasing agents are tetraacetylethylenediamine (TAED), nonanoyloxybenzenesulfonate, which are perhydrolyzed to form peracid as an active bleaching species and exert an improved bleaching effect. (NOBS, US
4,412,934), 3,5-trimethylhexanoloxybenzenesulfonate (ISONOBS, described in EP120,591), pentaacetylglucose (PAG) or phenol sulfonate ester of N-nonanoyl-6-aminocaproic acid (NACA- OBS, described in WO 94/28106). Co-pending European Patent Application No. 91
Acylated citrate esters as disclosed in 870207.7, as well as Procter & Gamble co-pending patent application USSN 60 / 022,786 (
Asymmetrical acyclic imido bleach activators of the following formulas, such as those disclosed in U.S. Patent Application Serial No. Beta is:

Embedded image In the above formula, R ₁ is a C ₇ -C ₁₃ linear or branched saturated or unsaturated alkyl group, R ₂ is a C ₁ -C ₈ linear or branched saturated or unsaturated alkyl group, and R ₃ is C ₁ -C ₄ straight or branched chain saturated or unsaturated alkyl group.

Useful bleaching agents, including bleach activators and peroxygen bleaching compounds, and peroxy acids, for use in detergent compositions according to the present invention, are described in our co-pending application USSN 08 / 136,626. , PCT / US95 /
07823, WO95 / 27772, WO95 / 27773, WO95 / 277
74 and WO 95/27775.

[0170] Hydrogen peroxide may also be present at the beginning or during the washing and / or rinsing process by adding an enzyme system capable of generating hydrogen peroxide (ie, the enzyme and its substrate). Such an enzyme system is described in EP-A-
It is disclosed in patent application 91202655.6.

[0171] Metal-containing catalysts for use in the bleach compositions include cobalt-containing catalysts such as pentaaminecobalt (III) acetate, and manganese-containing catalysts such as EPA549271,
EPA 549272, EPA 458 397, US 5,246,621, EPA 4
58398, US 5,194,416 and US 5,114,611. A bleaching composition comprising a peroxy compound, a manganese-containing bleach catalyst and a chelating agent is described in patent application 94870206.3.

Bleaches other than oxygen bleaches are known in the art and may be used in the present invention. One type of non-oxygen bleach that is of particular interest is a light activated bleach such as a sulfonated zinc and / or aluminum phthalocyanine. These substances can adhere to the substrate during the cleaning process. Like hanging clothes in the sun and drying
Upon irradiation with light in the presence of oxygen, the sulfonated zinc phthalocyanine is activated, thereby bleaching the substrate. A preferred zinc phthalocyanine and light activated bleaching process is described in US Pat. No. 4,033,718. Typically, the detergent compositions contain from about 0.025 to about 1.25% by weight of the sulfonated zinc phthalocyanine.

Builder System Preferably, the laundry detergent composition of the present invention may further comprise a builder, more preferably a zeolite, sodium tripolyphosphate and / or laminated silicate. It has been surprisingly found that such compositions exhibit good cleaning performance and a good soil release effect, especially in cosmetics and food stains. Aluminosilicate materials, silicates, polycarboxylates, alkyl or alkenyl succinic acids, and fatty acids, materials such as ethylenediaminetetraacetic acid, diethylenetriaminepentamethyleneacetic acid, sequestering agents such as aminopolyphosphonates, especially ethylenediaminetetramethylenephosphonic acid and diethylenetriamine Any conventional builder system, including pentamethylene phosphonic acid, is suitable for use in the present invention. Phosphate builders may also be used in the present invention.

Suitable builders include inorganic ion exchange materials, usually inorganic hydrated aluminosilicate materials, and more specifically hydrated synthetic zeolites, such as hydrated zeolites A, X
, B, HS or MAP. Another suitable inorganic builder material is a laminated silicate, such as SKS-6 (
Hoechst). SKS-6 is a crystal laminated silicate made of sodium silicate (Na ₂ Si ₂ O ₅ ).

Suitable polycarboxylates having one carboxy group include lactic acid, glycolic acid and There are those ether derivatives. 2
Polycarboxylates having two carboxy groups include succinic acid, malonic acid, (
Water-soluble salts of ethylenedioxy) diacetate, maleic acid, diglycolic acid, tartaric acid, tartronic acid and fumaric acid, and German Patent Publication No. 2,446,686;
No. 2,446,687 and US Pat. No. 3,935,257, and sulfinyl carboxylate described in Belgian Patent 840,623. Polycarboxylates having three carboxy groups include, in particular, water-soluble citrates, aconitrates and citraconates, as well as carboxymethyloxysuccinates described in GB 1,379,241, Netherlands application 72050873. And oxypolycarboxy such as 2-oxa-1,1,3-propanetricarboxylate described in GB 1,387,447. There are rate substances.

Polycarboxylates having four carboxy groups include those described in GB 1,26
Oxydisuccinate, 1,1,2,2-ethanetetracarboxylate, 1,1,3,3-propanetetracarboxylate and 1,1,2,3-propane disclosed in 1,829 There are tetracarboxylates. Polycarboxylates having sulfo substituents include those described in GB 1,398,421,
398,422 and US Pat. No. 3,936,448, and the sulfonated pyrolytic citrates described in GB 1,082,179, and phosphones. Polycarboxylates having substituents are disclosed in GB 1,439,000.

Cycloaliphatic and heterocyclic polycarboxylates include cyclopentane-cis,
Cis, cis-tetracarboxylate, cyclopentadienidepentacarboxylate, 2,3,4,5-tetrahydrofuran-cis, cis, cis-tetracarboxylate, 2,5-tetrahydrofuran-cis-dicarboxylate, 2,
2,5,5-tetrahydrofuran-tetracarboxylate, 1,2,3,4
There are 5,6-hexane-hexacarboxylate and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol. Aromatic polycarboxylates include melitic acid, pyromellitic acid, and the phthalic acid derivatives disclosed in GB 1,425,343. Among the above preferred polycarboxylates are hydroxycarboxylates having up to 3 carboxy groups per molecule, more particularly citrates.

Preferred builder systems for use in the present compositions include water-insoluble aluminosilicate builders or laminated silicates (SKS-6), such as zeolite A, and a water-soluble carboxylate chelating agent, such as citric acid. There is a mixture. Other preferred builder systems include water-insoluble aluminosilicate builders such as zeolite A;
There are mixtures with water-soluble carboxylate chelators such as citric acid. Preferred builder systems for use in the liquid detergent compositions of the present invention are soaps and polycarboxylates.

Other builder substances that can form part of the builder system on use in the granular composition include inorganic substances such as carbonates, bicarbonates, alkali metal silicates, and organic phosphonates.
There are organic substances such as aminopolyalkylene phosphonates and aminopolycarboxylates. Other suitable water-soluble organic salts are homo- or copolymeric acids or salts thereof, wherein the polycarboxylic acids have at least two carboxyl groups separated from one another by no more than two carbon atoms. This type of polymer is GB-A-1,596
, 756. Examples of such salts are polyacrylates with a MW of 2000 to 5000 and copolymers thereof with maleic anhydride, such copolymers having a molecular weight of 20,000 to 70,000, in particular of about 40,000.

The cleaning builder salt is usually present in an amount of from 5 to 80%, preferably from 10 to 70%, most usually from 30 to 60% by weight of the composition.

Conventional Detergent Enzymes Laundry detergent compositions can further comprise, in addition to the mannanase enzyme, one or more enzymes that exert cleaning performance, fabric care and / or sanitary benefits.

The above-mentioned enzymes include cellulase, hemicellulase, peroxidase, protease, glucoamylase, amylase, xylanase, lipase, phospholipase, esterase, cutinase, pectinase, keratanase, reductase, oxidase, phenol oxidase, lipoxygenase, ligninase, pullulanase, tannase. , Pentosanase, malanases, β-glucanases, arabinosidases, hyaluronidases, chondroitinases, laccases or mixtures thereof. A preferred combination is a laundry detergent composition having a cocktail of common enzymes such as proteases, amylases, lipases, cutinases and / or cellulases combined with one or more plant cell wall degrading enzymes.

Suitable proteases are subtilisins (subtilisins BPN and BPN ') obtained from certain strains of B. subtilis and B. licheniformis. One suitable protease is obtained from the Bacillus strain and has a maximum activity in the pH range from 8 to 12,
Developed by Novo Industries A / S in Denmark and sold as ESPERASE ^R , hereinafter referred to as "Novo". Novo's GB
1, 243, 784. Other suitable proteases include Novo AL
CALASE ^R , DURAZYM ^R and SAVINASE ^R , and Gist-Brocades' MAXATASE ^R ,
MAXACAL ^R, there is PROPERASE ^R and Maxapem ^R (protein engineered Maxacal). Proteolytic enzymes include modified bacterial serine proteases such as 1987
European Patent Application No. 87 / 303761.8 filed on April 28, 2008
(Especially pages 17, 24 and 98), and on October 29, 1986, for what is hereinafter referred to as "Protease B" and for the modified bacterial serine protease which is hereinafter referred to as "Protease A". One is described in published Venegas European Patent Application 199,404. Lysine replaces arginine at position 27, tyrosine replaces valine at position 104, and serine replaces 12
A protease, hereinafter referred to as "protease C", which is a variant of the alkaline serine protease from Bacillus, which replaces asparagine at position 3 and alanine for threonine at position 274, is suitable. Protease C
EP9091 corresponding to WO91 / 06637 published on May 16, 1991
5958: 4. In particular, genetically modified variants of protease C are also included in the present invention.

A preferred protease, referred to as "Protease D", is a carbonyl hydrolase variant having an amino acid sequence that is not found in nature, and is described in WO95 / 10591.
And USSN 08/3, filed October 13, 1994, by C. Ghosh et al.
According to the numbering of Bacillus amyloliquefaciens subtilisin as described in the patent application entitled "Bleaching Compositions Containing Protease Enzymes" at 22,677, preferably +99, +101, +103, +104, +107, +123.
, +27, +105, +109, +126, +128, +135, +156, +
166, +195, +197, +204, +206, +210, +216, +2
+7 in combination with one or more amino acid residue positions corresponding to those selected from the group consisting of 17, +218, +222, +260, +265 and / or +274.
At the position corresponding to position 6, it is derived from a precursor carbonyl hydrolase by using different amino acids instead of a plurality of amino acid residues in the carbonyl hydrolase. The following residues: +33, +62, +67, +76, +100, +
101, +103, +104, +107, +128, +129, +130, +1
32, +135, +156, +158, +164, +166, +167, +17
WO95 / 10591, having an amino acid sequence derived from the substitution of a plurality of amino acid residues replaced on the precursor enzyme corresponding to position +210 with one or more of 0, +209, +215, +217, +218 and +222. Also suitable are carbonyl hydrolase variants of the disclosed proteases, wherein the numbered positions correspond to natural subtilisins from Bacillus amyloliquefaciens or to the corresponding amino acid residues of other carbonyl hydrolases or subtilisins, such as Bacillus lentus subtilisin (1997). Co-pending patent application USSN 60 / 048,550 filed on June 4, 2016).

[0185] Protease described in patent application EP251446 and WO91 / 06637, WO91 / 02792, protease BLAP ^R described, and WO
Those variants described in 95/23221 are also suitable for the present invention. Novo W
See also the high pH protease from Bacillus sp. NCIMB 40338 described in O93 / 18140A. Enzyme detergents containing proteases, one or more other enzymes and a reversible protease inhibitor are described in Novo WO 92 / 03529A. If desired, proteases with reduced adsorptivity and improved hydrolysis are available as described in Procter & Gamble, WO 95/07791. Recombinant trypsin-like proteases for detergents suitable for the present invention are described in Novo WO 94/25583. Other suitable proteases are Unilever
EP516200. The proteolytic enzyme is present in an amount of 0.0001 to 2%, preferably 0.00% by weight of the composition.
Pure enzyme levels of from 0.01 to 0.2%, more preferably from 0.005 to 0.1%, are incorporated into the laundry detergent compositions of the present invention.

