CA2300696A1 - Detergent compositions comprising a mannanase and a protease - Google Patents

Detergent compositions comprising a mannanase and a protease Download PDF

Info

Publication number
CA2300696A1
CA2300696A1 CA002300696A CA2300696A CA2300696A1 CA 2300696 A1 CA2300696 A1 CA 2300696A1 CA 002300696 A CA002300696 A CA 002300696A CA 2300696 A CA2300696 A CA 2300696A CA 2300696 A1 CA2300696 A1 CA 2300696A1
Authority
CA
Canada
Prior art keywords
mannanase
alkyl
enzyme
protease
bacillus
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
CA002300696A
Other languages
French (fr)
Inventor
Michael Stanford Showell
Jean-Luc Philippe Bettiol
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Procter and Gamble Co
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Publication of CA2300696A1 publication Critical patent/CA2300696A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/39Organic or inorganic per-compounds
    • C11D3/3942Inorganic per-compounds
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D1/00Detergent compositions based essentially on surface-active compounds; Use of these compounds as a detergent
    • C11D1/38Cationic compounds
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/0005Other compounding ingredients characterised by their effect
    • C11D3/0036Soil deposition preventing compositions; Antiredeposition agents
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/37Polymers
    • C11D3/3703Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds
    • C11D3/3723Polyamines or polyalkyleneimines
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38609Protease or amylase in solid compositions only
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38636Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38645Preparations containing enzymes, e.g. protease or amylase containing cellulase
    • C11D2111/12

Abstract

The present invention relates to detergent compositions comprising a mannanase and a protease enzyme for superior cleaning performance.

Description

CA 02300696 '2000-02-07 DETERGENT COMPOSITIONS COMPRISING A MANNANASE
AND A PROTEASE
Field of the Invention The present invention relates to detergent compositions comprising a mannanase and a protease.
Background of the invention Performance of a detergent product is judged by a number of factors, including the ability to remove soils, and the ability to prevent the redeposition of the soils, or the breakdown products of the soils on the articles in the wash.
Therefore, detergent compositions include nowadays a complex combination of active ingredients which fulfil certain specific needs. In particular, current detergent formulations generally include detergent enzymes providing cleaning and fabric care benefits.
Food and cosmetic stainslsoils represent the majority of consumer relevant 3o stainslsoils and often comprise food additives such as thickener I
stabiliser agents. Indeed, hydrocolloids gums and emulsifiers are commonly used food additives. The term "gum" denotes a group of industrially useful polysaccharides (long chain polymer) or their derivatives that hydrate in hot or cold water to from viscous solutions, dispersions or gels. Gums are classified as natural and modified. Natural gums include seaweed extracts, plant extrudates, gums from seed or root, and gums obtained by microbial fermentation. Modified (semisynthetic) gums include cellulose and starch derivatives and certain synthetic gums such as low methoxyl pectin, propylene glycol alginate, and carboxymethyl and hydropropyl guar gum (Gums in Encyclopedia Chemical Technology 4th Ed. Vol. 12, pp842-862, J. Baird, Kelco division of Merck). See also Carbohydrate Chemistry for Food Scientists (Eagan Press - 1997) by R. L.
Whistler and J.N. BeMiller, Chap 4, pp63-89 and Direct Food Additives in Fruit Processing by P. Laslo, Bioprinciples and Applications, Vol1, Chapter II, pp313-325 (1996) Technomie publishing. Some of these gums such as guar gum (E412), locust bean (E410) are widely used alone or in combinations in many food applications (Gums in ECT 4th Ed., Vol. 12 pp842-862, J. Baird, Kelco division of Merck).
The guar gum used in these food and cosmetic stains is obtained from the seed endosperm of the leguminous plant Cyamopsis tetragonoloba. The guar gum (also called guaran) extracted from the dicotyledonous seed is composed of a 1-~5 4, b-D-mannopyranosyl unit backbone and is used as a thickening agent in dressing and frozen products and cosmetics (H.-D. Belitz, Food Chemistry pp 243, English version of the second edition, Springer-verlag, 1987, ISBN 0-387-15043-9 (US)) & (Carbohydrate Chemistry for Food Scientists, R.L. Wilstler, eagan press, 1997, ISBN 0-913250-92-9) ~ (Industrial Gum, second editions, 2o R.L. Whistler pp 308, Academic Press, 1973, ISBN, 0-12-74-6252-x). The locus bean gum (also called carob bean gum or St Jon's bread) is also used in the food industry and is extracted from the seed of an evergreen cultivated in the Mediterranean area. The locus bean gum probably differs from the structure of guar gum only in smaller number of D-gafactosyl side chains and have the same 25 1-4, b-D-mannopyranosyl backbone. In leguminous seeds, water-soluble galactomanann is the main storage carbohydrate, comprising up to 20% of the total dry weight in some cases. Galactomannan has a a-galactose linked to O-6 of mannose residues and it can also be acetylated to various degree on O-2 and O-3 of the mannose residues.
Protease enzymes have long been recognised in detergent compositions to provide the removal of proteinaceous food residues from dishware, hard surtaces or to provide cleaning performance on proteinaceous soils as well as other soils typically encountered in laundry applications.
*rB
However, there is a continuous need to formulate detergent compositions which provide superior cleaning performance, especially on encrusted stains typically found on garments with an extensive wash/wear history. This objective has been met by formulating detergent compositions comprising a mannanase and a protease.
It has been surprisingly found that these enzymatic compositions provide superior cleaning due to the synergistic effect of the mixed enzyme system, i.e.
superior stain removal, especially on encrusted stain typically found on garments 1o with an extensive wash/wear history.
It has been further found that the performance of the detergent compositions of the present invention is enhanced by the addition of selected surfactants, a builder and/or a bleach system.
Mannanases have been identified in several Bacillus organisms. For example, Talbot et al., Appl. Environ. Microbiol., vol. 56, No. 11, pp. 3505-3510 (1990) describes a (i-mannanase derived from Bacillus stearofhermophilus in dimer form having a MW of 162 kDa and an optimum pH of 5.5-7.5. Mendoza et al., World J.
2o Micobio. Boitech., vol. 10, no. 5, pp. 551-555 (1994) describes a ~i-mannanase derived from Bacillus subtilisis having a MW of 38 kDa, an optimum activity at pH
5.0 / 55°C and a pl of 4.8. J0304706 discloses a ~3-mannanase derived from Bacillus sp. having a MW of 37+I- 3kDa measured by gel ~Itration, an optimum pH of 8-10 and a pl of 5.3-5.4. J63056289 describes the production of an alkaline, thermostable ~i-mannase, which hydrolyses ~i-1,4-D-mannopyranoside bonds of e.g. mannans and produces manno:oligoaaccharides. J63036774 relates to a Bacillus micro-organism FERM P-8856 which produces ~i-mannanase and ~i-mannosidase, at an alkaline pH. A purifred mannanase from Bacillus amyloliquefaciens and its method of preparation useful in the bleaching of pulp and paper, is disclosed in W097111164. W091118974 describes an hemicellulase such as a glucanase, xylanase or mannanase, active at extreme pH and temperature and the production thereof. W09412557fi describes an enzyme exhibiting a mannanase activity derived from Aspergillus aculeatus CBS
101.43, that might be used for various purposes for which degradation or modification of plant or algae cell wall material is desired. W093124622 discloses a mannanase isolated from Trichoderma reesie for bleaching lignocellulosic pulps.
However, the synergistic combination of a mannanase and a protease, for superior cleaning performance in a detergent composition, has never been previously recognised.
Summar~r of the invention The present invention relates to detergent compositions comprising a mannanase and protease for providing superior cleaning performance.
Detailed description of the invention An essential element of the detergent composition of the present invention is a mannanase enzyme. Mannanase will provide significant stain removal benefits on stains that contain hydrocolloid gum such as Guar Gum used as food 2o additives. The second essential element of the present invention is a protease enzyme. Protease is known to remove proteinaceous soils.
Without wishing to be bound by theory, it is believed that protein containing stains such as cocoa food stains, choco pudding stains and/or cosmetic stains may also contain additives such as hydrocolloid gums. These hydrocolloid gums are for example guar gum or Locus bean gum. When such stains are present, it has been found that the use of protease is not efficient enough to provide significant cleaning performance benefits. Similarly, the single use of mannanase is not sufficient to provide significant performance benefits. Indeed, it is believed 3o that the mix of both protein and hydrocolloid gum in the food compositions is very viscous and is less sensitive to enzymatic action.
Especially in the laundry detergent field, it is well-known that stain encrustation's occur on in-use items such as pillowcases, kitchen towels, and T-shirts. It is believed that such stains are difficult to remove because of the presence of gluing proteinaceous material from the skin and of the presence of hydrocolloid WO 99/09x28 PCTlUS98/11996 gums, hemicellulose and derivative materials present on the fabric surface that glue the stains. These hydrocolloid gums, hemicellulose and derivative materials may originate from the fabric or from stains. !t is believed that the mix of both protein and hydrocolloid gum is very viscous, glues onto the fabrics and is 5 therefore less sensitive to the enzymatic actions.
It has been surprisingly found that the combination of a mannanase with a protease, preferentially with subtilisin laundry protease, provides significant cleaning performance benefits.
In addition, the combined use of the mannanase enzyme with the protease enzyme provides superior cleaning, especially of food and cosmetics stains on hard surfaces such as dishware and any other kitchen hard surfaces.
Furthermore, it is known that cotton fabric may contain mannose moities within the cellulose fibers. These mannose moities may glue other stains such as body soils to the cotton fabrics. It has been surprisingly found that the combined use of the mannanase and protease enzymes provide significant cleaning, also on these body soils and especially at low temperature.
The mannanase enzyme An esential element of the detergent compositions of the present invention is a mannanase enzyme.
Encompassed in the present invention are the following three mannans-degrading enzymes : EC 3.2.1.25 : ~3-mannosidase, EC 3.2.1.78 : Endo-1,4-~i-mannosidase, referred therein after as "mannanase" and EC 3.2.1.100 : 1,4-~-3o mannobiosidase (IUPAC Classification- Enzyme nomenclature, 1992 ISBN 0-12-227165-3 Academic Press).
More preferably, the detergent compositions of the present invention comprise a (i-1,4-Mannosidase (E.C. 3.2.1.78) referred to as Mannanase. The term "mannanase" or "galactomannanase" denotes a mannanase enzyme defined according to the art as officially being named mannan endo-1,4-beta-mannosidase and having the alternative names beta-mannanase and endo-1,4-mannanase and catalysing the reaction: random hydrolysis of 1,4-beta-D-mannosidic linkages in mannans, galactomannans, glucomannans, and galactoglucomannans.
in particular, Mannanases (EC 3.2.1.78) constitute a group of polysaccharases which degrade mannans and denote enzymes which are capable of cleaving polyose chains contaning mannose units, i.e. are capable of cleaving glycosidic bonds in mannans, glucomannans, galactomannans and galactogluco-mannans.
~o Mannans are polysaccharides having a backbone composed of ~i-1,4- linked mannose; glucomannans are polysaccharides having a backbone or more or less regularly alternating ~3-1,4 linked mannose and glucose; galactomannans and galactoglucomannans are mannans and glucomannans with a-1,6 linked galactose sidebranches. These compounds may be acetylated.
The degradation of galactomannans and galactoglucomannans is facilitated by full or partial removal of the galactose sidebranches. Further the degradation of the acetylated mannans, glucomannans, galactomannans and galactogfuco-mannans is facilitated by full or partial deacetylation. Acetyl groups can be 2o removed by alkali or by mannan acetylesterases. The oligomers which are released from the mannanases or by a combination of mannanases and a-galactosidase andlor mannan acetyl esterases can be further degraded to release free maltose by ~3-mannosidase and/or (i-glucosidase.
Mannanases have been identified in several Bacillus organisms. For example, Talbot et al., Appl. Environ. Microbiol., Vo1.56, No. 11, pp. 3505-3510 (1990) describes a beta-mannanase derived from Bacillus stearothermophilus in dimer form having molecular weight of 162 kDa and an optimum pH of 5.5-7.5.
Mendoza et al., World J. Microbiol. Biotech., Vol. 10, No. 5, pp. 551-555 (1994) 3o describes a beta-mannanase derived from Bacillus subtilis having a molecular weight of 38 kDa, an optimum activity at pH 5.0 and 55C and a pl of 4.8. JP-0304706 discloses a beta-mannanase derived from Bacillus sp., having a molecular weight of 373 kDa measured by gel filtration, an optimum pH of 8-10 and a pl of 5.3-5.4. JP-63056289 describes the production of an alkaline, s5 thermostable beta-mannanase which hydrolyses beta-1,4-D-mannopyranoside bonds of e.g. mannans and produces manno-oligosaccharides. JP-63036774 relates to the Bacillus microorganism FERM P-8856 which produces beta-mannanse and beta-mannosidase at an alkaline pH. JP-08051975 discloses alkaline beta-mannanases from alkalophilic Bacillus sp. AM-001. A purified mannanase from Bacillus amyloliquefaciens useful in the bleaching of pulp and paper and a method of preparation thereof is disclosed in WO 97/11164. WO
91118974 describes a hemicellulase such as a glucanase, xylanase or mannanase active at an extreme pH and temperature. WO 94/25576 discloses an enzyme from Aspergilius aculeatus, CBS 101.43, exhibiting mannanase activity which may be useful for degradation or modification of plant or algae cell 1o wall material. WO 93124622 discloses a mannanase isolated from Trichoderma reseei useful for bleaching lignocellulosic pulps. An hemicellulase capable of degrading mannan-containing hemicellulose is described in W091/18974 and a purified mannanase from Bacillus amyloliquefaciens is described in W097111164.
!n particular, this mannanase enzyme will be an alkaline mannanase as defined below, most preferably, a mannanase originating from a bacterial source.
Especially, the detergent composition of the present invention will comprise an alkaline mannanase selected from the mannanase from the strain Bacillus 2o agaradherens andlor Bacillus subtilises strain 168, gene yght.
The term "alkaline mannanase enzyme" is meant to encompass enzyme having an enzymatic activity of at least 10%, preferably at least 25%, more preferably at least 40% of its maximum activity at a given pH ranging from 7 to 12, preferably 7.5 to 10.5.
Most preferably, the (detergent composition of the present invention will comprise the alkaline mannanase from Bacillus agaradherens. Said mannanase is i) a polypeptide produced by Bacillus agaradherens, NCIMB 40482, or 3o ii) a polypeptide comprising an amino acid sequence as shown in positions 32-343 of SEQ ID N0:2 or iii) an analogue of the polypeptide defined in i) or ii) which is at feast 70%
homologous with said polypeptide, or is derived from said polypeptide by substitution, deletion or addition of one or several amino acids, or is immunoiogically reactive with a polyclonal antibody raised against said polypeptide in purified form.
The present invention also encompasses an isolated polypeptide having mannanase activity selected from the group consisting of (a) polynucleotide molecules encoding a polypeptide having mannanase activity and comprising a sequence of nucleotides as shown in SEQ ID NO:
1 from nucleotide 97 to nucleotide 1029;
(b) species homologs of (a);
(c) poiynucleotide molecules that encode a polypeptide having mannanase activity that is at least 70% identical to the amino acid sequence of SEQ ID
~o NO: 2 from amino acid residue 32 to amino acid residue 343;
(d) molecules complementary to (a), (b) or (c); and (e) degenerate nucleotide sequences of (a), (b), (c) or (d).
The plasmid pSJ1678 comprising the polynucleotide molecule (the DNA
~5 sequence) encoding a mannanase of the present invention has been transformed into a strain of the Escherichia coli which was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH, 2o Mascheroder Weg 1 b, D-38124 Braunschweig, Federal Republic of Germany, on 18 May 1998 under the deposition number DSM 12180.
A second most preferred enzyme is the mannanase from the Bacillus subtilisis strain 168, which mannanase:
25 i) is encoded by the coding part of the DNA sequence shown in SED ID No. 5 or an analogue of said sequence andlor ii) a polypeptide comprising an amino acid sequence as shown SEQ ID N0:6 or an analogue of the polypeptide defined in ii) which is at least 70%
3o homologous with said polypeptide, or is derived from said poiypeptide by substitution, deletion or addition of one or several amino acids, or is immunologically reactive with a polyclonal antibody raised against said polypeptide in purified form.
35 The present invention also encompasses an isolated polypeptide having mannanase activity selected from the group consisting of (a) polynucleotide molecules encoding a polypeptide having mannanase activity and comprising a sequence of nucleotides as shown in SEQ iD
N0:5 (b) species homologs of (a);
(c) polynucleotide molecules that encode a polypeptide having mannanase activity that is at least 70% identical to the amino acid sequence of SEQ ID
NO: 6;
(d) molecules complementary to (a), (b) or (c); and (e) degenerate nucleotide sequences of {a), {b), (c) or (d).
DEFINITIONS
Prior to discussing this invention in further detail, the following terms will first be defined The term "ortholog" (or "species homolog") denotes a polypeptide or protein obtained from one species that has homology to an analogous poiypeptide or protein from a different species.
The term "paralog" denotes a polypeptide or protein obtained from a given species that has homology to a distinct polypeptide or protein from that same 2o species.
The term "expression vector" denotes a DNA molecule, linear or circular, that comprises a segment encoding a polypeptide of interest operably linked to additional segments that provide for its transcription. Such additional segments may include promoter and terminator sequences, and may optionally include one 2s or more origins of replication, one or more selectable markers, an enhancer, a polyadenylation signal, and the like. Expression vectors are generally derived from plasmid or viral DNA, or may contain elements of both. The expression vector of the invention may be any expression vector that is conveniently subjected to recombinant DNA procedures, and the choice of vector will often 3o depend on the host cell into which the vector it is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e. a vector which exists as an extra chromosomal entity, the replication of which is independent of chromosomal replication, e.g. a plasmid. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome 35 and replicated together with the chromosame(s) into which it has been integrated.