Cellulases that can be used in the present invention include both bacterial and fungal cellulases. Preferably, they have an optimal pH of 5-12 and 50 CEVU (Cellulose Viscosity U
nit) / mg or more. Suitable cellulases are described in US Pat. No. 4,435,307 to Barbesgoard et al., J61078384 and WO96 / 0265.
3, where Humicola insolens, Trichoderma, Thielavia
And fungal cellulases produced from Sporotrichum, respectively.
EP 739982 describes a cellulase isolated from a novel Bacillus species. Suitable cellulases are GB-A-2,075,028, GB-A-2,095,
275, DE-OS-2,247,832 and WO 95/26398.

Examples of such cellulases include strains of Humicola insolens (Humicola grisea va
r. thermoidea), especially cellulase produced by Humicola strain DSM1800. Other suitable cellulases are those derived from Humicola insolens, DSM 1800, having a molecular weight of about 50 kDa, an isoelectric point of 5.5, and containing 415 amino acids, and exhibiting cellulase activity. A 43 kD endoglucanase, a preferred endoglucanase component is PCT Patent Application W
It has the amino acid sequence disclosed in O91 / 17243. September 2, 1994
Trichoderma as described in Genencor's WO 94/21801 published on 9th.
EGIII cellulases from longibrachiatum are also suitable cellulases. Particularly suitable cellulases are those having a color care effect. Examples of such cellulases are described in European Patent Application No. 912028, filed Nov. 6, 1991.
No. 79.2 (Novo). Carezyme and Cell
uzyme (Novo Nordisk A / S) is particularly useful. WO91 / 17244 and W
See also O91 / 21801. Other cellulases suitable for fabric care and / or cleaning properties are WO 96/34092, WO 96/17994 and WO 95
/ 24471. The above cellulases are usually incorporated into laundry detergent compositions at a pure enzyme level of 0.0001 to 2% by weight of the laundry detergent composition.

The peroxidase enzyme is a source of oxygen such as percarbonate, perborate,
Used in combination with phenolic substrates as persulfate, hydrogen peroxide, and the like, and as a bleach-enhancing molecule. They are used for "solution bleaching", i.e. to prevent dyes or pigments that have fallen off the substrate during the washing operation from migrating to other substrates in the washing liquor. Peroxidase enzymes are known in the art and include, for example, horseradish peroxidase, ligninase, haloperoxidases such as chloro and bromoperoxidase. Peroxidase-containing detergent compositions are described, for example, in PCT International Applications WO 89/099813, WO 89/0981.
3, and European Patent Application EP 912028 filed on November 6, 1991
EP 968700133.8, filed on Feb. 20, 1996 with 82.6.
Are disclosed. Laccase enzymes are also suitable.

[0189] Enhancers are usually included at a level of 0.1-5% by weight of the total composition. Preferred enhancers are the substituted phenothiazines and phenoxazines 10-phenothiazinepropionic acid (PPT), 10-ethylphenothiazine-4-carboxylic acid (EPC), 10-phenoxazinepropionic acid (POP) and 10-methylphenoxazine (WO94 / 12621), and substituted syringates
(C3-C5 substituted alkyl syringates) and phenols. Sodium percarbonate or perborate is the preferred source of hydrogen peroxide. The peroxidase is typically incorporated into laundry detergent compositions at a pure enzyme level of 0.0001 to 2% by weight of the laundry detergent composition.

Other preferred enzymes that may be included in the laundry detergent compositions of the present invention include lipases. Lipase enzymes suitable for detergents include Pseudomonas such as Pseudomonas stutzeri ATCC 19.154 disclosed in GB 1,372,034.
Some are produced by microorganisms of the genus s. Suitable lipases include the microorganism Pseudomonas fluorescent IAM10, which shows a positive immune cross-reactivity with lipase antibodies.
Some are produced by 57. This lipase is commercially available from Amano Pharmaceutical Co. Ltd. in Nagoya, Japan under the trade name Lipase P "Amano".
mano-P ". Other suitable commercially available lipases include Amano-CES, Chromobacter
viscosum, for example, Chromobacter viscosum var.
Lipase from lipolyticum NRRLB 3673; Chromobacter viscosum lipase from USBiochemical Corp. of USA and Disoiynth Co. of the Netherlands; Pseudomona
There is a lipase from s gladioli. Particularly suitable lipases are M1 Lipase ^R and L
a lipase such as ipomax ^R (Gist-Brocades) and Lipolase ^R and Lipolase Ultra ^R (Novo), it was found that they are very effective when used in conjunction with the compositions of the present invention. Novo Nordisk EP258068, WO92 / 05249
And WO95 / 22615, WO94 / 03578 from Unilever, WO95 / 3
Also suitable are the lipolytic enzymes described in 5381 and WO 96/00292.

Also suitable is a special type of lipase, a cutinase [EC 3.1.1.50], which is considered a lipase that does not require surface activity. The addition of cutinase to the detergent composition can be performed, for example, by adding W
OA-88 / 09367 (Genencor), WO90 / 09446 (Plant Geneti
c System), WO 94/14963 and WO 94/14964 (Unilever). Lipases and / or cutinases are commonly incorporated into laundry detergent compositions at a pure enzyme level of 0.0001 to 2% by weight of the laundry detergent composition.

Amylases (α and / or β) can be included for removal of carbohydrate-based soils. WO 94/02597 of Novo Nordisk A / S published February 3, 1994 describes a detergent composition containing a mutant amylase. WO95 / of Novo Nordisk A / S released on April 20, 1995
See also 10603. Other amylases known for detergent compositions include both α- and β-amylases. α-amylases are known in the art and are described in US Pat. No. 5,003,257, EP 252,666, WO 91/00353, FR 2,6.
76, 456, EP 285, 123, EP 525, 610, EP 368, 341
And British Patent Specification No. 1,296,839 (Novo). Other suitable amylases are described in WO 94/1 published August 18, 1994.
8314, Genencor's WO 96/0529 published Feb. 22, 1996.
Amylase described in No. 5 and WO95 published in April 1995
Amylase variants with additional modifications to the immediate parent of Novo Nordisk A / S, disclosed in US Pat. EP 277216, WO 95/26397 and WO 96
Amylases described in US Pat. No./23873 (all Novo Nordisk) are also suitable.

Examples of commercially available α-amylase products include Genencor's Purafect Ox Am^R, All Novo N
Termamyl commercially available from ordisk A / S Denmark^R, Ban^R, Fungamyl^Rand
 Duramyl^RIt is. WO 95/26397 describes other suitable amylases: Phadebas ^R As determined by the α-amylase activity assay, a temperature range of 25-55 ° C. and 8
At pH values in the range of -10, Termamyl^RHas a specific activity at least 25% higher than that of
An α-amylase characterized by the following is described. WO96 / 2
3873 (Novo Nordisk) are suitable. Active level
Have improved properties in terms of thermal stability and a combination of high activity levels
Other amylolytic enzymes are described in WO 95/35382.

The amylolytic enzyme is present in an amount of 0.0001 to 2% by weight of the composition, preferably 0.001%.
Pure enzyme levels of 018-0.06%, more preferably 0.00024-0.048%, are incorporated into the laundry detergent compositions of the present invention.

The enzymes may be of any suitable origin, such as of plant, animal, bacterial, fungal and yeast origin. The origin may also be mesophilic or extremophilic (cryophilic, eutrophic, thermophilic, barophilic, alkaline, acidophilic, halophilic, etc.). Purified or unpurified forms of these enzymes may also be used. At present, it is customary to modify wild-type enzymes by protein / genetic engineering techniques to maximize performance efficacy with the laundry detergent compositions of the present invention. For example, variants are designed to increase the compatibility of the enzyme with the common components of such compositions. On the other hand, variants may be designed such that the optimal pH, breach or chelant stability, catalytic activity, etc. of the enzyme variant are adjusted to suit a particular cleaning application.

In particular, attention should be paid to amino acids that are susceptible to oxidation in terms of bleach stability and surface charge in terms of surfactant compatibility. The isoelectric point of such enzymes may be modified by substitution of some charged amino acids, for example, increasing the isoelectric point helps to improve compatibility with anionic surfactants. Enzyme stability can be further enhanced, for example, by forming additional salt bridges and reinforcing calcium binding sites to increase the stability of the chelants. Special attention should be paid to cellulases, as most cellulases have a separate binding domain (CBD). The properties of such enzymes can be altered by modifying these domains.

The enzyme may be present at a pure enzyme level of 0.0001 to 2% by weight of the laundry detergent composition,
Usually incorporated into laundry detergent compositions. The enzymes can be used as separate single components (eg, globules, granules, stabilizing liquids, etc. containing one enzyme) or as a mixture of two or more enzymes (
(Eg, co-granules).

Another suitable detergent ingredient that can be added is an enzymatic oxidation scavenger, which comprises 1
Co-pending European Patent Application No. 92870018, filed Jan. 31, 992.
No. 6 is described in the specification. An example of such an enzymatic oxidation scavenger is ethoxylated tetraethylene polyamine.

The various enzyme substances and their means of incorporation into synthetic detergent compositions are also described in Genencor I.
WO 9307263A and WO 9307260A from nternational, WO from Novo
89086694A, and US 3,553, McCarty et al.
139. The enzyme was purchased from Place et al., US Pat.
U.S. Pat. No. 4,507,219 to Hughes, 101,457 and March 26, 1985.
However, it is further disclosed. Enzymatic substances useful in liquid detergent formulations and their incorporation into such formulations are described in US Pat. No. 4,261, April 14, 1981 to Hora et al.
868. Enzymes useful in detergents can be stabilized by various techniques. Enzyme stabilization technology is described in US Pat.
319, October 29, 1986, EP 199,405 and EP of Venegas.
200,586. Enzyme stabilization systems, for example, US3
519,570. A useful Bacillus sp. AC13 that provides proteases, xylanases and cellulases is described in Novo WO9401532A.

Color Care and Fabric Care Effects Technologies that exert a type of color care effect can also be included. Examples of these technologies are metal catalysts for color maintenance. Such metal catalysts are described in co-pending European Patent Application No. 92870181.2. Dye fixing agent, polyolefin dispersant for preventing wrinkles and improving water absorption, fragrance,
Amino-functional polymer for color care treatment and perfume continuation (PCT / US97 /
16546) is another example of a color care / fabric care technology and is described in 1996.
Co-pending patent application No. 96870140.9, filed Nov. 7, 2016.

[0201] Fabric softeners can also be incorporated into the laundry detergent compositions according to the present invention. These agents may be inorganic or organic in type. The inorganic softener is GB-A-1,400,898
And by the smectite clay disclosed in US Pat. No. 5,019,292. Organic fabric softeners include GB-A1,514,276 and EP-B0,0
Water-insoluble tertiary amines such as those disclosed in EP 11,340, EP-B-0,026
527 and mono-C ₁₂ -C ₁₄ quaternary ammonium salts disclosed in EP-B-0,026,528 and combinations thereof, and dilong chains as disclosed in EP-B-0,242,919 There are amides. Other useful organic components of the fabric softening system include E
There are high molecular weight polyethylene oxide materials such as those disclosed in PA-0,299,575 and 0,313,146.

The level of smectite clay is usually 2 to 20% by weight, more preferably 5 to 15% by weight.
%, The substance being added as a dry mix component to the rest of the formulation. Organic fabric softeners, such as water-insoluble tertiary amines or di-long chain amide materials, may be used in aqueous solutions.
5 to 5% by weight, usually 1 to 3% by weight, high molecular weight polyethylene oxide substance and water-soluble cationic substance 0.1 to 2% by weight, usually 0.15 to 1%
. Added at the 5% level. These substances are usually added to the spray-dried portion of the composition, but in some cases, they may be added as dry mix particles or sprayed as a molten liquid onto other solid components of the composition. Is convenient.

Chelating Agents The laundry detergent compositions of the present invention may also optionally include one or more iron and / or manganese chelating agents. Such chelators can be selected from the group consisting of aminocarboxylates, aminophosphonates, polyfunctionally substituted aromatic chelators and mixtures thereof, all as described below. Without being bound by theory, it is believed that the effects of these materials are due in part to their exceptional ability to remove iron and manganese ions from the wash liquor by the formation of soluble chelates.

Aminocarboxylates useful as optional chelating agents include ethylenediaminetetraacetic acid, N-hydroxyethylethylenediaminetriacetic acid, nitrilotriacetic acid,
There are ethylene diamine tetrapropionic acid, triethylene tetraamine hexaacetic acid, diethylene triamine pentaacetic acid and ethanol diglycine, their alkali metal, ammonium and substituted ammonium salts, and mixtures thereof. Aminophosphonates are also suitable for use as chelating agents in the compositions of the present invention when at least low levels of total phosphorus are tolerated in the detergent composition, including DEQUES
There is ethylenediaminetetrakis (methylene phosphonate) such as T. Preferably, these aminophosphonates do not contain alkyl or alkenyl groups of about 7 or more carbon atoms. Polyfunctionally substituted aromatic chelators are also useful in the present compositions. May 2, 1974
See U.S. Pat. No. 3,812,044 issued to Connor et al. A preferred compound of this type is a dihydroxydisulfobenzene, such as 1,2-dihydroxy-3,5-disulfobenzene, in the acid form.

Preferred biodegradable chelators for use in the present invention are those described by Har on November 3, 1987.
Ethylenediaminedisuccinic acid ("EDDS"), especially the [S, S] isomer, as described in US Pat. No. 4,704,233 to tman and Perkins. The composition may also contain a water-soluble methylglycine diacetate (MGDA) salt (or acid form) as a cobuilder useful as an insoluble builder, such as zeolites, laminated silicates, and the like, or as a chelant.

[0206] If utilized, these chelating agents are typically present in the laundry detergent composition in an amount of from about 0.1 to about 0.1%.
~ 15% by weight. More preferably, if utilized, the chelating agent will be from about 0.1 to about 3.0% by weight of such a composition.

[0207] Another optional component foam control agents, silicone and silica - a foam control agent which is exemplified by silicone mixture. Silicones are typically represented by alkylated polysiloxane materials, and silica is commonly used in finely divided form, exemplified by silica airgel, xerogels and various types of hydrophobic silica. These materials can be formulated as particles, and the suds suppressor is advantageously formulated to be released in a water-soluble or water-dispersible, substantially non-surfactant, detergent-impermeable carrier. . On the other hand, the foam inhibitor may be applied by dissolving or dispersing it in a liquid carrier and spraying it on one or more other components.

Preferred silicone suds suppressors are disclosed in US Pat. No. 3,933,6, Bartollota et al.
No. 72. Another particularly useful suds suppressor is a self-emulsifying silicone suds suppressor, which is disclosed in German Patent Application DT published April 28, 1977.
OS 2,646,126. Examples of such compounds are
DC-544, commercially available from Dow Corning, which is a siloxane-glycol copolymer. Particularly preferred suds suppressors are silicone oils and 2
Foam suppressant system consisting of a mixture of -alkyl-alkanols. A suitable 2-alkyl-alkanol is 2-butyloctanol, sold under the trade name Isofol 12R. Such a suds suppressor system is described in co-pending European Patent Application No. N9298704.77, filed Nov. 10, 1992. Particularly preferred silicone suds suppressors are co-pending European Patent Application No. N # 9220.
1649.8. The compositions may comprise silicone / silica mixture in combination with a molten nonporous silica such as Aerosil ^R.

[0209] The above-mentioned foam suppressing agent is used in an amount of 0.001 to 2% by weight, preferably 0.02% by weight of the composition.
Usually used at a level of 1 to 1% by weight.

Other ingredients used in laundry detergent compositions, such as soil suspending agents, soil releasing agents, optical brighteners, abrasives, bactericides, haze inhibitors, colorants and / or encapsulated or unencapsulated fragrances May also be used.

Particularly suitable encapsulating materials are water-soluble capsules consisting of matrices of polysaccharide and polyhydroxy compounds as described in GB 1,464,616. Other suitable water-soluble encapsulating materials consist of dextrins derived from non-gelatinized starch esters of substituted dicarboxylic acids, as described in US Pat. No. 3,455,838. These acid ester dextrins are preferably made from starches such as waxy maize, waxy sorghum, sago, tapioca and potato. A suitable example of the encapsulating material is N-Lok from National Starch. N-Lo
The k-encapsulated material consists of modified maize starch and glucose. Starch is modified by adding a monofunctional substituent such as octenyl succinic anhydride.

[0212] Antiredeposition and soil suspending agents suitable for the present invention include cellulose derivatives such as methylcellulose, carboxymethylcellulose and hydroxyethylcellulose, and homo or copolymer polycarboxylic acids or salts thereof.
Polymers of this type include polyacrylates and maleic anhydride-acrylic acid copolymers already described as builders, and copolymers of maleic anhydride with ethylene, methyl vinyl ether or methacrylic acid, where maleic anhydride is at least one of the copolymers. Accounts for 20 mol%. These materials are generally used at levels of 0.5 to 10%, more preferably 0.75 to 8%, most preferably 1 to 6% by weight of the composition.

Preferred optical brighteners are anionic in nature, examples of which are 4,4'-bis (2
-Diethanolamino-4-anilino-s-triazin-6-ylamino) stilbene-2,2'-disulfonate disodium, 4,4'-bis (2-morpholino-4-anilino-s-triazin-6-ylamino ) Stilbene-2,2'-
Disodium disulfonate, disodium 4,4'-bis (2,4-dianilino-s-triazin-6-ylamino) stilbene-2,2'-disulfonate,
', 4 "-bis (2,4-dianilino-s-triazin-6-ylamino) stilbene-2-sulfonic acid monosodium salt, 4,4'-bis [2-anilino-4-
(N-methyl-N-2-hydroxyethylamino) -s-triazin-6-ylamino] stilbene-2,2'-disulfonate disodium, 4,4'-bis (
4-phenyl-2,1,3-triazol-2-yl) stilbene-2,2'-
Disodium disulfonate, disodium 4,4'-bis [2-anilino-4- (1-methyl-2-hydroxyethylamino) -s-triazin-6-ylamino] stilbene-2,2'-disulfonate, 2-Stillville-4 "-(Naphth-
Sodium 1 ', 2', 4,5) -1,2,3-triazole-2 "-sulfonate and 4,4'-bis (2-sulfostyryl) biphenyl. Highly preferred brighteners are Specific brighteners disclosed in EP 755567.

Other useful polymeric substances are polyethylene glycols, especially molecular weights between 1000 and 1
0000, more specifically 2000-8000, most preferably about 4000. These are used at a level of from 0.20 to 5% by weight, more preferably from 0.25 to 2.5%. These polymers, and the previously described homo or copolymer polycarboxylate salts, provide whiteness maintenance, fabric ash adhesion (fabric ash).
deposition) and in the presence of transition metal impurities to improve cleaning performance on soil, proteins and oxidative soils.

Conventional Soil Release Polymers Preferably, the laundry detergent compositions of the present invention include other conventional soil release polymers. Such compositions exhibit good cleaning and soil release performance. Suitable soil release polymers are anionic end-capped polyesters, conventionally copolymers or terpolymers of terephthalic acid and ethylene glycol and / or propylene glycol units in various configurations. Examples of such polymers are commonly assigned US Pat. Nos. 4,116,885 and 4,711,730;
And EP-A-0,272,033. EP
A particularly preferred polymer according to -A-0,272,033 has the formula: (CH ₃ (PEG) ₄₃ ) _0.75 (POH) _0.25 [(T-PO) _2.8 (T-PEG) _0.4 ] T ( POH) _0.25 ((PEG) ₄₃ CH ₃ ) _{0.75 In the} above formula, PEG is-(OC ₂ H ₄ ) O-, PO is (OC ₃ H ₆ O), and T is (pcOC ₆ H ₄ CO).

Modified polyesters are also very useful as random copolymers of dimethyl terephthalate, dimethyl sulfoisophthalate, ethylene glycol and 1,2-propanediol, with the end groups being mainly sulfobenzoate, and secondarily ethylene glycol and / or Or it consists of a monoester of propanediol. The purpose is to obtain a polymer capped at both ends by sulfobenzoate groups, in the present context most of the copolymers being "mainly" end-capped with sulfobenzoate groups. However, some copolymers are not completely capped, so their end groups may consist of monoesters of ethylene glycol and / or propane-1,2-diol,
"Secondary" consists of such species. The polyester selected in the present invention comprises about 46% by weight dimethyl terephthalic acid, about 16% by weight propane-1,2-diol, about 10% by weight ethylene glycol, about 13% by weight dimethyl sulfobenzoic acid and about 15% by weight. It contains by weight sulfoisophthalic acid and has a molecular weight of about 3000. Polyesters and their methods of manufacture are described in detail in EPA 311,342.

It is well known in the art that free chlorine in tap water rapidly inactivates enzymes contained in detergent compositions. Thus, when a chlorine scavenger such as perborate, ammonium sulfate, sodium sulfite or polyethyleneimine is used in a formulation at a level of 0.1% or more by weight of the total composition, an improved through-the-wash of detergent enzymes ( throuth the wash) Demonstrate stability. Compositions containing chlorine scavengers are described in European Patent Application No. 9 filed January 31, 1992.
No. 2,780,18.6.

Alkoxylated polycarboxylates, such as those made from polyacrylates, are useful in the present invention to provide additional fat removal performance. Such materials are described in WO 91/08281 and PCT, which are incorporated herein by reference.
90/01815, pages 4 et seq. Chemically, these substances are 7
Consists of a polyacrylate having one ethoxy side chain for every ~ 8 acrylate units. Side chain of the formula _- consists _{(CH 2 CH 2 O) m} (CH 2) n CH 3, wherein m is 2 to 3, n is 6-12. The side chains are esterified to the polyacrylate “backbone” to form a “comb” polymer type structure. Molecular weights vary, but typically range from about 2000 to about 50,000. Such alkoxylated polycarboxylates represent from about 0.05 to about 10% by weight of the composition.

Dispersant The laundry detergent composition of the present invention can also contain a dispersant. Suitable water-soluble organic salts are homo- or copolymeric acids, or salts thereof, wherein the polycarboxylic acid has at least two carboxyl groups separated from each other by no more than two carbon atoms. This type of polymer is disclosed in GB-A-1,596,756. Examples of such salts are polyacrylates with a MW of 2000 to 5000 and their copolymers with maleic anhydride, such copolymers being 1000 to 10
It has a molecular weight of 000. In particular, copolymers of acrylates and methyl acrylates such as 480N having a molecular weight of 4000 can be added to the laundry detergent compositions of the present invention at a level of 0.5-20% by weight of the composition.

The compositions of the present invention may contain a lime soap peptizer compound, which has a lime soap dispersing power (LSDP) of 8 or less, preferably 7 or less, most preferably 6 or less. Is preferred. The lime soap peptizer compound is preferably present at a level of 0-20% by weight.

The numerical measure of the effectiveness of a lime soap peptizer is the lime soap dispersive power (LSD).
P), HCBorghetty and CA Bergman, J. Am. Oil. Chem. Soc., Volum
e 27, pages 88-90 (1950) Measured using a lime soap dispersion test as described in the article. This lime soap dispersion test method is widely used by those skilled in the art,
For example, the following review literature: WNLinfield, Surfactant Science Series, Volume 7,
p.3; WNLinfield, Tenside Surf.det., volume 27, pages 159-161 (1990);
K. Nagarajan, WFMasler, Cosmetics and Toiletries, volume 104, pages 71-73 (1
989). LSDP is a dispersant to olein required to disperse a lime soap precipitate formed by 0.025 g of sodium oleate in 30 ml of water having a hardness of 333 ppm CaCo ₃ (Ca: Mg = 3: 2). It means the percentage by weight of sodium acid.