The term "recombinant expressed" or "recombinantly expressed" used herein in connection with expression of a polypeptide or protein is defined according to the standard definition in the art. Recombinantly expression of a protein is generally performed by using an expression vector as described immediately 5 above.
The term "isolated", when applied to a polynucleotide molecule, denotes that the polynucleotide has been removed from its natural genetic milieu and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and include cDNA and genomic clones. Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, but may include naturally occurring 5' and 3' untranslated regions such as promoters and terminators. The identification of associated regions will be evident to one of ~5 ordinary skill in the art (see for example, Dynan and Tijan, Nature 316:774-78, 1985).
The term "an isolated polynucleotide" may alternatively be termed "a cloned polynucleotide". When applied to a proteinlpolypeptide, the term "isolated"
indicates that the protein is found in a condition other than its native environment.
2o In a preferred form, the isolated protein is substantially free of other proteins, particularly other homologous proteins (i.e., "homologous impurities" (see below)). It is preferred to provide the protein in a greater than 40% pure form, more preferably greater than 60% pure form. Even more preferably it is preferred to provide the protein in a highly purified form, i.e., greater than 80%
25 pure, more preferably greater than 95% pure, and even more preferably greater than 99% pure, as determined by SDS-PAGE.
The term "isolated proteinlpolypeptide may alternatively be termed "purified protein/polypeptide".
The term "homologous impurities" means any impurity (e.g. another 3o polypeptide than the polypeptide of the invention} which originate from the homologous cell where the polypeptide of the invention is originally obtained from.
The term "obtained from" as used herein in connection with a specific microbial source, means that the polynucleotide andlor polypeptide produced by the 35 specific source, or by a cell in which a gene from the source have been inserted.

The term "operably linked", when referring to DNA segments, denotes that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in the promoter and proceeds through the coding segment to the terminator.
The term "polynucleotide" denotes a single- or double- stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end.
Polynucleotides include RNA and DNA, and may be isolated from natural sources, synthesized in vitro, or prepared from a combination of natural and synthetic molecules.
The term "complements of polynucleotide molecules" denotes polynucleotide molecules having a complementary base sequence and reverse orientation as compared to a reference sequence. For example, the sequence 5' ATGCACGGG 3' is complementary to 5' CCCGTGCAT 3'.
The term "degenerate nucleotide sequence" denotes a sequence of ~5 nucleotides that includes one or more degenerate codons (as compared to a reference polynucleotide molecule that encodes a polypeptide). Degenerate codons contain different triplets of nucleotides, but encode the same amino acid residue (i.e., GAU and GAC
triplets each encode Asp).
2o The term "promoter" denotes a portion of a gene containing DNA sequences that provide for the binding of RNA polymerase and initiation of transcription.
Promoter sequences are commonly, but not always, found in the 5' non-coding regions of genes.
The term "secretory signal sequence" denotes a DNA sequence that encodes a 25 polypeptide (a "secretory peptide") that, as a component of a larger polypeptide, directs the larger polypeptide through a secretory pathway of a cell in which it is synthesized. The larger peptide is commonly cleaved to remove the secretory peptide during transit through the secretory pathway.
3o HOW TO USE A SEQUENCE OF THE INVENTION TO GET OTHER RELATED
SEQUENCES:
The disclosed sequence information herein relating to a polynucleotide sequence encoding a mannanase of the invention can be used as a tool to identify other homologous mannanases. For instance, polymerase chain reaction (PCR) can 35 be used to amplify sequences encoding other homologous mannanases from a variety of microbial sources, in particular of different Bacillus species.