Surfactants having good lime soap peptizer capabilities include certain amines
Oxide, betaine, sulfobetaine, alkyl ethoxy sulfate and eth
There is a xylated alcohol. Exemplary surfactants having an LSDP of 8 or less for use according to the invention include C ₁₆ -C₁₈Dimethylamine oxide, C having an average ethoxylation degree of 1 to 5₁₂-C₁₈Al
Kill ethoxy sulphate, especially C with ethoxylation degree 3₁₂-C_FifteenAlkyl ethoxy
Cisulfate surfactant (LSDP = 4), and trade name from BASF GmbH
Average ethoxylation sold in Lutensol A012 and Lutensol A030 respectively
Degree 12 (LSDP = 6) or 30 C₁₄-C_FifteenThere is ethoxylated alcohol
.

Polymer lime soap peptizers suitable for use in the present invention include Cosmetics and
MKNagarajan, WFMa found in Toiletries, volume 104, pages 71-73 (1989)
It is described in a paper by sler. 4- (N-octanoyl-6-aminohexanoyl) benzenesulfonate,
4- (N-nonanoyl-6-aminohexanoyl) benzenesulfonate, 4-
Hydrophobic bleach, such as (N-decanoyl-6-aminohexanoyl) benzenesulfonate and mixtures thereof; Nonanoyloxybenzenesulfonate combined with hydrophilic / hydrophobic bleach formulation is also used as lime soap peptizer compound it can.

Discoloration Inhibition The laundry detergent compositions of the present invention may also include compounds for inhibiting dye transfer from one fabric with dissolved and suspended dye to another encountered during a fabric washing operation with a colored fabric. Can be contained.

Polymer Transfer Inhibitor The laundry detergent composition according to the present invention comprises from 0.001 to 10% by weight, preferably from 0.01 to 10% by weight.
It also contains 1-2%, more preferably 0.05-1%, of a polymeric dye transfer inhibitor. The polymeric transfer dye inhibitor is commonly incorporated into laundry detergent compositions to prevent dye transfer from the colored fabric onto the washed fabric. These polymers have the ability to complex with or adsorb free dye washed off from the colored fabric before the dye has a chance to adhere to other objects in the wash liquor. Particularly suitable polymeric dye transfer inhibitors are polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinylpyrrolidone polymers, polyvinyloxazolidone and polyvinylimidazole, or mixtures thereof. The addition of such a polymer also enhances the performance of the enzyme according to the invention.

A) Polyamine N-Oxide Polymers Suitable for use with the polyamine N-oxide polymers comprise units having the following structural formula:

Embedded image In the above formula, P is a polymerizable unit, to which an R—N—O group can be bound, or the R—N—O group forms part of the polymerizable unit, or a combination of both A is NC (= O), C (= O) O, C = O, -O-, -S-, -N-;
x is 0 or 1; R is an aliphatic, ethoxylated aliphatic, aromatic, heterocyclic, alicyclic group or a combination thereof, to which the nitrogen of the NO group can be attached, or The nitrogen of the NO group is part of these groups.

The N—O group can be represented by the following general structure:

Embedded image Wherein R1, R2 and R3 are an aliphatic group, an aromatic, a heterocyclic, an alicyclic group or a combination thereof, wherein x or / and y or / and z is 0 or 1, where N The nitrogen of the -O group is attached, or the nitrogen of the NO group forms part of these groups.

The NO group may be part of the polymerizable unit (P), attached to the polymer backbone, or a combination of both. Suitable polyamine N-oxides in which the NO group forms part of the polymerizable unit include those polyamine N-oxides in which R is selected from aliphatic, aromatic, cycloaliphatic or heterocyclic groups. is there. One class of the above polyamine N-oxides comprises a group of polyamine N-oxides in which the nitrogen of the NO group forms part of the R group. Preferred polyamine N
An oxide is where R is a heterocyclic group such as pyridine, pyrrole, imidazole, pyrrolidine, piperidine, quinoline, acridine and derivatives thereof. Another class of polyamine N-oxides consists of a group of polyamine N-oxides in which the nitrogen of the NO group is attached to the R group.

Other suitable polyamine N-oxides are those in which the NO group is attached to a polymerizable unit. A preferred class of these polyamine N-oxides is
R is an aromatic, heterocyclic or alicyclic group and the nitrogen of the NO functionality is
A polyamine N-oxide having the general formula (I), which is part of a group. Examples of these classes are polyamine oxides, where R is a heterocyclic compound such as pyridine, pyrrole, imidazole and derivatives thereof. Another preferred class of polyamine N-oxides is the general formula (I) wherein R is an aromatic, heterocyclic or alicyclic group and the nitrogen of the NO function is attached to the R group. ). Examples of these classes are polyamine oxides, where the R groups are aromatic, such as phenyl.

[0230] Any polymer backbone may be used as long as the amine oxide polymer formed is water soluble and has dye transfer inhibiting properties. Examples of suitable polymer backbones include
Polyvinyl, polyalkylene, polyester, polyether, polyamide, polyimide, polyacrylate and mixtures thereof.

The amine N-oxide polymers of the present invention typically comprise 10: 1 to 1: 1000
It has a ratio of amine to amine N-oxide of 000. However, the amount of amine oxide groups present in the polyamine oxide polymer can be varied by suitable copolymerization or by moderate N-oxidation. Preferably, the ratio of amine to amine N-oxide is from 2: 3 to 1: 1,000,000, more preferably from 1: 4 to 1: 1,000,000, and most preferably from 1: 7 to 1: 100,000.
0. The polymers of the present invention actually include random or block copolymers in which one monomer type is an amine N-oxide and the other monomer type is or is not an amine N-oxide. The amine oxide units of the polyamine N-oxide have a pKa <10, preferably a pKa <7, more preferably a pKa <6. Polyamine oxides can be obtained at almost any degree of polymerization. The degree of polymerization is not critical as long as the material has the desired water solubility and dye suspending power. Typically, the average molecular weight is between 500 and 1,000,000, preferably 1000
~ 50,000, more preferably 2000 to 30,000, most preferably 30
It is in the range of 00 to 20,000.

B) Copolymer of N-vinylpyrrolidone and N-vinylimidazole The N-vinylimidazole N-vinylpyrrolidone polymer used in the present invention has an average molecular weight of 5000 to 1,000,000, preferably 5000 to 200,000. Having a range. Highly preferred polymers for use in the laundry detergent compositions according to the present invention are those selected from N-vinylimidazole N-vinylpyrrolidone copolymers, the polymers being from 5,000 to 50,000, more preferably from 8,000 to 30,000.
00, most preferably from 10,000 to 20,000.
The average molecular weight range is based on Barth HGand Mays JW, Chemical Analysis, Vol. 113, "Mod
ern Methods of Polymer Characterization ". Highly preferred N-vinylimidazole N-vinylpyrrolidone copolymers are 5,000-50,000, more preferably 8,000-30,000, most preferably It has an average molecular weight range of 10,000 to 20,000.

N-vinylimidazole N-vinylpyrrolidone copolymers, characterized by having the above average molecular weight range, exhibit excellent transfer inhibition properties while adversely affecting the cleaning performance of the detergent compositions formulated therewith. Absent. The N-vinylimidazole N-vinylpyrrolidone copolymer of the present invention comprises:
0.2, more preferably 0.8: 0.3, most preferably 0.6: 0.4 N-
It has a molar ratio of vinylimidazole to N-vinylpyrrolidone.

C) Polyvinylpyrrolidone In the laundry detergent compositions of the present invention, from about 2500 to about 400,000, preferably from about 5000 to about 200,000, more preferably from about 5000 to about 50,000, and most preferably about 5000. Polyvinyl pyrrolidone ("PVP") having an average molecular weight of from about 15,000 may also be utilized. Suitable polyvinylpyrrolidone are the product names PVP K-15 (viscosity molecular weight of 10,000), PVP K-30 (40,0
ISP Corporation as PVP K-60 (average molecular weight of 160,000) and PVP K-90 (average molecular weight of 360,000).
, New York, NY and Montreal, Canada. BASF Cooperation
Other suitable polyvinylpyrrolidones commercially available from Sokalan HP165 and Sokalan HP12; polyvinylpyrrolidone known to the detergent industry (see, for example, EP-A-262,897 and EP-A-256,696). is there.

D) Polyvinyl oxazolidone In the laundry detergent composition of the present invention, polyvinyl oxazolidone may also be used as a polymeric dye transfer inhibitor. The above polyvinyl oxazolidone is used in an amount of about 2500 to about 4
00,000, preferably about 5000 to about 200,000, more preferably about 5
It has an average molecular weight of from 000 to about 50,000, most preferably from about 5000 to about 15,000.

E) Polyvinylimidazole In the laundry detergent composition of the present invention, polyvinylimidazole may also be used as a polymer transfer inhibitor. The above polyvinyl imidazole is used in an amount of about 2500 to about 400.
000, preferably from about 5000 to about 200,000, more preferably about 500
It has an average molecular weight of from about 0 to about 50,000, most preferably from about 5000 to about 15,000.

F) Crosslinked Polymers Crosslinked polymers are polymers in which the backbone is linked to some extent, these links may be of chemical or physical nature, with the possibility that the active groups may be on the backbone or It may be on the side chain, and the crosslinked polymer can be found in Journal of Polymer Science, volum
e 22, pages 1035-1039. In one embodiment, the cross-linked polymer is made to form a three-dimensional rigid structure and can trap dye in pores formed by the three-dimensional structure. In another aspect, the crosslinked polymer captures the dye by swelling. Such crosslinked polymers are described in co-pending patent application 94870213.9.

Cleaning Methods The compositions of the present invention may be used in essentially any cleaning or cleaning method, including dipping, pre-treatment, and methods involving a rinsing step in which another rinse aid composition may be added. Is also good. The process described herein consists of contacting a fabric with a wash liquor in a conventional manner, and is exemplified below. The process of the present invention is conveniently performed during the cleaning process. The cleaning method is preferably 5 to 95 ° C, particularly 10 to 95 ° C.
Performed at 60 ° C. The pH of the treatment solution is preferably 7-12.