ASSAY FOR ACTIVITY TEST
A polypeptide of the invention having mannanase activity may be tested for mannanase activity according to standard test procedures known in the art, such as by applying a solution to be tested to 4 mm diameter holes punched out in agar plates containing 0.2% AZCL galactomannan (carob), i.e. substrate for the assay of endo-1,4-beta-D-mannanase available as CatNo.l- AZGMA from the company Megazyme for US$110.00 per 3 grams (Megazyme's Internet address:
http:I/www.megazyme.com/Purchase/index.html).
POLYNUCLEOTIDES:
An isolated polynucleotide of the invention will hybridize to similar sized regions of SEQ iD No. 1, or a sequence complementary thereto, under at least medium stringency conditions.
In particular polynucleotides of the invention will hybridize to a denatured doubie-stranded DNA probe comprising either the full sequence shown in positions 97-1029 of SEQ ID N0:1 or any probe comprising a subsequence of SEQ ID N0:1 having a length of at least about 100 base pairs under at least medium 2o stringency conditions, but preferably at high stringency conditions as described in detail below. Suitable experimental conditions for determining hybridization at medium, or high stringency between a nucleotide probe and a homologous DNA
or RNA sequence involves presoaking of the filter containing the DNA fragments or RNA to hybridize in 5 x SSC (Sodium chloridelSodium citrate, Sambrook et al.
1989) for 10 min, and prehybridization of the filter in a solution of 5 x SSC, 5 x Denhardt's solution (Sambrook et al. 1989), 0.5 % SDS and 100 Nglml of denatured sonicated salmon sperm DNA (Sambrook et al. 1989), followed by hybridization in the same solution containing a concentration of 10ng/ml of a random-primed (Feinberg, A. P. and Vogelstein, B. (1983) Anal. Biochem. 132:6-13), 32P-dCTP-labeled (specific activity higher than 1 x 109 cpmlNg ) probe for 12 hours at ca. 45°C. The filter is then washed twice for 30 minutes in 2 x SSC, 0.5 % SDS at least 60°C (medium stringency), still more preferably at least 65°C
(medium/high stringency), even more preferably at least 70°C (high stringency), and even more preferably at least 75°C (very high stringency).
Molecules to which the oligonucleotide probe hybridizes under these conditions are detected using a x-ray film.

As previously noted, the isolated polynucleotides of the present invention include DNA and RNA. Methods for isolating DNA and RNA are well-known in the art.
DNA and RNA encoding genes of interest can be cloned in Gene Banks or DNA
libraries by means of methods known in the art.
Polynucleotides encoding polypeptides having mannanase activity of the invention are then identified and isolated by, for example, hybridization or PCR.
The present invention further provides counterpart polypeptides and polynucleotides from different bacterial strains (orthologs or paralogs). Of particular interest are mannanase poiypeptides from gram-positive alkalophilic strains, including species of Bacillus.
Species homologues of a polypeptide with mannanase activity of the invention can be cloned using information and compositions provided by the present invention in combination with conventional cloning techniques. For example, a DNA sequence of the present invention can be cloned using chromosomal DNA
~5 obtained from a cell type that expresses the protein. Suitable sources of DNA
can be identified by probing Northern blots with probes designed from the sequences disclosed herein. A library is then prepared from chromosomal DNA
of a positive cell line. A DNA sequence of the invention encoding an polypeptide having mannanase activity can then be isolated by a variety of methods, such as 2o by probing with probes designed from the sequences disclosed in the present specification and claims or with one or more sets of degenerate probes based on the disclosed sequences. A DNA sequence of the invention can also be cloned using the polymerase chain reaction, or PCR (Mullis, U.S. Patent 4,683,202), using primers designed from the sequences disclosed herein. Within an 25 additional method, the DNA library can be used to transform or transfect host cells, and expression of the DNA of interest can be detected with an antibody (mono-clonal or polyclonal) raised against the mannanase cloned from B.agaradherens, NCIMB 40482, expressed and purified as described in Materials and Methods and Example 1, or by an activity test relating to a polypeptide 3o having mannanase activity.
The mannanase encoding part of the DNA sequence cloned into plasmid pSJ1678 present in Escherichia coli DSM 12180 andlor an analogue DNA
sequence of the invention may be cloned from a strain of the bacterial species Bacillus agaradherens, preferably the strain NCIMB 40482, producing the 35 enzyme with mannan degrading activity, or another or related organism as described herein.

Alternatively, the analogous sequence may be constructed on the basis of the DNA sequence obtainable from the plasmid present in Escherichia coli DSM
12180 (which is believed to be identical to the attached SEQ ID N0:1), e.g be a sub-sequence thereof, andlor by introduction of nucleotide substitutions which do not give rise to another amino acid sequence of the mannanase encoded by the DNA sequence, but which corresponds to the codon usage of the host organism intended for production of the enzyme, or by introduction of nucleotide substitutions which may give rise to a different amino acid sequence (i.e. a variant of the mannan degrading enzyme of the invention).
POLYPEPTlDES:
The sequence of amino acids nos. 32-343 of SEQ ID NO: 2 is a mature mannanase sequence.
The present invention also provides mannanase polypeptides that are substantially homologous to the polypeptide of SEQ ID N0:2 and species homologs (parafogs or orthologs) thereof. The term "substantially homologous"
is used herein to denote polypeptides having 70%, preferably at least 80%, more preferably at least 85%, and even more preferably at least 90%, sequence identity to the sequence shown in amino acids nos. 32-343 of SEQ ID N0:2 or 2o their orthologs or paralogs. Such po(ypeptides will more preferably be at least 95% identical, and most preferably 98% or more identical to the sequence shown in amino acids nos. 32-343 of SEQ ID N0:2 or its orthologs or paralogs.
Percent sequence identity is determined by conventional methods, by means of computer programs known in the art such as GAP provided in the GCG program package z5 (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) as disclosed in Needleman, S.B. and Wunsch, C.D., (1970), Journal of Molecular Biology, 48, 443-453, which is hereby incorporated by reference in its entirety.
GAP is used with the following settings for polypeptide sequence comparison:
3o GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
Sequence identity of polynucleotide molecules is determined by similar methods using GAP with the following settings for DNA sequence comparison: GAP
creation penalty of 5.0 and GAP extension penalty of 0.3.
The enzyme preparation of the invention is preferably derived from a microorganism, preferably from a bacterium, an archea or a fungus, especially from a bacterium such as a bacterium belonging to Bacillus, preferably to an alkalophilic Bacillus strain which may be selected from the group consisting of the species Bacillus agaradherens and highly related Bacillus species in which all species preferably are at least 95%, even more preferably at least 98%, homologous to Bacillus agaradherens based on aligned 16S rDNA sequences.
Substantially homologous proteins and polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably of a minor nature, that is conservative amino acid substitutions (see Table 2) and other substitutions that do not significantly affect the folding or 5 activity of the protein or polypeptide; small deletions, typically of one to about 30 amino acids; and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or a small extension that facilitates purification (an affinity tag), such as a poly-histidine tract, protein A (Nilsson et al., EMBO J. 4:1075, 1985;
Nilsson et ~o al., Methods Enzymol 198:3, 1991. See, in general Ford et al., Protein Expression and Purification 2: 95-107, 1991, which is incorporated herein by reference. DNAs encoding affinity tags are available from commercial suppliers (e.g., Pharmacia Biotech, Piscataway, NJ; New England Biolabs, Beverly, MA).
However, even though the changes described above preferably are of a minor ~5 nature, such changes may also be of a larger nature such as fusion of larger polypeptides of up to 300 amino acids or more both as amino- or carboxyl-terminal extensions to a Mannanase polypeptide of the invention.
Table 1 2o Conservative amino acid substitutions Basic : arginine, lysine, histidine Acidic : glutamic acid, aspartic acid Polar : glutamine, asparagine Hydrophobic : leucine, isoleucine, valine Aromatic : phenylalanine, tryptophan, tyrosine Small : glycine, alanine, serine, threonine, methionine fn addition to the 20 standard amino acids, non-standard amino acids (such as hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isavaline and a-methyl serine) may be substituted for amino acid residues of a polypeptide according to the invention. A limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be substituted for amino acid residues. "Unnatural amino acids" have been modified after protein synthesis, and/or have a chemical structure in their side chains) different from that of the standard amino acids. Unnatural amino acids can be chemically synthesized, or preferably, are commercially available, and include pipecolic acid, thiazolidine carboxylic acid, dehydroproline, 3- and 4-methylproline, and 3,3-dimethylproline.
Essential amino acids in the mannanase polypeptides of the present invention can be identified according to procedures known in the art, such as site-directed ~o mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244: 1081-1085, 1989). In the latter technique, single alanine mutations are introduced at every residue in the molecule, and the resultant mutant molecules are tested for biological activity (i.e mannanase activity) to identify amino acid residues that are critical to the activity of the molecule. See also, Hilton et al., J.
Biol. Chem. 271:4699-4708, 1996. The active site of the enzyme or other biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction or photoaffinity labeling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., Science 20 255:306-312, 1992; Smith et al., J. Mol. Biol. 224:899-904, 1992; Wlodaver et al., FEBS Lett. 309:59-64, 1992. The identities of essential amino acids can also be inferred from analysis of homologies with polypeptides which are related to a polypeptide according to the invention.
Multiple amino acid substitutions can be made and tested using known methods 25 of mutagenesis, recombination and/or shuffling followed by a relevant screening procedure, such as those disclosed by Reidhaar-Olson and Sauer (Science 241:53-57, 1988), Bowie and Sauer (Proc. Natl. Acad. Sci. USA 86:2152-2156, 1989), W095/17413, or WO 95/22625. Briefly, these authors disclose methods for simultaneously randomizing two or more positions in a polypeptide, or 3o recombinationlshuffling of different mutations (W095/17413, W095122625), followed by selecting for functional a polypeptide, and then sequencing the mutagenized polypeptides to determine the spectrum of allowable substitutions at each position. Other methods that can be used include phage display (e.g., Lowman et al., Biochem. 30:10832-10837, 1991; Ladner et al., U.S. Patent No.
35 5,223,409; Huse, WIPO Publication WO 92106204) and region-directed mutagenesis (Derbyshire et al., Gene 46:145, 1986; Ner et al., DNA 7:127, 1988).
Mutagenesislshuffling methods as disclosed above can be combined with high throughput, automated screening methods to detect activity of cloned, s mutagenized polypeptides in host cells. Mutagenized DNA molecules that encode active polypeptides can be recovered from the host cells and rapidly sequenced using modern equipment. These methods allow the rapid determination of the importance of individual amino acid residues in a polypeptide of interest, and can be applied to pofypeptides of unknown structure.
Using the methods discussed above, one of ordinary skill in the art can identify andlor prepare a variety of polypeptides that are substantially homologous to residues 32 to 343 of SEQ ID NO: 2 and retain the mannanase activity of the wild-type protein.
15 PROTEIN PRODUCTION:
The proteins and polypeptides of the present invention, including full-length proteins, fragments thereof and fusion proteins, can be produced in genetically engineered host cells according to conventional techniques. Suitable host cells are those cell types that can be transformed or transfected with exogenous DNA
20 and grown in culture, and include bacteria, fungal cells, and cultured higher eukaryotic cells. Bacterial cells, particularly cultured cells of gram-positive organisms, are preferred. Gram-positive cells from the genus of Bacillus are especially preferred, such as from the group consisting of Bacillus subtilis, Bacillus lentus, Bacillus brevis, Bacillus stearothermophilus, Bacillus alkalophilus, 25 Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus circulans, Bacillus lautus, Bacillus thuringiensis, Bacillus licheniformis, and Bacillus agaradherens, in particular Bacillus agaradherens.
Techniques for manipulating cloned DNA molecules and introducing exogenous DNA into a variety of host cells are disclosed by Sambrook et al., Molecular 3o Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; Ausubel et al. (eds.), Current Protocols in Molecular Bioloay, John Wiley and Sons, Inc., NY, 1987; and "Bacillus subtilis and Other Gram-Positive Bacteria", Sonensheim et al., 1993, American Society for Microbiology, Washington D.C., which are incorporated herein by reference.
35 In general, a DNA sequence encoding a mannanase of the present invention is operably linked to other genetic elements required for its expression, generally including a transcription promoter and terminator within an expression vector.
The vector will also commonly contain one or more selectable markers and one or more origins of replication, although those skilled in the art will recognize that within certain systems selectable markers may be provided on separate vectors, and replication of the exogenous DNA may be provided by integration into the host cell genome. Selection of promoters, terminators, selectable markers, vectors and other elements is a matter of routine design within the level of ordinary skill in the art. Many such elements are described in the literature and are available through commercial suppliers.
To direct a polypeptide into the secretory pathway of a host cell, a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is provided in the expression vector. The secretory signal sequence may be that of the polypeptide, or may be derived from another secreted protein or synthesized de novo. Numerous suitable secretory signal sequences are known in the art and reference is made to "Bacillus subtilis and Other Gram-Positive Bacteria", Sonensheim et al., 1993, American Society for Microbiology, Washington D.C.; and Cutting, S. M.(eds.) "Molecular Biological Methods for Bacillus", John Wiley and Sons, 1990, for further description of suitable secretory signal sequences especially for secretion in a Bacillus host cell. The secretory 2o signal sequence is joined to the DNA sequence in the correct reading frame.
Secretory signal sequences are commonly positioned 5' to the DNA sequence encoding the polypeptide of interest, although certain signal sequences may be positioned elsewhere in the DNA sequence of interest (see, e.g., Welch et al., U.S. Patent No. 5,037,743; Holland et al., U.S. Patent No. 5,143,830).
Transformed or transfected host cells are cultured according to conventional procedures in a culture medium containing nutrients and other components required for the growth of the chosen host cells. A variety of suitable media, including defined media and complex media, are known in the art and generally include a carbon source, a nitrogen source, essential amino acids, vitamins and 3o minerals. Media may also contain such components as growth factors or serum, as required. The growth medium will generally select for cells containing the exogenously added DNA by, for example, drug selection or deficiency in an essential nutrient which is complemented by the selectable marker carried on the expression vector or co-transfected into the host cell.
PROTEIN ISOLATION:

When the expressed recombinant polypeptide is secreted the polypeptide may be purified from the growth media. Preferably the expression host cells are removed from the media before purification of the polypeptide (e.g. by centrifugation).
When the expressed recombinant polypeptide is not secreted from the host cell, the host cell are preferably disrupted and the polypeptide released into an aqueous "extract" which is the first stage of such purification techniques.
Preferably the expression host cells are collected from the media before the cell disruption (e.g. by centrifugation).
1o The cell disruption may be performed by conventional techniques such as by lysozyme digestion or by forcing the cells through high pressure. See (Robert K.
Scobes, Protein Purification, Second edition, Springer-Verlag) for further description of such cell disruption techniques.
Whether or not the expressed recombinant poiypeptides (or chimeric ~5 polypeptides) is secreted or not it can be purified using fractionation and/or conventional purification methods and media.
Ammonium sulfate precipitation and acid or chaotrope extraction may be used for fractionation of samples. Exemplary purification steps may include hydroxyapatite, size exclusion, FPLC and reverse-phase high performance liquid 2o chromatography. Suitable anion exchange media include derivatized dextrans, agarose, cellulose, polyacrylamide, specialty silicas, and the like. PEI, DEAE, QAE and Q derivatives are preferred, with DEAE Fast-Flow Sepharose (Pharmacia, Piscataway, NJ) being particularly preferred. Exemplary chromatographic media include those media derivatized with phenyl, butyl, or 25 octyl groups, such as Phenyl-Sepharose FF (Pharmacia), Toyopearl butyl 650 (Toso Haas, Montgomeryville, PA), Octyl-Sepharose (Pharmacia) and the like; or polyacrylic resins, such as Amberchrom CG 71 (Toro Haas) and the like.
Suitable solid supports include glass beads, silica-based resins, cellulosic resins, agarose beads, cross-linked agarose beads, polystyrene beads, cross-linked 3o polyacrylamide resins and the like that are insoluble under the conditions in which they are to be used. These supports may be modified with reactive groups that allow attachment of proteins by amino groups, carboxyl groups, sulfhydryl groups, hydroxyl groups andlor carbohydrate moieties. Examples of coupling chemistries include cyanogen bromide activation, N-hydroxysuccinimide 35 activation, epoxide activation, sulfhydryl activation, hydrazide activation, and carboxyl and amino derivatives for carbodiimide coupling chemistries. These and other solid media are well-known and widely used in the art, and are available from commercial suppliers.
Selection of a particular method is a matter of routine design and is determined in part by the properties of the chosen support. See, for example, Aft'initv 5 Chromatoaraphy~ Principles & Methods, Pharmacia LKB Biotechnology, Uppsala, Sweden, 1988.
Polypeptides of the invention or fragments thereof may also be prepared through chemical synthesis. Polypeptides of the invention may be monomers or multimers; glycosylated or non-glycosylated; pegylated or non-pegylated; and may or may not include an initial methionine amino acid residue.
Based on the sequence information disclosed herein a full length DNA
sequence encoding a mannanase of the invention and comprising the DNA
sequence shown in SEQ ID No 1, at least the DNA sequence from position 97 ~5 to position 1029, may be cloned.
Cloning is performed by standard procedures known in the art such as by, t preparing a genomic library from a Bacillus strain, especially the strain B.
agaradherens, NCIMB 40482;
~ plating such a library on suitable substrate plates;
20 ~ identifying a clone comprising a polynucleotide sequence of the invention by standard hybridization techniques using a probe based on SEQ ID No 1; or by t identifying a clone from said Bacillus agaradherens NCIMB 40482 genomic library by an Inverse PCR strategy using primers based on sequence information from SEQ ID No 1. Reference is made to M.J. MCPherson et al.
("PCR A practical approach" Information Press Ltd, Oxford England) for further details relating to Inverse PCR.
Based on the sequence information disclosed herein (SEQ ID No 1, SEQ ID No 2) is it routine work for a person skilled in the art to isolate homologous polynucleotide sequences encoding homologous mannanase of the invention 3o by a similar strategy using genomic libraries from related microbial organisms, in particular from genomic libraries from other strains of the genus Bacillus such as alkalophilic species of Bacillus.
Alternatively, the DNA encoding the mannan or galactomannan-degrading enzyme of the invention may, in accordance with well-known procedures, conveniently be cloned from a suitable source, such as any of the above mentioned organisms, by use of synthetic oligonucleotide probes prepared on *rB

the basis of the DNA sequence obtainable from the plasmid present in Escherichia coli DSM 12180.
Accordingly, the polynucleotide molecule of the invention may be isolated from Escherichia coli, DSM 12180, in which the plasmid obtained by cloning such as described above is deposited. Also, the present invention relates to an isolated substantially pure biological culture of the strain Escherichia coli, DSM
12180.
In the present context, the term "enzyme preparation" is intended to mean either a conventional enzymatic fermentation product, possibly isolated and purified, from a single species of a microorganism, such preparation usually comprising a number of different enzymatic activities; or a mixture of monocomponent enzymes, preferably enzymes derived from bacterial or fungal species by using conventional recombinant techniques, which enzymes have been fermented and possibly isolated and purified separately and which may originate from different species, preferably fungal or bacterial species; or the fermentation product of a microorganism which acts as a host cell for expression of a recombinant mannanase, but which microorganism simultaneously produces other enzymes, e.g. pectin degrading enzymes, proteases, or cellulases, being naturally occurring fermentation products of the microorganism, i.e. the enzyme complex ~5 conventionally produced by the corresponding naturally occurring microorganism.
A method of producing the enzyme preparation of the invention, the method comprising culturing a microorganism, eg a wild-type strain, capable of producing the mannanase under conditions permitting the production of the enzyme, and 2o recovering the enzyme from the culture. Culturing may be carried out using conventional fermentation techniques, e.g. culturing in shake flasks or fermentors with agitation to ensure sufficient aeration on a growth medium inducing production of the mannanase enzyme. The growth medium may contain a conventional N-source such as peptone, yeast extract or casamino acids, a 25 reduced amount of a conventional C-source such as dextrose or sucrose, and an inducer such as guar gum or locust bean gum. The recovery may be carried out using conventional techniques, e.g. separation of bio-mass and supernatant by centrifugation or filtration, recovery of the supernatant or disruption of cells if the enzyme of interest is intracellular, perhaps followed by further purification as 3o described in EP 0 406 314 or by crystallization as described in WO
97/15660.
IMMUNOLOGICAL CROSS-REACTIVITY:
*rB

WO 99/09128 PCT/iJS98/11996 Polyclonal antibodies to be used in determining immunological cross-reactivity may be prepared by use of a purified mannanase enzyme. More specifically, antiserum against the mannanase of the invention may be raised by immunizing rabbits (or other rodents) according to the procedure described by N. Axelsen et al. in: A Manual of Quantitative Immunoelectrophoresis, Blackwell Scientific Publications, 1973, Chapter 23, or A. Johnstone and R. Thorpe, Immunochemistry in Practice, Blackwell Scientific Publications, 1982 (more specifically p. 27-31). Purified immunoglobulins may be obtained from the antisera, for example by salt precipitation ((NH4)2 SOq), followed by dialysis and ~o ion exchange chromatography, e.g. on DEAE-Sephadex. Immunochemical characterization of proteins may be done either by Outcherlony double-diffusion analysis (O. Ouchterlony in: Handbook of Experimental Immunology (D.M. Weir, Ed.), Blackwell Scientific Publications, 1967, pp. 655-706), by crossed immunoelectrophoresis (N. Axelsen et al., supra, Chapters 3 and 4), or by rocket immunoelectrophoresis (N. Axelsen et al., Chapter 2).
Examples of useful bacteria producing the enzyme or the enzyme preparation of the invention are Gram positive bacteria, preferably from the BacilluslLactobacillus subdivision, preferably a strain from the genus Bacillus, 2o more preferably a strain of Bacillus agaradherens, especially the strain Bacillus agaradherens, NCIMB 40482.
The present invention includes an isolated mannanase having the properties described above and which is free from homologous impurities, and is produced using conventional recombinant techniques.
DETERMINATION OF CATALYTIC ACTIVITY (ManU) OF MANNANASE
Colorimetric Assay:Substrate:0.2% AZCL-Galactomannan (Megazyme, Australia) from carob in 0.1 M Glycin buffer, pH10Ø The assay is carried out in an Eppendorf Micro tube 1.5 ml on a thermomixer with stirring and temperature 3o control of 40°C. Incubation of 0.750 ml substrate with 0.05 ml enzyme for 20 min, stop by centrifugation for 4 minutes at 15000 rpm. The color of the supernatant is measured at 600 nm in a 1 cm cuvette. One ManU (Mannanase units) gives 0.24 abs in 1 cm.
OBTENTION OF THE BACILLUS AGARADHERENS MANNANASE NCIMB

WO 99/09128 PCTlUS98/I1996 Strains Bacillus agaradherens NCIMB 40482 comprises the mannanase enzyme encoding DNA sequence.
E. toll strain: Cells of E. coli SJ2 (Diderichsen, B., Wedsted, U., Hedegaard, L., s Jensen, B. R., Sj~eholm, C. (1990} Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis. J. Bacteriol., 172, 4315-4321 ), were prepared for and transformed by electroporation using a Gene PuIserTM electroporator from BIO-RAD as described by the supplier.
B.subtilis PL2306. This strain is the B.subtilis DN1885 with disrupted apr and npr genes (Diderichsen, B., Wedsted, U., Hedegaard, L., Jensen, B. R., Sjroholm, C.
(1990) Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis. J. Bacteriol., 172, 4315-4321 ) disrupted in the transcriptional unit of the known Bacillus subtilis cellulase gene, resulting in celiulase negative cells. The disruption was performed essentially as described in 15 ( Eds. A.L. Sonenshein, J.A. Hoch and Richard Losick (1993) Bacillus subtilis and other Gram-Positive Bacteria, American Society for microbiology, p.618).
Competent cells were prepared and transformed as described by Yasbin, R.E., Wilson, G.A. and Young, F.E. (1975) Transformation and transfection in lysogenic strains of Bacillus subtilis: evidence for selective induction of prophage in 2o competent cells. J. Bacteriol, 121:296-304.
Piasmids pSJ1678 (as described in detail in WO 94/19454 which is hereby incorporated by reference in its entirety).
2s pMOL944: This plasmid is a pUB110 derivative essentially containing elements making the plasmid propagatable in Bacillus subtilis, kanamycin resistance gene and having a strong promoter and signal peptide cloned from the amyl gene of B.licheniformis ATCC14580. The signal peptide contains a Sacll site making it convenient to clone the DNA encoding the mature part of a protein in-fusion with 3o the signal peptide. This results in the expression of a Pre-protein which is directed towards the exterior of the cell.
The plasmid was constructed by means of conventional genetic engineering techniques which are briefly described in the following.
Construction of pMOL944:
*rB

The pUB110 plasmid (McKenzie, T. et al., 1986, Plasmid 15:93-103) was digested with the unique restriction enzyme Ncil. A PCR fragment amplified from the amyl promoter encoded on the piasmid pDN1981 (P.L. Jr~rgensen et al.,1990, Gene, 96, p37-41.) was digested with Ncil and inserted in the Ncil digested pUB110 to give the plasmid pSJ2624.
The two PCR primers used have the following sequences:
# LWN5494 5'-GTCGCCGGGGCGGCCGCTATCAATTGGTAACTGTATCTCAGC -3' # LWN5495 5'-~o GTCGCCCGGGAGCTCTGATCAGGTACCAAGCTTGTCGACCTGCAGAA
TGAGGCAGCAAGAAGAT-3' The primer #LWN5494 inserts a Notl site in the plasmid.
The plasmid pSJ2624 was then digested with Sacl and Notl and a new PCR
~5 fragment amplified on amyl promoter encoded on the pDN1981 was digested with Sacl and Notl and this DNA fragment was inserted in the Sacl-Notl digested pSJ2624 to give the plasmid pSJ2670.
This cloning replaces the first amyl promoter cloning with the same promoter but in the opposite direction. The two primers used for PCR amplification have the 2o following sequences:
#LWN5938 5'-GTCGGCGGCCGCTGATCACGTACCAAGCTTGTCGACCTGCAGAATG
AGGCAGCAAGAAGAT-3' 25 #LWN5939 5'-GTCGGAGCTCTATCAATTGGTAACTGTATCTCAGC -3' The plasmid pSJ2670 was digested with the restriction enzymes Pstl and Bcll and a PCR fragment amplified from a cloned DNA sequence encoding the alkaline amylase SP722 (disclosed in the International Patent Application 3o published as W095/26397 which is hereby incorporated by reference in its entirety) was digested with Pstl and Bcll and inserted to give the plasmid pMOL944. The two primers used for PCR amplification have the following sequence:
#LWN7864 5' -AACAGCTGATCACGACTGATCTTTTAGCTTGGCAC-3' 35 #LWN7901 5' -AACTGCAGCCGCGGCACATCATAATGGGACAAATGGG -3' The primer #LWN7901 inserts a Sacll site in the plasmid.

Cloning of the mannanase gene from Bacillus a~raradherens Genomic DNA preparation:
Strain Bacillus agaradherens NCIMB 40482 was propagated in liquid medium as described in W094/01532. After 16 hours incubation at 30°C and 300 rpm, the cells were harvested, and genomic DNA isolated by the method described by Pitcher et al. (Pitcher, D. G., Saunders, N. A., Owen, R. J. (1989). Rapid extraction of bacterial genomic DNA with guanidium thiocyanate. Lett. Appl.
Microbiol., 8, 151-156).
Genomic library construction:
~o Genomic DNA was partially digested with restriction enzyme Sau3A, and size-fractionated by electrophoresis on a 0.7 % agarose gel. Fragments between 2 and 7 kb in size was isolated by electrophoresis onto DEAE-cellulose paper (Dretzen, G., Bellard, M., Sassone-Corsi, P., Chambon, P. (1981) A reliable method for the recovery of DNA fragments from agarose and acrylamide gels.
Anal. Biochem., 112, 295-298).
Isolated DNA fragments were ligated to BamHl digested pSJ1678 pfasmid DNA, and the ligation mixture was used to transform E. coli SJ2.
Identification of positive clones:
A DNA library in E. coli, constructed as described above, was screened on LB
2o agar plates containing 0.2% AZCL-galactomannan (Megazyme) and 9 Ng/ml Chloramphenicol and incubated overnight at 37oC. Clones expressing mannanase activity appeared with blue diffusion halos. Plasmid DNA from one of these clone was isolated by Qiagen plasmid spin preps on 1 ml of overnight culture broth {cells incubated at 37°C in TY with 9 pglml Chloramphenicol and 2s shaking at 250 rpm).
This clone {MB525) was further characterized by DNA sequencing of the cloned Sau3A DNA fragment. DNA sequencing was carried out by primerwalking, using the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labelled terminators and appropriate oligonucleotides as primers.
3o Analysis of the sequence data was performed according to Devereux et al.
(1984) Nucleic Acids Res. 12, 387-395. The sequence encoding the mannanase is shown in SEQ ID No 1. The derived protein sequence is shown in SEQ ID
No.2.
Subcloning and expression of mannanase in B.subtilis:

The mannanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligo nucleotides:
Mannanase.upper.Sacll 5'-CAT TCT GCA GCC GCG GCA GCA AGT ACA GGC TTT TAT GTT GAT GG-3' Mannanase.lower. Notl 5'-GAC GAC GTA CAA GCG GCC GCG CTA TTT CCC TAA CAT GAT GAT
ATT TTC G -3' Restriction sites Sacll and Notll are underlined.
Chromosomal DNA isolated from B.agaradherens NCIMB 40482 as described above was used as template in a PCR reaction using Amplitaq DNA Poiymerase (Perkin Elmer) according to manufacturers instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCI, pH 8.3, 50 mM KCI, 1.5 mM MgCl2, 0.01 (wlv) gelatin) containing 200 NM of each dNTP, 2.5 units of AmpIiTaq poly-15 merase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer.
The PCR reaction was performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94°C for 1 min followed by thirty cycles of PCR
performed using a cycle profile of denaturation at 94°C for 30 sec, annealing at 60°C for 1 min, and extension at 72°C for 2 min. Five-NI
aliquots of the 2o amplification product was analysed by electrophoresis in 0.7 % agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 1.4 kb indicated proper amplification of the gene segment.
Subcloning of PCR fragment.
Fortyfive-NI aliquots of the PCR products generated as described above were 25 purified using QIAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 NI of 10mM Tris HCI, pH 8.5.
pg of pMOL944 and twentyfive-NI of the purified PCR fragment was digested with Sacll and Notl, electrophoresed in 0.8% low gelling temperature agarose 30 (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the Sacll-Notl digested and purified pMOL944. The ligation Was performed overnight at 16°C using 0.5pg of each DNA fragment, 1 U of T4 DNA
ligase and 35 T4 ligase buffer (Boehringer Mannheim, Germany).