The following examples are meant to illustrate the compositions of the present invention and do not necessarily limit or limit the scope of the present invention. In laundry detergent compositions, enzyme levels are expressed as pure enzyme by weight of total composition, and unless otherwise noted, detergent components are expressed by weight of total composition. Abbreviated ingredients displayed have the following meanings: LAS: Sodium linear C _11-13 alkyl benzene sulphonate TAS: Sodium tallow alkyl sulfate CxyAS: Sodium C _1X -C _1Y alkyl sulfate CxySAS: Sodium C _1X -C _1Y two grade (2,3) alkyl sulfates CxyEz: mean z moles of ethylene oxide condensed with C _1X -C _1Y primarily straight chain primary alcohol CxyEzS: mean z moles of ethylene oxide condensed with C _1X -C _1Y sodium alkyl Sulfate QAS: R ₂ N ⁺ (CH ₃ ) ₂ (C ₂ H ₄ OH) (R ₂ = C ₁₂ -C ₁₄ ) QAS 1: R ₂ N ⁺ (CH ₃ ) ₂ (C ₂ H ₄ OH) (R _{2 = C 8 -C 11) APA:} C 8-10 amido propyl dimethyl amine soap: tallow Contact Sodium linear alkyl carboxylate nonionic derived from 80/20 mixture of fine coconut fatty acids: C ₁₃ -C ₁₅ mixed ethoxylated with an average ethoxylation degree 3.8 and the average propoxylation degree 4.5 / propoxylated fatty alcohols Neodol 45-13:. Shell Chemical CO sale C ₁₄ -C ₁₅ linear primary alcohol ethoxylates STS: sodium toluene sulphonate CFAA: C ₁₂ -C ₁₄ alkyl N- methyl glucamide TFAA: C ₁₆ -C ₁₈ alkyl N- methyl glucamide TPKFA: C ₁₂ -C ₁₄ Top de hole cut (topped whole cut) fatty silicate: amorphous sodium silicate _{(SiO 2:} Na 2 O ratio = 1.6-3.2) metasilicate: metasilicate sodium _{(SiO 2:} Na 2 O ratio = 1.0) zeolite A: 0.1 to 10 [mu] m Formula _{Na 12 (AlO 2 SiO 2)} 12 · 27H 2 O of hydrated sodium aluminosilicate (wt displayed on a dry basis) Na-SKS-6 having a main particle size of circumference: in the formula _δ-Na 2 _Si 2 _{O 5} Crystal-laminated silicate citrate: 86.4% active trisodium citrate dihydrate having a particle size distribution of 425 to 850 μm Citric acid: anhydrous citric acid Borate: sodium borate carbonate: anhydrous with a particle size of 200 to 900 μm Sodium carbonate bicarbonate: anhydrous sodium bicarbonate with a particle size distribution of 400 to 1200 μm sulfate: anhydrous sodium sulfate Mg sulfate: anhydrous magnesium sulfate STPP: sodium tripolyphosphate TSPP: tetrasodium pyrophosphate MA / AA: 4: 1 acrylate / maleate Random copolymer average molecular weight about 70,0 00-80,000 MA / AA 1: 6: 4 Random copolymer of acrylate / maleate Average molecular weight about 10,000 AA: sodium polyacrylate polymer with average molecular weight of 4500 PA30: polyacrylic acid with average molecular weight of about 4500-8000 480N: 7 : Random copolymer of 3 acrylate / methacrylate Average molecular weight of about 3500 Polygel / carbopol: high molecular weight crosslinked polyacrylate PB1: empirical formula NaBO ₂ .H ₂ O ₂ anhydrous sodium perborate monohydrate PB4: empirical formula NaBO _2. 3H _{2 O ·} H ₂ O ₂ of sodium perborate tetrahydrate percarbonate: empirical formula _{2Na 2 CO 3 · 3H 2 O} 2 in anhydrous sodium percarbonate NaDCC: sodium dichloroisocyanurate TAED: tetra acetyl ethylene les Diamine NOBS: Nonanoyloxybenzenesulfonate in sodium salt form NACA-OBS: (6-Nonamidocaproyl) oxybenzenesulfonate DTPA: Diethylenetriaminepentaacetic acid HEDP: 1,1-Hydroxyethanediphosphonic acid DETPMP: Dequest 2060 from Monsanto Diethyltriaminepenta (methylene) phosphonate EDDS: ethylenediamine-N, N'-disuccinic acid (S, S) isomer in its sodium salt form MnTACN: manganese 1,4,7-trimethyl-1,4 , 7-Triazacyclononane Photoactivated Bleach: Sulfonated Zinc Phthalocyanine Encapsulated in Dextrin-Soluble Polymer Photoactivated Bleach 1: Sulfonated Aluminophthalate Encapsulated in Dextrin-Soluble Polymer Russianin PAAC: pentaamine cobalt acetate (III) salt Paraffin: sold by Wintershall under the trade name Winog 70 Paraffin oil NaBz: sodium benzoate BzP: benzoyl peroxide mannanase: Bacillus agardherens, mannanase from NCIMB 40482 Protease: Novo Nordisk A Proteolytic enzymes sold under the trade names Savinase, Alcalase, Durazym from / S; Maxacal, Maxapem sold from Gist-Brocades; and described in patents WO 91/06637 and / or WO 95/10591 and / or EP 251446. protease amylase: Genencor tradename Purafact Ox Am ^R sold by WO94 / 18314, WO96 / 05295 amylolytic enzymes was described from; all Novo Nordisk A / S Termamyl commercially available from ^R, Fungamyl ^R Oyo Duramyl ^R; and WO95 / 26397 as described in lipase: Novo Nordisk A / S from tradename Lipolase, lipolytic enzymes sold under Lipolase Ultra, and Lipomax cellulase by Gist-Brocades: Product from Novo Nordisk A / S Cellulolytic enzymes sold under the names Carezyme, Celluzyme and / or Endolase CMC: sodium carboxymethylcellulose PVP: polyvinyl polymer with an average molecular weight of 60,000 PVNO: polyvinylpyridine-N-oxide PVPVI with an average molecular weight of 50,000: average molecular weight 20 Copolymer of 2,000 vinylimidazole and vinylpyrrolidone Brightener 1: Disodium 4,4'-bis (2-sulfostyryl) biphenyl Brightener 2: 4,4'-bis (4-anilino-6-morpholino- 1,3,5-triazine-2 -Yl) stilbene-2,2'-disulfonic acid disodium silicone antifoaming agent: a siloxane oxyalkylene copolymer as a dispersing agent in a ratio of 10: 1 to 100: 1 form adjuster to dispersing agent, Polydimethylsiloxane Foam Modifier Foam Inhibitor: Granular, 12% Silicone / Silica, 18% Stearyl Alcohol, 70% Starch Opaque: Water based monostyrene latex mixture sold by BASF Aktiengesellschaft under the trade name Lytron 621 SRP1: anionic end-capped polyester SRP2: diethoxylated poly (1,2-propylene terephthalate) short block polymer QEA: bis _{[(C 2 H 5 O) (} C 2 H 4 O) n ] _(CH 3) -N ^{_{+ - C 6 H 12 -N +}} - (CH 3) bis [(C _{2 H 5 O) (C 2} H 4 O) ] _{n (n = 20~30) PEI:} WO97 / PEI1800E 7 as described in 42288, PEI1200E _7, polyethylene such as quaternized PEI1200E _7, PEI600E ₂₀ Imine SCS: Sodium cumene sulfonate HMWPEO: High molecular weight polyethylene oxide PEGx: Polyethylene glycol with molecular weight x PEO: Polyethylene oxide with average molecular weight of 5000

Example 1 The following high-density laundry detergent composition was prepared in accordance with the present invention: I II III IV V VI LAS 8.0 8.0 8.0 2.0 6.0 6.0 TAS -0.5-0.5 1.0 0.1 C46 (S) AS 2.0 2.5--- -C25AS---7.0 4.5 5.5 C68AS 2.0 5.0 7.0---C25E5--3.4 10.0 4.6 4.6 C25E7 3.4 3.4 1.0---C25E3S---2.0 5.0 4.5 QAS-0.8----QAS1---0.8 0.5 1.0 Zeolite A 18.1 17.5 14.1 17.1 19.5 17.1 Citric acid---2.5-2.5 Carbonate 13.0 13.0 27.0 10.0 10.0 13.0 Na-SKS-6---10.0-10.0 Silicate 1.4 1.4 3.0 0.3 0.5 0.3 Citrate-1.0-3.0--Sulfate 26.1 26.1 26.1 6.0--Mg sulfate 0.3--0.2-0.2 MA / AA 0.3 0.3 0.3 4.0 1.0 1.0 CMC 0.2 0.2 0.2 0.2 0.4 0.4 PB4 9.0 9.0 5.0---Percarbonate----18.0 18.0 TAED 1.5 0.4 1.5- 3.9 4.2 NACA-OBS-2.0 1.0---DETPM 0.25 0.25 0.25 0.25--SRP1---0.2-0.2 EDDS-0.25 0.4-0.5 0.5 CFAA-1.0-2.0--HEDP 0.3 0.3 0.3 0.3 0.4 0.4 QEA---0.2-0.5 Mannanase 0.001 0.02 0.001 0.02 0.0015 0.001 Protease 0.009 0.009 0.01 0.04 0.05 0.03 amylase 0.002 0.002 0.002 0.006 0.008 0.008 cellulase 0.0007--0.0007 0.0007 0.0007 lipase 0.006--0.01 0.01 0.01 Light activated bleach (ppm) 15 15 15-20 20 PEI 0.2 0.5 0.2 1.0 0.5 1.0 PVNO / PVPVI- --0.1--Brightener 1 0.09 0.09 0.09-0.09 0.09 Fragrance 0.3 0.3 0.3 0.4 0.4 0.4 Silicone defoamer 0.5 0.5 0.5-0.3 0.3 Density g / L 850 850 850 850 850 850 850 Others Up to 100%

Example 2 The following granular laundry detergent compositions particularly useful under European machine wash conditions were prepared in accordance with the present invention: I II III IV V VI LAS 5.5 7.5 5.0 5.0 6.0 7.0 TAS 1.25 1.9-0.8 0.4 0.3 C24AS / C25AS-2.2 5.0 5.0 5.0 2.2 C25E3S-0.8 1.0 1.5 3.0 1.0 C45E7 3.25----3.0 TFAA--2.0---C25E5-5.5----QAS 0.8-----QAS1-0.7 1.0 0.5 1.0 0.7 STPP 19.7-----Zeolite A-16.75 24.0 19.5 20.0 17.0 NaSKS-6 / citric acid (79:21)-10.6-10.6--Na-SKS-6--9.0-10.0 10.0 Carbonate 6.1 21.4 9.0 10.0 10.0 18.0 Bicarbonate-2.0 7.0 5.0-2.0 Silicate 6.8--0.3 0.5-Citrate--4.0 4.0--Sulfate 36.8--5.0-12.0 Mg sulfate--0.1 0.2 0.2-MA / AA 0.5 1.6 3.0 3.5 1.0 1.0 CMC 0.2 0.4 1.0 1.0 0.4 0.4 PB4 5.0 12.7----Percarbonate----18.0 15.0 TAED 0.5 3.1--5.0-NACA-OBS 1.0 3.5---2.5 DETPMP 0.25 0.2 0.3 0.4-0.2 HEDP-0.3-0.3 0.3 0.3 QEA--1.0 1.0 1.0-Mannanase 0.001 0.02 0.001 0.015 0.02 0.001 Protease 0.009 0.03 0.03 0.05 0.05 0.02 Lipase 0.003 0.003 0.006 0.006 0.006 0.004 Cellulase 0.0006 0.0006 0.0005 0.0005 0.0007 0.0007 Amylase 0.002 0.002 0.006 0.006 0.01 0.003 PEI 3.0 1.75 1.0 0.5 0.25 0.25 PVNO / PVPVI--0.2 0.2--PVP 0.9 1.3---0.9 SRP1--0.2 0.2 0.2-Light activated bleach (ppm) 15 27--20 20 Light activated bleach (1) (ppm) 15-----Brightener 1 0.08 0.2--0.09 0.15 Brightener 2-0.04-- --Fragrance 0.3 0.5 0.4 0.3 0.4 0.3 Silicone defoamer 0.5 2.4 0.3 0.5 0.3 2.0 Density g / L 750 750 750 750 750 750 Others Up to 100%

Example 3 The following detergent compositions which are particularly useful under European machine wash conditions were prepared in accordance with the present invention: I II III IV Blown Powder: LAS 6.0 5.0 11.0 0 TAS 2.0--2.0 Zeolite A 23.5--19.5 STPP-26.0 21.0-Sulfate 4.0 6.0 13.0-MA / AA 1.0 4.0 6 2.0 2.0 silicate 1.0 7.0 3.0 3.0 CMC 1.0 1.0 0.5 0.6 Brightener 1 0.2 0.2 0.2 0.2 Silicone defoaming 1.0 1.0 1.0 0.3 DETPMP 0.4 0.4 0.2 0.4 Spray-on: Brightener 0.02 --- 0.02 C45E7 --- 5.0 C45E2 5 2.5 2.0-C45E3 2.6 2.5 2.0-fragrance 0. 5 0.3 0.5 0.2 Silicone defoamer 0.3 0.3 0.3-Dry additive: QEA---1.0 EDDS 0.3---Sulfate 2.0 3.05 0.0 10.0 Carbonate 6.0 13.0 15.0 14.0 Citric acid 2.5--2.0 QAS1 0.5--0.5 Na-SKS-6 10.0--PEI 0.5 1.0 3.0 0.5 Percarbonate 18.5----PB4-18.0 10.0 21.5 TAED 2.0 2.0-2.0 NACA-OBS 3.0 2.0. 0 4.0-Mannanase 0.001 0.02 0.01 0.0015 Protease 0.03 0.03 0.03 0.03 Lipase 0.008 0.008 0.008 0.004 Amylase 0.003 0.003 0.003 0.006 Brightener 1 0.05--0.05 Others Up to 100%