The ligation mixture was used to transform competent B.subtilis PL2306. The transformed cells were plated onto LBPG-10 ~rglml of Kanamycin plates. After hours incubation at 37°C colonies were seen on plates. Several clones were analysed by isolating plasmid DNA from overnight culture broth.
One such positive clone was restreaked several times on agar plates as used above, this clone was called MB594. The clone MB594 was grown overnight in TY-10 Ng/ml kanamycin at 37°C, and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturers recommendations for B.subtilis plasmid preparations. This DNA was DNA sequenced and revealed the DNA sequence corresponding to the mature part of the mannanase, i.e. positions 94-1404 of the appended SEQ ID N0:3. The derived mature protein is shown in SEQ ID N0:4. It will appear that the 3' end of the mannanse encoded by the sequence of SEQ ID
N0:1 was changed to the one shown in SEQ ID N0:3 due to the design of the ~5 lower primer used in the PCR. The resulting amino acid sequence is shown in SEQ ID N0:4 and it is apparent that the C terminus of the SEQ ID N0:2 (SHHVREIGVQFSAADNSSGQTALYVDNVTLR) is changed to the C terminus of SEQ ID N0:4 (IIMLGK).
Media:
2o TY (as described in Ausubel, F. M. et al. (eds.) "Current protocols in Molecular Biology". John Wlley and Sons, 1995).
LB agar (as described in Ausubel, F. M. et al. (eds.) "Current protocols in Molecuiar Biology". John Wiley and Sons, 1995).
LBPG is LB agar (see above) supplemented with 0.5% Glucose and 0.05 M
25 potassium phosphate, pH 7.0 BPX media is described in EP 0 506 780 (WO 91109129).
Exaression, purification and characterisation of mannanase from Bacillus acraradherens 3o The clone MB 594 obtained as described above under Materials and Methods was grown in 25 x 200m1 BPX media with 10 Ng/ml of Kanamycin in 500m1 two baffled shakeflasks for 5 days at 37°C at 300 rpm.
6500 ml of the shake flask culture fluid of the clone MB 594 (batch #9813) was collected and pH adjusted to 5.5. 146 rnl of cationic agent (C521) and 292 ml of 35 anionic agent {A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 9000 rpm for 20 min at 6°C. The supernatant was clarified using Whatman glass filters GF/D and C and finally concentrated on a filtron with a cut off of 10 kDa.
750 ml of this concentrate was adjusted to pH 7.5 using sodium hydroxide. The clear solution was applied to anion-exchange chromatography using a 900 ml Q-s Sepharose column equilibrated with 50 mmol Tris pH 7.5. The mannanase activity bound was eluted using a sodium chloride gradient.
The pure enzyme gave a single band in SDS-PAGE with a molecular weight of 38 kDa. The amino acid sequence of the mannanase enzyme, i.e. the translated DNA sequence, is shown in SEQ ID No.2.
~o Determination of kinetic constants:
Substrate: Locust bean gum (carob) and reducing sugar analysis (PHBAH).
Locust bean gum from Sigma (G-0753).
Kinetic determination using different concentrations of locust bean gum and incubation for 20 min at 40°C at pH 10 gave ~ 5 Kcat: 467 per sec.
Km: 0.08 gram per I
MW: 38kDa pl (isoelectric point): 4.2 The temperature optimum of the mannanase was found to be 60°C.
2o The pH activity profile showed maximum activity between pH 8 and 10.
DSC differential scanning calometry gives 77°C as melting point at pH
7.5 in Tris buffer indicating that this enzyme is very thermostable.
Detergent compatibility using 0.2% AZCL-Galactomannan from carob as substrate and incubation as described above at 40°C shows excellent 25 compatibility with conventional liquid detergents and good compatibility with conventional powder detergents.

The Bacillus subtilises ~-mannanase was characterised and purified as follows 3o The Bacillus subteles genome was searched for homology with a known Bacillus sp ~i-Mannanase gene sequence (Mendoza et al., Biochemica et Biophysica Acta 1243:552-554, 1995). The coding region of ydhT, whose product 1 was unknown, showed a 58% similarity to the known Bacellus (3-Mannanase. The following oligonucleotides were designed to amplify the sequences coding for the 35 mature portion of the putative (3-Mannanase: 5'-GCT CAA TTG GCG CAT ACT
GTG TCG CCT GTG-3' and 5'-GAC GGA TCC CGG ATT CAC TCA ACG ATT

GGC G-3'. Total genomic DNA from Bacillus subtilis strain 1A95 was used as a template to amplify the ydhT mature region using the aforementioned primers.
PCR is performed using the GENE-AMP PCR Kit with AMPLITAQ DNA
Polymerase (Perkin Elmer, Applied Biosystems, Foster City, CA). An initial s melting period at 95°C for 5 min was followed by 25 cycles of the following program: melting at 95°C for 1 min, annealing at 55°C for 2 min, and extension at 72°C for 2 min. After the last cycle, the reaction was held at 72°C for 10 min to complete extension. The PCR products were purified using QIAquick PCR
purification kit (Qiagen, Chatsworth, CA).
~o The ydhT mature region amplified from Bacillus subtilis strain 1A95 was inserted into the expression vector pPG1524 (previously described) as follows. The amplified 1028bp fragment was digested with Mfe I and BamH I. The expression vector pPG1527 was digested with EcoR I and BamH I. The restriction products were purified using QIAquick PCR purification kit (Qiagen, Chatsworth, CA).
The ~5 two fragments were ligated using T4 DNA ligase (13 hr, 16°C) and used to transform competent E. coli strain DH5-a. Ampicilin resistant colonies were cultured for DNA preparations. The DNA was then characterized by restriction analysis. Plasmid pPG3200 contains the mature region of the ydhT gene.
Plasmid pPG3200 was then used to transform competent Bacillus subtilis strain 2o PG 632 (Saunders et al., 1992).
Seven kanamycin resistant Bacillus subtilis clones and one PG 632 control clone were picked and grown in 20m1 of 20/20/5 media ( 20g/l tryptone, 20g11 yeast extract, 5g/l NaCI ) supplemented with 1 ml 25% maltrin, 1201 10mM MnCl2, and 201 of 50 mglml kanamycin. Clones were grown overnight in 250m1 baffled 25 flasks shaking at 250 rpm at 37°C for expression of the protein.
Cells were spun out at 14,OOOrpm for 15 minutes. One ~.I of each supernatant was diluted in 99u1 of 50mM sodium acetate (pH 6.0). One ~I of this dilution was assayed using the endo-1,4-(i-Mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) according to the manufacturers instructions. Absorbance was read at 590 nm on a ao Beckman DU640 spectrophotometer. Clone 7 showed the highest Absorbance of 1.67. The PG632 control showed no Absorbance at 590nm.
Supernatant was analyzed by SDS-PAGE on a 10-20% Tris-Glycine gel (Novex, San Diego, Ca) to confirm expected protein size of 38kDa. Samples were prepared as follows. A 5001 sample of ydhT clone 7 and PG 632 supernatants 35 were precipitated with 55.51 100% Trichloroacetic acid (Sigma), washed with 100u1 5% Trichloroacetic, resuspended in 501 of Tris-glycine SDS sample buffer(Novex) and boiled for five minutes. One ~I of each sample was electrophoresed on the gel at 30 mA for 90minutes. A large band of protein was observed to run at 38kDa for ydhT clone 7.
A 10 I fermentation of Bacillus sub>filis ydhT clone 7 was performed in a B.Braun 5 Biostat C fermentator. Fermentation conditions were as follows. Cells were grown for 18h in a rich media similar to 20/20/5 at 37°C. At the end of the fermentation run, the cells were removed and the supernatant concentrated to 1 liter using a tangential flow filtration system. The final yield of (i-Mannanase in the concentrated supernatant was determined to be 3 gll.
The purification of the ~i-Mannanase from the fermentation supernatant was pertormed as follows: 500m1 of supernatant was centrifuged at 10,000 rpm for min at 4°C. The centrifuged supernatant was then dialyzed overnight at 4°C in two 4 I changes of 10 mM potassium phosphate (pH 7.2) through Spectrapor 12,000-14,000 mol.wt. cutoff membrane (Spectrum). The dialyzed supernatant ~5 was centrifuged at 10,000 rpm for 10 min at 4°C. A 200 ml Q
Sepharose fast flow (Pharmacia) anion exchange column was equilibrated with 1 liter of 10 mM
potassium phosphate (pH 7.2) at 20°C and 300m1 of supernatant was loaded on column. Two flow through fractions .of 210 ml (sample A) and 175 ml (sample B) were collected. The two fractions were assayed as before, except that the 2o samples were diluted with 199 p.l of 50 mM sodium acetate (pH 6.0), and they showed Absorbance of .38 and .52 respectively. Two pl of each sample was added to 8~1 of Tris-glycine SDS sample buffer (Novex, CA) and boiled for 5 min.
The resulting samples were electrophoresed on a 10-20% Tris-Giycine gel (Novex, Ca) at 30 mA for 90minutes. A major band corresponding to 38kDa was 25 present in each sample and comprised greater than 95% of the total protein.
A
BCA protein assay (Pierce) was performed on both samples according to the manufacturers instructions, using bovine serum albumin as standard. Samples A
and B contained 1.3 mg/mi and 1.6 mglml of (3-Mannanase respectively. The identity of the protein was confirmed by ion spray mass spectrometry and amino so terminal amino acid sequence analysis.
The purified (i-Mannanase samples were used to characterize the enzymes activity as follows. All assays used endo-1,4-~-Mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) as described earlier. Activity at pH range 3.0-9.0 were performed in 50 mM citrate phosphate buffer, for activity determination at pH
9.5, as 50 mM CAPSO (Sigma), and for pH 10.0-11.0 range 50 mM CAPS buffer was employed. The optimum pH for the Bacillus subtilis [3-Mannanase was found to be pH 6.0-6.5. Temperature activity profiles were performed in 50mM citrate phosphate buffer (pH 6.5). The enzyme showed optimum activity at 40-45°C. The Bacillus subtilis ~i-Mannanase retained significant activity at less than 15°C and greater than 80°C. Specific activity against ~-1,4-Galactomannan was determined to be 160,000 pmollmin~mg (i-Mannanase using endo-1,4-~-Mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) according to the manufacturers directions. The nucleotide and amino acid sequences of the Bacillus subtilisis ~-mannanase are shown in SEQ. ID. No. 5 and 6.
~o The mannanase is incorporated into the compositions of the invention preferably at a level of from 0.0001 % to 2%, more preferably from 0.0005% to 0.1 %, most preferred from 0.001 % to 0.02% pure enzyme by weight of the composition.
The enzyme of the invention, in addition to the enzyme core comprising the catalytically domain, also comprise a cellulose binding domain (CBD), the cellulose binding domain and enzyme core (the catalytically active domain) of the enzyme being operably linked. The cellulose binding domain (CBD) may exist as an integral part of the encoded enzyme, or a CBD from another origin may be introduced into the enzyme thus creating an enzyme hybrid. In this context, the 2o term "cellulose-binding domain" is intended to be understood as defined by Peter Tomme et al. "Cellulose-Binding Domains: Classification and Properties" in "Enzymatic Degradation of Insoluble Carbohydrates", John N. Saddler and Michael H. Penner (Eds.), ACS Symposium Series, No. 618, 1996. This definition classifies more than 120 cellulose- binding domains into 10 families (I-X), and demonstrates that CBDs are found in various enzymes such as cellulases, xylanases, mannanases, arabinofuranosidases, acetyl esterases and chitinases.
CBDs have also been found in algae, e.g. the red alga Porphyra purpurea as a non-hydrolytic polysaccharide-binding , protein, see Tomme et al., op.cit.
However, most of the CBDs are from cellulases and xylanases, CBDs are found 3o at the N and C termini of proteins or are internal. Enzyme hybrids are known in the art, see e.g. WO 90100609 and WO 95116782, and may be prepared by transforming into a host cell a DNA construct comprising at least a fragment of DNA encoding the cellulose- binding domain ligated, with or without a linker, to a DNA sequence encoding the mannanase enzyme and growing the host cell to express the fused gene. Enzyme hybrids may be described by the following formula:

CBD - MR - X
wherein CBD is the N-terminal or the C-terminal region of an amino acid sequence corresponding to at least the cellulose- binding domain; MR is the middle region (the tinker), and may be a bond, or a short linking group preferably of from about 2 to about 100 carbon atoms, more preferably of from 2 to 40 carbon atoms; or is preferably from about 2 to to about 100 amino acids, more preferably of from 2 to 40 amino acids; and X is an N-terminal or C-terminal region of the enzyme of the invention.
The above-mentioned enzymes may be of any suitable origin, such as vegetable, animal, bacterial, fungal and yeast origin. Origin can further be mesophilic or extremophilic (psychrophilic, psychrotrophic, thermophilic, barophilic, alkalophilic, acidophilic, halophilic, etc.). Purified or non-purified forms of these enzymes may be used. Nowadays, it is common practice to modify wild-type enzymes via ~5 protein I genetic engineering techniques in order to optimise their performance efficiency in the cleaning compositions of the invention. For example, the variants may be designed such that the compatibility of the enzyme to commonly encountered ingredients of such compositions is increased. Alternatively, the variant may be designed such that the optimal pH, bleach or chetant stability, 2o catalytic activity and the like, of the enzyme variant is tailored to suit the particular cleaning application.
In particular, attention should be focused on amino acids sensitive to oxidation in the case of bleach stability and on surface charges for the surfactant 25 compatibility. The isoelectric point of such enzymes may be modified by the substitution of some charged amino acids, e.g. an increase in isoelectric point may help to improve compatibility with anionic surfactants. The stability of the enzymes may be further enhanced by the creation of e.g. additional salt bridges and enforcing metal binding sites to increase chelant stability.
Protease The second essential element of the detergent compositions of the present invention is a protease enzyme.

Suitable proteases are the proteases from the IUPAC classification EC 3.4.-.-, preferably the Endo-serine protease from the IUPAC classification EC 3.4.21.-, more preferably the Subtilisin proteases from the IUPAC classification EC
3.4.21.62. These EC 3.4.21.62 proteases are the subtilisins which are obtained from particular strains of B. subtilis and B. licheniformis (subtilisin BPN
and BPN'). One suitable protease is obtained from a strain of Bacillus, having maximum activity throughout the pH range of 8-12, developed and sold as ESPERASE~ by Novo Industries A/S of Denmark, hereinafter "Novo". The preparation of this enzyme and analogous enzymes is described in GB
1,243,784 to Novo. Other suitable proteases include ALCALASE~, DURAZYM~
and SAVINASE~ from Novo and MAXATASE~. MAXACAL~, PROPERASE~
and MAXAPEM~ (protein engineered Maxacal) from Gist-Brocades. Proteolytic enzymes also encompass modified bacterial serine proteases, such as those described in European Patent Application Serial Number 87 303761.8, filed April ~5 28, 1987 (particularly pages 17, 24 and 98), and which is called herein "Protease B", and in European Patent Application 199,404, Venegas, published October 29, 1986, which refers to a modified bacterial serine protealytic enzyme which is called "Protease A" herein. Suitable is the protease called herein "Protease C", which is a variant of an alkaline serine protease from Bacillus in which lysine 2o replaced arginine at position 27, tyrosine replaced valine at position 104, serine replaced asparagine at position 123, and alanine replaced threonine at position 274. Protease C is described in EP 90915958:4, corresponding to WO 91106637, Published May 16, 1991. Genetically modified variants, particularly of Protease C, are also included herein.
25 A preferred protease referred to as "Protease D" is a carbonyl hydrolase variant having an amino acid sequence not found in nature, which is derived from a precursor carbonyl hydrolase by substituting a different amino acid for a plurality of amino acid residues at a position in said carbonyl hydrolase equivalent to position +76, preferably also in combination with one or more amino acid residue 3o positions equivalent to those selected from the group consisting of +gg, +101, +103, +104, +107, +123, +27, +105, +109, +126, +12g, +135, +156, +166, +195, +197, +204, +206, +210, +216, +217, +21 g, +222, +260, +265, and/or +274 according to the numbering of Bacillus amyloliquefaciens subtilisin, as described in W095110591 and in the patent application of C. Ghosh, et al, "Bleaching 35 Compositions Comprising Protease Enzymes" having US Serial No. 08/322,677, filed October 13, 1994. Also suitable is a carbonyl hydrolase variant of the protease described in W095l10591, having an amino acid sequence derived by replacement of a plurality of amino acid residues replaced in the precursor enzyme corresponding to position +210 in combination with one or more of the following residues : +33, +62, +67, +76, +100, +101, +103, +104, +107, +128, +129, +130, +132, +135, +156, +158, +164, +166, +167, +170, +209, +215, +217, +218, and +222, where the numbered position corresponds to naturally occurring subtilisin from Bacillus amylolipuefaciens or to equivalent amino acid residues in other carbonyl hydrolases or subtilisins, such as Bacillus lentos subtilisin (co-pending patent application US Serial No. 60/048,550, filed June 04, ~ 0 1997).
Also suitable for the present invention are proteases described in patent applications EP 251 446 and WO 91106637, protease BLAP~ described in W091102792 and their variants described in WO 95123221.
See also a high pH protease from Bacillus sp. NCIMB 40338 described in WO
93118140 A to Novo. Enzymatic detergents comprising protease, one or more other enzymes, and a reversible protease inhibitor are described in WO
92/03529 A to Novo. When desired, a protease having decreased adsorption and increased hydrolysis is available as described in WO 95/07791 to Procter &
Gamble. A recombinant trypsin-like protease for detergents suitable herein is 2o described in WO 94125583 to Novo. Other suitable proteases are described in EP 516 200 by Unilever.
The proteolytic enzymes are incorporated in the detergent compositions of the present invention a level of from 0.0001 % to 2%, preferably from 0.001 % to 0.2%, more preferably from 0.005% to 0.1% pure enzyme by weight of the composition.
Detergent components The detergent compositions of the invention must contain at least one additional detergent component. The precise nature of these additional component, and levels of incorporation thereof will depend on the physical form of the composition, and the nature of the cleaning operation for which it is to be used.

The detergent compositions of the present invention preferably further comprise a detergent ingredient selected from a selected surtactant, another enzyme, a builder and/or a bleach system.
5 The detergent compositions according to the invention can be liquid, paste, gels, bars, tablets, spray, foam, powder or granular. Granular compositions can also be in "compact" form and the liquid compositions can also be in a "concentrated"
form.
1o In a preferred embodiment, the present invention relates to a detergent composition comprising a mannanase and a protease (Examples 1-16). In a second embodiment, the present invention relates to dishwashing or household detergent compositions (Examples 17-22).
~5 The compositions of the invention may for example, be formulated as hand and machine dishwashing compositions, hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the soaking and/or pretreatment of stained fabrics, rinse added fabric softener compositions, and compositions for use in general household hard 2o surface cleaning operations.
When formulated as compositions for use in manual dishwashing methods the compositions of the invention preferably contain a surfactant and preferably other detergent compounds selected from organic polymeric compounds, suds 25 enhancing agents, group ll metal ions, solvents, hydrotropes and additional enzymes.
When formulated as compositions suitable for use in a laundry machine washing method, the compositions of the invention preferably contain both a surtactant 3o and a builder compound and additionally one or more detergent components preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti-redeposition agents and corrosion inhibitors. Laundry compositions can also contain softening agents, as additional detergent 35 components. Such compositions containing a mannanase and a protease can provide fabric cleaning, stain removal and whiteness maintenance when formulated as laundry detergent compositions.
The compositions of the invention can also be used as detergent additive products in solid or liquid form. Such additive products are intended to supplement or boost the pertormance of conventional detergent compositions and can be added at any stage of the cleaning process.
If needed the density of the detergent compositions herein ranges from 400 to 1200 g/litre, preferably 500 to 950 g/litre of composition measured at 20°C.
The "compact" form of the compositions herein is best reflected by density and, in terms of composition, by the amount of inorganic filler salt; inorganic filler salts are conventional ingredients of detergent compositions in powder form; in conventional detergent compositions, the filler salts are present in substantial amounts, typically 17-35% by weight of the total composition. In the compact compositions, the filler salt is present in amounts not exceeding 15% of the total composition, preferably not exceeding 10%, most preferably not exceeding 5%
by weight of the composition. The inorganic filler salts, such as meant in the present compositions are selected from the alkali and alkaline-earth-metal salts of sulphates and chlorides. A preferred filler salt is sodium sulphate.
Liquid detergent compositions according to the present invention can also be in a "concentrated form", in such case, the liquid detergent compositions according the present invention will contain a lower amount of water, compared to conventional liquid detergents. Typically the water content of the concentrated liquid detergent is preferably less than 40%, more preferably less than 30%, most preferably less than 20% by weight of the detergent composition.
Suitable detergent compounds for use herein are selected from the group consisting of the below described compounds.
Surtactant syrstem The detergent compositions according to the present invention generally comprise a surfactant system wherein the surfactant can be selected from nonionic and/or anionic and/or cationic and/or ampholytic andlor zwitterionic and/or semi-polar surtactants. Preferably, the detergent compositions of the present invention will comprise a nonionic, an anionic andlor a cationic surfactant.
It has been surprisingly found that the detergent composition of the present invention further comprising a nonionic, an anionic surtactant and/or a cationic surfactant, provide superior stain removal.
Without wishing to be bound by theory, it is believed that the enzymatic hydrolysis results in small particles being more easily removed by nonionic surtactants known to focus on particulate soiling. Preferred nonionic surfactants ~o are alkyl ethoxylate AE3 to AE7. It is also believed that the combination of the fabric substantive cationic surfactant with the enzymatic hydrolysis of the combined enzyme provides improved performances.
The surfactant is typically present at a level of from 0.1 % to 60% by weight.
More ~5 preferred levels of incorporation are 1% to 35% by weight, most preferably from 1 % to 30% by weight of detergent compositions in accord with the invention.
The surfactant is preferably formulated to be compatible with enzyme components present in the composition. In liquid or gel compositions the 2o surfactant is most preferably formulated such that it promotes, or at least does not degrade, the stability of any enzyme in these compositions.
Nonionic surtactants Polyethylene, polypropylene, and polybutylene oxide condensates of alkyl 2s phenols are suitable for use as the nonionic surfactant of the surfactant systems of the present invention, with the polyethylene oxide condensates being preferred. These compounds include the condensation products of alkyl phenols having an alkyl group containing from about 6 to about 14 carbon atoms, preferably from about 8 to about 14 carbon atoms, in either a straight-chain or 3o branched-chain configuration with the alkylene oxide. In a preferred embodiment, the ethylene oxide is present in an amount equal to from about 2 to about 25 moles, more preferably from about 3 to about T 5 moles, of ethylene oxide per mole of alkyl phenol. Commercially available nonionic surfactants of this type include IgepaITM CO-630, marketed by the GAF Corporation; and TritonTM X-3s 45, X-114, X-100 and X-102, all marketed by the Rohm & Haas Company. These surfactants are commonly referred to as alkylphenol alkoxylates (e.g., alkyl phenol ethoxylates).
The condensation products of primary and secondary aliphatic alcohofs with from about 1 to about 25 moles of ethylene oxide are suitable for use as the nonionic surfactant of the nonionic surfactant systems of the present invention. The alkyl chain of the aliphatic alcohol can either be straight or branched, primary or secondary, and generally contains from about 8 to about 22 carbon atoms.
Preferred are the condensation products of alcohols having an alkyl group containing from about 8 to about 20 carbon atoms, more preferably from about to about 18 carbon atoms, with from about 2 to about 10 moles of ethylene oxide per mole of alcohol. About 2 to about 7 moles of ethylene oxide and most preferably from 2 to 5 moles of ethylene oxide per mole of alcohol are present in said condensation products. Examples of commercially available nonionic ~5 surtactants of this type include TergitoITM 15-S-9 (the condensation product of C11-C15 linear alcohol with 9 moles ethylene oxide), TergitoITM 24-L-6 NMW
(the condensation product of C12-C14 primary alcohol with 6 moles ethylene oxide with a narrow molecular weight distribution), both marketed by Union Carbide Corporation; NeodoITM 45-9 (the condensation product of C14-C15 linear alcohol with 9 moles of ethylene oxide), NeodoITM 23-3 (the condensation product of C12-C13 linear alcohol with 3.0 moles of ethylene oxide), NeodoITM
45-7 (the condensation product of C14-C15 linear alcohol with 7 moles of ethylene oxide), NeodoITM 45-5 (the condensation product of C14-C15 linear alcohol with 5 moles of ethylene oxide) marketed by Shell Chemical Company, KyroTM EOB (the condensation product of C13-C15 alcohol with 9 moles ethylene oxide), marketed by The Procter & Gamble Company, and Genapol LA
030 or 050 (the condensation product of C12-C14 alcohol with 3 or 5 moles of ethylene oxide) marketed by Hoechst. Preferred range of HLB in these products is from 8-11 and most preferred from 8-10.
Also useful as the nonionic surtactant of the surtactant systems of the present invention are the alkylpolysaccharides disclosed in U.S. Patent 4,565,647, Llenado, issued January 21, 1988, having a hydrophobic group containing from about 6 to about 30 carbon atoms, preferably from about 10 to about 16 carbon atoms and a polysaccharide, e.g. a polyglycoside, hydrophilic group containing from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7 saccharide units. Any reducing saccharide containing or 6 carbon atoms can be used, e.g., glucose, galactose and galactosyl moieties can be substituted for the glucosyl moieties (optionally the hydrophobic group is attached at the 2-, 3-, 4-, etc. positions thus giving a glucose or 5 galactose as opposed to a glucoside or galactoside). The intersaccharide bonds can be, e.g., between the one position of the additional saccharide units and the 2-, 3-, 4-, andlor 6- positions on the preceding saccharide units.
The preferred alkylpolyglycosides have the formula:
R2~(CnH2n~)t(9lYcosyl)x wherein R2 is selected from the group consisting of alkyl, alkyfphenyl, hydroxyalkyl, hydroxyaikylphenyl, and mixtures thereof in which the alkyl groups contain from about 10 to about 18, preferably from about 12 to about 14, carbon ~5 atoms; n is 2 or 3, preferably 2; t is from 0 to about 10, preferably 0;
and x is from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7. The glycosy! is preferably derived from glucose. To prepare these compounds, the alcohol or alkylpolyethoxy alcohol is formed first and then reacted with glucose, or a source of glucose, to form the glucoside 20 (attachment at the 1-position). The additional glycosyl units can then be attached between their 1-position and the preceding glycosyl units 2-, 3-, 4- and/or 6-position, preferably predominately the 2-position.
The condensation products of ethylene oxide with a hydrophobic base formed by 25 the condensation of propylene oxide with propylene glycol are also suitable for use as the additional nonionic surfactant systems of the present invention.
The hydrophobic portion of these compounds will preferably have a molecular weight of from about 1500 to about 1800 and will exhibit water insolubility. The addition of polyoxyethylene moieties to this hydrophobic portion tends to increase the 3o water solubility of the molecule as a whole, and the liquid character of the product is retained up to the point where the poiyoxyethylene content is about 50% of the total weight of the condensation product, which corresponds to condensation with up to about 40 moles of ethylene oxide. Examples of compounds of this type include certain of the commercially-available PiurafacTM
35 LF404 and PluronicTM surfactants, marketed by BASF.