[0243] Example 4 below granular detergent compositions were prepared in accordance with the present invention: I II III IV V VI Blown Powder: LAS 23.0 8.0 7.0 9.0 7.0 7.0 TAS - - - - 1.0 - C45AS 6.0 6.0 5.0 8.0 - - C45AES - 1.0 1.0 1.0--C45E35-----2.0 4.0 Zeolite A 10.0 18.0 14.0 10.25 10.0 10.0 MA / AA-0.5---2.0 MA / AA1 7.0------AA-3.0 3.0 2.0 3.0 3.0 Sulfate 5.0 6.3 12.3 11.0 13.0 18.3 Silicate 10.0 1.0 1.0 1.0 1.0 1.0 Carbonate 14.5 19.0 10.0 20.7 8.0 6.0 PEG 4000 0.4 1.5 1.5 1.0 1.0 1.0 DTPA-0.9 0.5--0.5 Brightener 2 0.3 0.2 0.3-0.1 0.3 Spray-on: C45E7-2.0--2.0 2.0 C25E9 3.0------C23E9--1.5 2.0-2.0 Fragrance 0.3 0.3 0.3 2.0 0.3 0.3 Aggregate: C45AS-5.0 5.0 2.0-5.0 LAS-2.0 2.0--2.0 Light A-7.5 7.5 8.0-7.5 Carbonate-4.0 4.0 5.0-4.0 PEG4000-0.5 0.5--0.5 Other (water, etc.)-2.0 2.0 2.0-2.0 Dry additive: QAS----1.0-Citric acid---- -2.0-PB4----12.0 1.0 PB1 4.0 1.0 3.0 2.0--Percarbonate-----2.0 10.0 Carbonate-5.3 1.8-4.0 4.0 NOBS 4.0-6.0--0.6 Methylcellulose 0.2------Na-SKS -6 8.0------STS--2.0-1.0-Cumenesulfonic acid-1.0---2.0 Mannanase 0.001 0.02 0.001 0.015 0.02 0.02 Protease 0.02 0.02 0.02 0.01 0.02 0.02 Lipase 0.004-0.004-0.004 0.008 Amylase 0.003-0.002- 0.003-Cellulase 0.0005 0.0005 0.0005 0.0007 0.0005 0.0005 PVPVI-----0.5 0.1 PVP-----0.5-PVNO--0.5 0.3--PEI 0.5 1.0 2.0 1.75 2.0 1.0 QEA-----1.0-SRP1 0.2 0.5 0.3-0.2-Silicone defoamer 0.2 0.4 0.2 0.4 0.1-Mg sulfate--0.2-0.2-Others up to 100%

Example 5 The following bleach-free detergent compositions particularly useful in washing colored clothing were prepared according to the present invention: I II III Blown Powder: Zeolite A 14.5 14.0-Sulfate-5.0-LAS 3 3.0 3.0-DETPMP 0.4 0.5-CMC 0.4 0.4-MA / AA 4.0 4.0-Aggregate: C45AS--11.0 LAS 6.0 5.0-TAS 3.0 2.0-PEI 0.5 1.0 3.0 Silicate 4.0 4.0-Zeolite A 10.0 15.0 13.0 CMC--0.5 MA / AA--2.0 Carbonate 9.0 7.0 7.0 Spray-on: Perfume 0.3 0.3 0.5 C45E7 4.0 4.0 4.0 C25E3 2.0 2.0 2.0 Dry Additive: MA / AA --- 1.0 Na-SKS-6 --11.0 Citrate 10.0-8.0 Bicarbonate 7.0 3.0 5.0 Carbonate 8.0 5.0 7.0 PVPVI / PVNO 0.5 0.5 0.5 Mannanase 0 0.001 0.02 0.015 Protease 0.03 0.02 0.05 Lipase 0.008 0.008 0.008 Amylase 0.01 0.01 0.01 Cellulase 0.001 0.001 0.001 Silicone Foaming 5.0 5.0 5.0 Sulfate-9.0-Density (g / L) 700 700 700 Others Up to 100%

[0245] Example 6 The following detergent composition was prepared in accordance with the present invention: I II III IV Base granule Zeolite A 29.5 21.0 22.0 10.0 Sulfate 10.0 5.0 10.0 7.0 MA / AA 3.0 - - - AA - 1.6 2.0 - PEI 0.5 1.0 2.0 3.0 MA / AA1-12.0-6.0 LAS 14.0 10.0 9.0 18.0 C45AS 8.0 7.0 9.0 7.0 C45AES-1.0 1.0-silicate-1.0 0.5 9.0 Soap-2.0--Brightener 1 0.2 0.2 0.2 0.2 Carbonate 6.0 9.0 10.0 10.0 PEG4000- 1.0 1.5-DTPA-0.4--Spray-on: C25E9---5.0 C45E7 1.0 1.0--C23E9-1.0 2.5-Fragrance 0.2 0.3 0.3-Dry additive: Carbonate 5.0 10.0 18.0 8.0 PVPVI / PVNO 0.5-0.3-Mannanase 0.001 0.02 0.001 0.0015 Protease 0.03 0.03 0.03 0.02 Lipase 0.008--0.008 Amylase 0.002--0.002 Cellulase 0.0002 0.0005 0.0005 0.0002 NOBS-4.0-4.5 PB1 1.0 5.0 1.5 6.0 Sulfate 4.0 5.0-5.0 SRP1-0.4--Foaming inhibitor-0.5 0.5-Others up to 100%

Example 7 The following granular detergent composition was prepared in accordance with the present invention: I II III Blown powder: Zeolite A 20.0-15.0 STPP-20.0-Sulfate-5.0 Carbonate-5 1.0 TAS--1.0 LAS 6.0 6.0 6.0 C68AS 2.0 2.0-Silicate 3.0 8.0-MA / AA 4.0 2.0 2.0 CMC 0.6 0.6 0.2 Brightener 1 0.2 0.2 0.1 DETPMP 0.4 0.4 0.1 STS --- 1.0 Spray-on: C45E7 5.0 5.0 4.0 Silicone Foaming agent 0.3 0.3 0.1 Fragrance 0.2 0.2 0.3 Dry additive: QEA--1.0 Carbonate 14.0 9.0 10.0 10.0 PB1 1.5 2.0- PB4 18.5 13.0 13.0 TAED 2.0 2.0 2.0 QAS--1.0 Light-activated bleach 15 ppm 15 ppm 15 ppm Na-SKS-6-3.0 Mannanase 0.001 0.02 0.01 Protease 0.03 0.03 0.007 Lipase 0.004 0.004 0.004 Amylase 0.006 0.006 0.003 Cellulase 0.0002 0.0002 0.0005 PEI 1.0 3.0 0.5 Sulfate 9.0 17.0 4.5 Density (g / L) 700 700 700 Others Up to 100%

Example 8 The following detergent composition was prepared according to the present invention: I II III Blown Powder: Zeolite A 15.0 15.0 15.0 Sulfate-5.0-LAS 3.0 3.0 QAS-1.5 1.5 DETPMP 0.4 0.2 0.4 EDDS-0.4 0.2 CMC 0.4 0.4 0.4 MA / AA 4.0 2.0 2.0 Aggregate : LAS 5.0 5.0 5.0 TAS 2.0 2.0 1.0 silicate 3.0 3.0 4.0 Zeolite A 8.0 8.0 8.0 Carbonate 8.0 8.0 4.0 Spray-on: Fragrance 0.3 0.3 0.3 C45E7 2.0 2.0 2.0 2.0 C25E3 2.0 --- Dry additive: Citrate 5.0-2.0 Bicarbonate --3. 0-carbonate 8.0 14.0 8.0 PEI 0.5 1.0 2. 0 TAED 6.0 2.0 5.0 PB1 13.5 7.0 10.0 PEO--0.2 Bentonite clay--10.0 Mannanase 0.001 0.02 0.01 Protease 0.03 0.0. 03 0.03 Lipase 0.008 0.008 0.008 Cellulase 0.001 0.001 0.001 Amylase 0.01 0.01 0.01 Silicone Defoamer 5.0 5.0 5.0 Sulfate-3 0.0-Density (g / L) 850 850 850 Others Up to 100%

Example 9 The following detergent composition was prepared in accordance with the present invention: I II III IV LAS 18.0 14.0 24.0 20.0 QAS 0.7 1.0-0.7 TFAA-1.0 --C23E56.5--1.0-C45E7-1.0--C45E3S 1.0 2.5 1.0-STPP 32.0 18.0 30.0 22.0 Silicate 9.0 5.09 8.0 8.0 Carbonate 11.0 7.5 10.0 5.0 Bicarbonate-7.5--PB1 3.0 1.0--PB4-1.0--NOBS 2.0 1. 0--DETPMP-1.0--DTPA 0.5-0.2 0.3 SRP1 0.3 0.2-0.1 MA / AA 1.0 1.5 2.0 0.5 CMC 8 0.4 0.4 0.2 PEI 0.4 0.4 0.4 0.4 monkey 20.0 10.0 20.0 30.0 Mg sulfate 0.2-0.4 0.9 Mannanase 0.001 0.02 0.001 0.01 Protease 0.03 0.03 0.02 0.02 Amylase 0.008 0.007 -0.004 Lipase 0.004-0.002-Cellulase 0.0003--0.0001 Photoactivated bleach 30 ppm 20 ppm-10 ppm Fragrance 0.3 0.3 0.1 0.2 Brightener 1/2 0.05 0.02 0. 08 0.1 Others up to 100%

Example 10 The following liquid detergent formulation was prepared according to the present invention (levels are given in parts / weight; enzymes are expressed as pure enzyme): I II III IV V LAS 11.58 2.8-3.9-C25E2.5S-3.0 18.0-16.0 C45E2.25S 11.5 3.0-15.7-C23E9-2.7 1.8 2.0 1.0 C23E7 3.2-----CFAA--5.2-3.1 TPKFA 1.6-2.0 0.5 2.0 2.0 Citric acid (50%) 6.5 1.2 2.5 4.4 2 0.5 Ca formate 0.1 0.06 0.1--Na formate 0.5 0.06 0.1 0.05 0.05 SCS 4.0 1.0 3.0 1.2-Borate 0.6 -3.0 2.0 2.9 Na hydroxide 5.8 2.0 3.5 3.5 3.7 2.7 d. Tanol 1.75 1.0 3.6 4.2 2.9 1,2-3.3 2.0 8.0 7.9 5.3 Propanediol monoethanolamine 3.0 1.5 1.3 2 1.5 0.8 TEPAE 1.6-1.3 1.2 1.2 Mannanase 0.001 0.02 0.001 0.01 0.02 Protease 0.03 0.01 0.03 0.02 0.02 Lipase-- 0.002--Amylase----0.002-Cellulase--0.0002 0.0005 0.0001 SRP1 0.2-0.1--DTPA--0.3--PEI 0.4 0.4 0.4 0.4 0.4 0.4 PVNO --0.3-0.2 Brightener 1 0.2 0.07 0.1--Silicone defoamer 0.04 0.02 0.1 0.1 0.1 Water and other up to 100%

Example 11 The following liquid detergent formulation was prepared according to the present invention (levels are given in parts / weight; enzymes are indicated as pure enzyme): I II III IV LAS 10.0 0 9.0-C25AS 4.0 1.0 2.0 10.0 10.0 C25E3S 1.0--3.0 C25E7 6.0 8.0 13.0 2.5 TFAA---4.5 APA-1 ---TPKFA 2.0-13.0 7.0 Citric acid 2.0 3.0 1.0 1.5 Dodecenyl / 12.0 10.0--Tetradecenyl succinic acid Rapeseed fatty acid 4.0 2.0 1.0-ethanol 4.0 4.0 7.0 2.0 1,2-propanediol 4.0 4.0 2.0 7.0 monoethanolamine---5.0 triethanolamine ---8.0-TEPAE -0.5 0.2 DETPMP 1.0 1.0 0.5 1.0 Mannanase 0.001 0.02 0.001 0.02 Protease 0.02 0.02 0.01 0.008 Lipase-0.002-0.002 Amylase 0.004 0.004 0. 01 0.008 Cellulase-----0.002 SRP2 0.3-0.3 0.1 Boric acid 0.1 0.2 1.0 2.0 Ca chloride-0.02- 0.01 Brightener 1-0.4 --PEI 0.4 0.4 0.2 0.2 Foaming inhibitor 0.1 0.3-0.1 Opacifier 0.5 0.4-0.3 NaOH (to right pH) 0 8.0 7.6 7.7 Water and other up to 100%

Example 12 The following liquid detergent composition was prepared in accordance with the present invention (levels are given in parts / weight; enzymes are indicated as pure enzyme): I II III IV LAS 25.0-- -C25AS-13.0 18.0 15.0 C25E3S-2.0 2.0 4.0 C25E7--4.0 4.0 TFAA-6.0 8.0 8.0 APA 3.0 1.0 2.0-TPKFA-15.0 11.0 11.0 Citric acid 1.0 1.0 1.0 1.0 Dodecenyl / 15.0---Tetradecenyl succinic acid Rapeseed fatty acid 1.0-3 5.5-ethanol 7.0 2.0 3.0 2.0 1,2-propanediol 6.0 8.0 10.0 13.0 monoethanolamine--9.0 9.0 TEMPE--0. 4 0.3 DETPMP 2.0 1.2 1.0-Mannanase 0.001 0.02 0.001 0.01 Protease 0.08 0.02 0.01 0.02 Lipase--0.003 0.003 Amylase 0.004 0.01 0.01 0.01 Cellulase--0.004 0.003 PEI 0.2 0.2 0.4 0.4 SRP2 --- 0.2 0.1 Boric acid 1.0 1.5 2.5 2.5 Bentonite clay 4.0 4.0-Brightener 1 0.1 0.2 0.3-Foaming inhibitor 0.4---Opaque agent 0.8 0.7--NaOH (up to the right pH) 8.0 7.5 8.0 8.0 Water And up to 100%

Example 13 The following liquid detergent composition was prepared according to the present invention (levels are given in parts / weight; enzymes are expressed as pure enzyme): I II LAS 27.6 18.9 C45AS 13.8 5.9 C13E8 3.0 3.1 Oleic acid 3.4 2.5 Citric acid 5.4 5.4 Na hydroxide 0.4 3.6 Ca formate 0.2 0.1 Na-0 formate 5.5 Ethanol 7.0-Monoethanolamine 16.5 8.0 1,2-Propanediol 5.9 5.5 Xylenesulfonic acid-2.4 TEMPE 1.5 0.8 Protease 0.05 0.02 Mannanase 0.001 0.02 PEI 0.2 0.4 PEG-0.7 Brightener 2 0.4 0.1 Fragrance 0.5 0.3 Water and other up to 100%

[0253] Example 14 The following granular fabric detergent compositions which exhibit the capacity "softening by washing" was prepared in accordance with the present invention: I II C45AS - 10.0 LAS 7.6 - C68AS 1.3 - C45E7 4.0 -C25E3-5.0 Cocoalkyldimethylhydroxy 1.4 1.0 Ethyl ammonium chloride citrate 5.0 3.0 Na-SKS-6-11.0 Zeolite A 15.0 15.0 MA / AA 4.04 0.0 DETPMP 0.4 0.4 PB1 15.0-Percarbonate-15.0 TAED 5.0 5.0 Smectite clay 10.0 10.0 HMWPEO-0.1 Mannanase 0.001 0.02 Protease 0.0 02 0.01 Lipase 0.02 0.01 Amylase 0.03 0.005 Cellulase 0.0 1 - silicate 3.0 5.0 PEI 0.2 0.4 Carbonate 10.0 10.0 suds suppressor 1.0 to 4.0 CMC 0.2 0.1 Others 100%

Example 15 The following solid laundry detergent composition was prepared in accordance with the present invention (levels are given in parts / weight; enzymes are expressed as pure enzyme): I II III VI V VI VII VIII LAS --19.0 15.0 21.0 6.75 8.8-C28AS 30.0 13.5----15.75 11.2 22.5 Na laurate 2.5 9.0-------Zeolite A 2.0 1.25----1.25 1.25 1.25 1.25 Carbonate 20.0 3.0 13.0 8.0 10.0 15.0 15.0 10.0 Carbonate 27.5 39.0 35.0--40.0-40.0 Sulfate 5.0 5.0 3.0 5.0 3.0--5.0 TSPP 5.0----5.0 2.5-STPP 5.0 15.0 10.0--7.0 8.0 10.0 Bentonite clay-10.0--5.0---DETPMP-0.7 0.6- 0.6 0.7 0.7 0.7 CMC-1.0 1.0 1.0 1.0--1.0 Talc--10.0 15.0 10.0----Silicate--4.0 5.0 3.0-----PVNO 0.02 0.03-0.01-0.02--MA / AA 0.41 .0--0.2 0.4 0.5 0.4 SRP1 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 Mannanase 0.001 0.01 0.001 0.01 0.01 0.001 0.01 0.001 Amylase--0.01----0.002-Protease-0.004-0.003 0.003--0.003 Lipase-0.002-0.002- ----Cellulase-.0003--.0003 .0002--PEI 0.2 0.2 0.2 0.2 0.3 0.2 0.2 0.3 Fragrance 1.0 0.5 0.3 0.2 0.4--0.4 Mg sulfate--3.0 3.0 3.0---Brightener 0.15 0.1 0.15- ----0.1 Light activated bleach (ppm)-15.0 15.0 15.0 15.0--15.0

Example 16 The following detergent additive composition was prepared according to the present invention: I II III LAS-5.0 5.0 PEI 0.5 1.0 3.0 STPP 29.5-17.0 Zeolite A- 34.0 20.0 PB1 20.0 15.0-TAED 10.0 8.0-Mannanase 0.001 0.02 0.001 Protease-0.3 0.3 Amylase-0.06 0.06 Water and Others up to 100%

[Sequence List] SEQ ID NO: 1 Sequence characteristics: Length: 1407 base pairs Type: Nucleic acid Number of strands: Single strand Topology: Linear Molecular type: Genomic DNA Prototype Features: Name / Key: CDS Position: 1 -1482 SEQ description: SEQ ID NO: 1 ATGAAAAAAAAGTTATCACAGATTTATCATTTAATTATTTGCACACTTATAATA AGTGTGGGAATAATGGGGATTACAACGTCCCCATCAGCAGCAAGTACAGGC TTTTATGTTGATGGCAATACGTTATATGACGCAAATGGGCAGCCATTTGTCAT GAGAGGTATTAACCATGGACATGCTTGGTATAAAGACACCGCTTCAACAGCT ATTCCTGCCATTGCAGAGCAAGGCGCCAACACGATTCGTATTGTTTTATCAG ATGGCGGTCAATGGGAAAAAGACGACATTGACACCATTCGTGAAGTCATTG AGCTTGCGGAGCAAAATAAAATGGTGGCTGTCGTTGAAGTTCATGATGCCA CGGGTCGCGATTCGCGCAGTGATTTAAATCGAGCCGTTGATTATTGGATAG AAATGAAAGATGCGCTTATCGGTAAAGAAGATACGGTTATTATTAACATTGCA AACGAGTGGTATGGGAGTTGGGATGGCTCAGCTTGGGCCGATGGCTATATT GATGTCATTCCGAAGCTTCGCGATGCCGGCTTAACACACACCTTAATGGTTG ATGCAGCAGGATGGGGGCAATATCCGCAATCTATTCATGATTACGGACAAG ATGTGTTTAATGCAGATCCGTTAAAAAATACGATGTTCTCCATC CATATGTAT GAGTATGCTGGTGGTGATGCTAACACTGTTAGATCAAATATTGATAGAGTCA TAGATCAAGACCTTGCTCTCGTAATAGGTGAATTCGGTCATAGACATACTGA TGGTGATGTTGATGAAGATACAATCCTTAGTTATTCTGAAGAAACTGGCACA GGGTGGCTCGCTTGGTCTTGGAAAGGCAACAGTACCGAATGGGACTATTTA GACCTTTCAGAAGACTGGGCTGGTCAACATTTAACTGATTGGGGGAATAGAA TTGTCCACGGGGCCGATGGCTTACAGGAAACCTCCAAACCATCCACCGTAT TTACAGATGATAACGGTGGTCACCCTGAACCGCCAACTGCTACTACCTTGTA TGACTTTGAAGGAAGCACACAAGGGTGGCATGGAAGCAACGTGACCGGTG GCCCTTGGTCCGTAACAGAATGGGGTGCTTCAGGTAACTACTCTTTAAAAGC CGATGTAAATTTAACCTCAAATTCTTCACATGAACTGTATAGTGAACAAAGTC GTAATCTACACGGATACTCTCAGCTCAACGCAACCGTTCGCCATGCCAATTG GGGAAATCCCGGTAATGGCATGAATGCAAGACTTTACGTGAAAACGGGCTC TGATTATACATGGCATAGCGGTCCTTTTACACGTATCAATAGCTCCAACTCA GGAACAACGTTATCTTTTGATTTAAACAACATCGAAAATAGTCATCATGTTAG GGAAATAGGCGTGCAATTTTCAGCGGCAGATAATAGCAGTGGTCAAACTGC TCTATACGTTGATAACGTTACTTTAAGATAG SEQ ID NO: 2 sequence characteristics: Length: 493 amino acid Type: amino acid Topology: linear Molecular Type: Protein Column description: SEQ ID NO: 2 MKKKLSQIYHLIICTLIISVGIMGITTSPSAASTGFYVDGNTLYDANGQPFVMRGIN HGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKM VAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGS AWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTM FSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEE TGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKP STVFTDDNGGHPEPPTATTLYDFEGSTQGWHGSNVTGGPWSVTEWGASGNY SLKADVNLTSNSSHELYSEQSRNLHGYSQLNATVRHANWGNPGNGMNARLYV KTGSDYTWHSGPFTRINSSNSGTTLSFDLNNIENSHHVREIGVQFSAADNSSGQ TALYVDNVTLR SEQ ID NO: 3 sequence characteristics: Length: 1407 base pairs Type: Number of nucleic acid strands: single strand Topology: linear molecule Type: Description of genomic DNA sequence: SEQ ID NO: 3 CCTGCCATTGCAGAGCAAGGCGCCAACACGATTCGTATTGTTTTATCAG ATGGCGGTCAATGGGAAAAAGACGACATTGACACCATTCGTGAAGTCATTG AGCTTGCGGAGCAAAATAAAATGGTGGCTGTCGTTGAAGTTCATGATGCCA CGGGTCGCGATTCGCGCAGTGATTTAAATCGAGCCGTTGATTATTGGATAG AAATGAAAGATGCGCTTATCGGTAAAGAAGATACGGTTATTATTAACATTGCA AACGAGTGGTATGGGAGTTGGGATGGCTCAGCTTGGGCCGATGGCTATATT GATGTCATTCCGAAGCTTCGCGATGCCGGCTTAACACACACCTTAATGGTTG ATGCAGCAGGATGGGGGCAATATCCGCAATCTATTCATGATTACGGACAAG ATGTGTTTAATGCAGATCCGTTAAAAAATACGATGTTCTCCATCCATATGTAT GAGTATGCTGGTGGTGATGCTAACACTGTTAGATCAAATATTGATAGAGTCA TAGATCAAGACCTTGCTCTCGTAATAGGTGAATTCGGTCATAGACATACTGA TGGTGATGTTGATGAAGATACAATCCTTAGTTATTCTGAAGAAACTGGCACA GGGTGGCTCGCTTGGTCTTGGAAAGGCAACAGTACCGAATGGGACTATTTA GACCTTTCAGAAGACTGGGCTGGTCAACATTTAACTGATTGGGGGAATAGAA TTGTCCACGGGGCCGATGGCTTACAGGAAACCTCCAAACCATCCACCGTAT TTACAGATGATAACGGTGGTCACCCTGAACCGCCAACTGCTACTACCTTGTA TGACTTTGAAGGAAGCACACAAGGGTGGCATGGAAGCAACGTGACCGGTG GCCCTTGGTCCGTAACAGAATGGGGTGCTTCAGGTAACTACTCTTTAAAAGC CGATGTAAATTTAACCTCAAATTCTTCACATGAACTGTATAGTGAACAAAGTC GT AATCTACACGGATACTCTCAGCTCAACGCAACCGTTCGCCATGCCAATTG GGGAAATCCCGGTAATGGCATGAATGCAAGACTTTACGTGAAAACGGGCTC TGATTATACATGGCATAGCGGTCCTTTTACACGTATCAATAGCTCCAACTCA GGAACAACGTTATCTTTTGATTTAAACAACATCGAAAATATCATCATGTTAGG GAAATAG SEQ ID NO : 4 sequence characteristics: Length: 468 amino acid Type: amino acid Topology: linear Molecular Type: wherein the protein sequence: SEQ ID NO: 4 MKKKLSQIYHLIICTLIISVGIMGITTSPSAASTGFYVDGNTLYDANGQPFVMRGIN HGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKM VAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGS AWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTM FSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEE TGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKP STVFTDDNGGHPEPPTATTLYDFEGSTQGWHGSNVTGGPWSVTEWGASGNY SLKADVNLTSNSSHELYSEQSRNLHGYSQLNATVRHANWGNPGNGMNARLYV KTGSDYTWHSGPFTRINSSNSGTTLSFDLNNIENIIMLGK SEQ ID NO: 5 Sequence characteristics: Length: 1029 base pairs Type: Number of nucleic acid chains: single-stranded Topology: linear Molecular type: genomic DNA Sequence description: SEQ ID NO: 5 5 'AAT TGG CGC ATA CTG TGT CGC CTG TGA ATC CTA ATG CCC AGC AGA CAA CAA AAA CAG TGA TGA ACT GGC TTG CGC ACC TGC CGA ACC GAA CGG AAA ACA GAG TCC TTT CCG GAG CGT TCG GAG GTT ACA GCC ATG ACA CAT TTT CTA TGG CTG AGG CTG ATA GAA TCC GAA GCG CCA CCG GGC AAT CGC CTG CTA TTT ATG GCT GTGATT A CCA GAG GAT GGC TTG AAA CAG CAA ATA TTG AAG ATT CAA TAG ATG TAA GCT GCA ACG GCG ATT TAA TGT CGT ATT GGA AAA ATG GCG GAA TTC CGC AAA TCA GTT TGC ACC TGG CGA ACC CTG CTT TTC AGT CAG GGC ATT TTA AAA CAC CGA TTA CAA ATG ATC AGT ATA AAA ACA TAT TAG ATT CAG CAA CAG CGG AAG GGA AGC GGC TAA ATG CCA TGC TCA GCA AAA TTG CTG ACG GAC TTC AAG AGT TGG AGA ACC AAG GTG TGC CTG TTC TGT TCA GGC CGC TGC ATG TGA ACG GCG AAT GGT TTT GGT GGG GAC TCA CAT CAT ATA ACC AAA AGG ATA ATG AAA GAA TCT CTC TAT ATA AAC AGC TCT ACA AGA AAA TCT ATC ATT ATA TGA CCG ACA CAA GAG GAC TTG ATC ATT TGA TTT GGG TTT ACT CTC CCG ACG CCA ACC GAG ATT TTA AAA CTG ATT TTT ACC CGG GCG CGT CTT ACG TGG ATA TTG TCG GAT TAG ATG CGT ATT TTC AAG ATG CCT ACT CGA TCA ATG GAT ACG ATC AGC TAA CAG CGC TTA ATA AAC TTG CTT TTA CAG AAG TCG GCC CGC AAA CAG CAA ACG GCA GCT TCG ATT ACA GCC TGT TCA TCA ATG CAA TAA AAC AAA AAT ATC CTA AAA CCA TTT ACT TTC TGG CAT GGA ATG ATG AAT GGA GCG CAG CAG TAA ACA AGG GTG CTT CAG CTT TAT ATC ATG ACA GCT GGA CAC TCA ACA AGG GAG AAA TAT GGA ATG GTG ATT CTT TAA CGC CAA TCG TTG AGT GAA TCC GGG ATC 3 ' SEQ ID NO: 6 Sequence characteristics: Length: 363 amino acids Type: Amino acid Topology: linear molecule type: wherein the protein sequence: SEQ ID NO: 6 ydhT 1 LFKKHTISLLIIFLLASAVLAKPIEAHTVSPVNPNAQQTTKTVMNWLAHL 50 ydhT 51 PNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLE 100 ydhT 101 TANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQ 150 ydhT 151 YKNILDSATAEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFW 200 ydhT 201 WGLTS YNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFK 250 ydhT 251 TDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANG 300 ydhT 301 SFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGAYLYWSWTPNK. 363

──────────────────────────────────────────────────続 き Continuation of front page (81) Designated country EP (AT, BE, CH, CY, DE, DK, ES, FI, FR, GB, GR, IE, IT, LU, MC, NL, PT, SE ), OA (BF, BJ, CF, CG, CI, CM, GA, GN, ML, MR, NE, SN, TD, TG), AP (GH, GM, KE, LS, MW, SD, SZ, UG, ZW), EA (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM), AL, AM, AT, AU, AZ, BA, BB, BG, BR, BY, CA, CH, CN, CU, CZ, DE, DK, EE, ES, FI, GB, GE, GH, GM, GW, HU, ID, IL, IS, JP, KE, KG, KP, KR , KZ, LC, LK, LR, LS, LT, LU, LV, MD, MG, MK, MN, MW, MX, NO, NZ, PL, PT, RO, RU, SD, SE, SG, SI, SK, SL, TJ, TM, TR, TT, UA, UG, US, UZ, VN, YU, ZW Christian, Arthur, Jack, Camiel, Toen Ohio, USA, West, Chester, Rap, Farm, Drive, 8485 F-term (reference) 4H003 AB19 AB27 AB31 AC05 AC08 AE06 DA01 EA09 EA12 EA15 EA20 EA28 EA30 EB08 EB12 EB13 EB19 EB22 EB24 EB26 EB28 EB32 EB37 EB38 EB42 EC01 EC02 EC03 EE05 FA47

Claims (11)

[Claims] 1. A laundry detergent composition comprising a mannanase enzyme and a cotton polyethylene imine soil release polymer. 2. Mannanase is present in an amount of 0.0001 to 2%, preferably 0.000% by weight of the total composition.
2. Laundry detergent composition according to claim 1, wherein it is present at a pure enzyme level of 5 to 0.5%, more preferably 0.001 to 0.1%. 3. The method of claim 1, wherein the cotton polyethyleneimine soil release polymer comprises 0.0001 to 20% by weight.
Laundry detergent composition according to claim 1 or 2, comprising at a level of preferably from 0.001 to 15%, more preferably from 0.01 to 10%. 4. A cotton polyethylene imine soil release polymer having the following formula: ## STR1 ##(Modified polyamine formula V_{(n + 1)}W_mY_nZ), or a material corresponding to the following formula:
Liamine main chain:(Modified polyamine formula V_{(n-k + 1)}W_mY_nY '_kHas Z (k is less than or equal to n)
(The unmodified polyamine backbone has a molecular weight of about 200 daltons or more.)
Wherein i) the V unit is a terminal unit having the following formula:ii) W units are backbone units having the formula:iii) Y units are branching units having the formula:iv) Z units are terminal units having the formula:In the above formula, the main chain linking R unit is C₂-C₁₂Alkylene, C₄-C₁₂Alkenylene,
C₃-C₁₂Hydroxyalkylene, C₄-C₁₂Dihydroxyalkylene, C₈-
C₁₂Dialkylarylene,-(R¹O)_xR¹-,-(R¹O)_xR⁵(OR ¹ )_x-,-(CH₂CH (OR²) CH₂O)_z-(R¹O)_yR¹(OCH ₂ CH (OR²) CH₂)_w-, -C (O) (R⁴)_rC (O)-, -CH₂C
H (OR²) CH₂-And mixtures thereof; R¹Is
C₂-C₆Alkylene and mixtures thereof; R²Is hydrogen,-(R¹O) _x B and mixtures thereof; R³Is C₁-C₁₈Alkyl, C₇-C₁₂Ants
Alkyl, C₇-C₁₂Alkyl-substituted aryl, C₆-C₁₂Aryl and its
Mixtures thereof; R⁴Is C₁-C₁₂Alkylene, C₄-C₁₂Alkenylene,
C₈-C₁₂Arylalkylene, C₆-C_TenWith arylene and their mixtures
There; R⁵Is C₁-C₁₂Alkylene, C₃-C₁₂Hydroxyalkylene, C₄-
C₁₂Dihydroxyalkylene, C₈-C₁₂Dialkylarylene, -C (O)-
, -C (O) NHR⁶NHC (O)-, -R¹(OR¹)-, -C (O) (R⁴ )_rC (O)-, -CH₂CH (OH) CH₂-, -CH₂CH (OH) CH₂ O (R¹O)_yR¹-OCH₂CH (OH) CH₂-And their mixtures
R⁶Is C₂-C₁₂Alkylene or C₆-C₁₂Is an arylene; the E unit is
Hydrogen, C₁-C_{twenty two}Alkyl, C₃-C_{twenty two}Alkenyl, C₇-C_{twenty two}Arylalkyl
Le, C₂-C_{twenty two}Hydroxyalkyl,-(CH₂)_pCO₂M,-(CH₂)_q SO₃M, -CH (CH₂CO₂M) CO₂M,-(CH₂)_pPO₃M,-(
R¹O)_xB, -C (O) R³Selected from the group consisting of and mixtures thereof
With the proviso that when any E unit of a nitrogen is hydrogen, the nitrogen is not an N-oxide.
B is hydrogen, C₁-C₆Alkyl,-(CH₂)_qSO₃M,-(CH₂)_p CO₂M,-(CH₂)_q(CHSO₃M) CH₂SO₃M,-(CH₂)_q(
CHSO₂M) -CH₂SO₃M,-(CH₂)_pPO₃M, -PO₃M and
M is hydrogen or a sufficient amount of water to satisfy the charge balance
X is a water-soluble anion; k and k 'are from 1 to about 15
M has a value of 4 to about 400; n has a value of 0 to about 200;
p has a value of 1 to 6; q has a value of 0 to 6; r has a value of 0 or 1
W has a value of 0 or 1; x has a value of 1-100; y is 0-10
Has a value of 0; z has a value of 0 or 1].
3. The laundry detergent composition according to item 1. 5. The method of claim 1 wherein the cotton polyethyleneimine soil release polymer is polyethyleneimine 180.
The laundry according to any one of claims 1 to 4, wherein the laundry is selected from OE7 and its amine oxide derivatives, polyethyleneimine 1200E7 and its oxidized and / or quaternized derivatives, polyethyleneimine 600E20, and / or mixtures thereof. Detergent composition. 6. The composition according to claim 1, further comprising a surfactant, preferably a nonionic surfactant.
The laundry detergent composition according to any one of claims 5 to 10. 7. A nonionic surfactant comprising a C ₈ -C ₂₀ chain, preferably C ₁₂ -C ₁₆ , and 2
The laundry detergent composition according to claim 6, which is an alkyl ethoxylated nonionic surfactant having a degree of ethoxylation of from 9 to 9, preferably from 3 to 7. 8. The laundry according to claim 6, wherein the nonionic surfactant is an alkylmethylglucamide surfactant having an alkyl chain length of C ₈ -C ₂₀ , preferably C ₁₂ -C _16. Detergent composition. 9. Laundry detergent composition according to claim 1, further comprising a builder, preferably a builder selected from zeolite, sodium tripolyphosphate, laminated silicate and / or mixtures thereof. object. 10. A process according to claim 1, further comprising a conventional soil release polymer, preferably an anionic end-capped polyester, diethoxylated polypropylene terephthalate and / or mixtures thereof. Laundry detergent composition. 11. A method for cleaning a fabric with the laundry detergent composition according to claim 1.