Also suitable for use as the nonionic surtactant of the nonionic surfactant system of the present invention, are the condensation products of ethylene oxide with the product resulting from the reaction of propylene oxide and ethylenediamine.
The hydrophobic moiety of these products consists of the reaction product of 5 ethytenediamine and excess propylene oxide, and generally has a molecular weight of from about 2500 to about 3000. This hydrophobic moiety is condensed with ethylene oxide to the extent that the condensation product contains from about 40% to about 80% by weight of polyoxyethylene and has a molecular weight of from about 5,000 to about 11,000. Examples of this type of nonionic surtactant include certain of the commercially available TetronicTM compounds, marketed by BASF.
Preferred for use as the nonionic surfactant of the surfactant systems of the present invention are polyethylene oxide condensates of alkyl phenols, ~5 condensation products of primary and secondary aliphatic alcohols with from about 1 to about 25 moles of ethylene oxide, alkylpolysaccharides, and mixtures thereof. Most preferred are Cg-C14 alkyl phenol ethoxylates having from 3 to ethoxy groups and Cg-C1g alcohol ethoxylates (preferably C10 avg.) having from 2 to 10 ethoxy groups, and mixtures thereof.
Highly preferred nonionic surtactants are polyhydroxy fatty acid amide surfactants of the formula:
R2-C-N-Z, wherein R1 is H, or R1 is C1_4 hydrocarbyl, 2-hydroxy ethyl, 2-hydroxy propyl or a mixture thereof, R2 is C5_31 hydrocarbyl, and Z is a polyhydroxyhydrocarbyl 3o having a linear hydrocarbyl chain with at least 3 hydroxyls directly connected to the chain, or an alkoxylated derivative thereof. Preferably, R1 is methyl, R2 is a straight C11_15 alkyl or C1g-18 alkyl or alkenyl chain such as coconut alkyl or mixtures thereof, and Z is derived from a reducing sugar such as glucose, fructose, maltose, lactose, in a reductive amination reaction.
Anionic surfactants WO 99!09128 PCT/US98/11996 ' Preferred anionic surfactants for the purpose of the present invention are alkyl esters sulfates and linear alkyl benzene surfactants. Suitable anionic surfactants to be used are linear alkyl benzene sulfonate, alkyl ester sulfonate surfactants including linear esters of Cg-C20 carboxylic acids (i.e., fatty acids) which are sulfonated with gaseous S03 according to "The Journal of the American Oil Chemists Society", 52 (1975), pp. 323-329. Suitable starting materials would include natural fatty substances as derived from tallow, palm oil, etc.
The preferred alkyl ester suifonate surtactant, especially for laundry applications, comprise alkyl ester sulfonate surfactants of the structural formula:
O

wherein R3 is a Cg-C20 hydrocarbyl, preferably an alkyl, or combination thereof, R4 is a C1-C6 hydrocarbyl, preferably an alkyl, or combination thereof, and M
is a cation which forms a water soluble salt with the alkyl ester sulfonate.
Suitable 2o salt-forming cations include metals such as sodium, potassium, and lithium, and substituted or unsubstituted ammonium cations, such as monoethanolamine, diethanolamine, and triethanolamine. Preferably, R3 is C10-C16 alkyl, and R4 is methyl, ethyl or isopropyl. Especially preferred are the methyl ester sulfonates wherein R3 is C10-C16 alkyl.
Other suitable anionic surfactants include the alkyl sulfate surfactants which are water soluble salts or acids of the formula ROSO3M wherein R preferably is a C1p-C2q, hydrocarbyl, preferably an alkyl or hydroxyalkyl having a C10-C20 alkyl component, more preferably a C12-C1g alkyl or hydroxyalkyl, and M is H or a 3o cation, e.g., an alkali metal cation (e.g. sodium, potassium, lithium), or ammonium or substituted ammonium (e.g. methyl-, dimethyf-, and trimethyl ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and quaternary ammonium cations derived from alkylamines such as ethylamine, diethylamine, triethylamine, and mixtures thereof, and the like). Typically, alkyl chains of C12-C16 are preferred for lower wash temperatures {e.g. below about 50°C) and C16-18 alkyl chains are preferred for higher wash temperatures (e.g. above about 50°C).
Other anionic surfactants useful for detersive purposes can also be included in the detergent compositions of the present invention. These can include salts (including, for example, sodium, potassium, ammonium, and substituted ammonium salts such as mono-, di- and triethanolamine salts) of soap, Cg-C22 primary of secondary alkanesulfonates, Cg-C24 olefinsulfonates, sulfonated polycarboxylic acids prepared by sulfonation of the pyrolyzed product of alkaline earth metal citrates, e.g., as described in British patent specification No.
1,082,179, Cg-C24 alkylpolygiycolethersulfates (containing up to 10 moles of ethylene oxide); alkyl glycerol sulfonates, fatty acyl glycerol sulfonates, fatty oleyl glycerol sulfates, alkyl phenol ethylene oxide ether sulfates, paraffin sulfonates, alkyl phosphates, isethionates such as the acyl isethionates, N-acyl taurates, alkyl succinamates and sulfosuccinates, monoesters of sulfosuccinates (especially saturated and unsaturated C12-C1g monoesters) and diesters of sulfosuccinates (especially saturated and unsaturated C6-C12 diesters), acyl sarcosinates, sulfates of alkylpolysaccharides such as the sulfates of alkylpolyglucoside (the nonionic nonsulfated compounds being described below), 2o branched primary alkyl sulfates, and alkyl polyethoxy carboxylates such as those of the formula RO(CH2CH20)k-CH2C00-M+ wherein R is a Cg-C22 alkyl, k is an integer from 1 to 10, and M is a soluble salt-forming cation. Resin acids and hydrogenated resin acids are also suitable, such as rosin, hydrogenated rosin, and resin acids and hydrogenated resin acids present in or derived from tall oil.
Further examples are described in "Surface Active Agents and Detergents" (Vol.
I
and II by Schwartz, Perry and Berch). A variety of such surfactants are also generally disclosed in U.S. Patent 3,929,678, issued December 30, 1975 to Laughlin, et ai. at Column 23, line 58 through Column 29, line 23 (herein so incorporated by reference).
When included therein, the detergent compositions of the present invention typically comprise from about 1 % to about 40%, preferably from about 3% to about 20% by weight of such anionic surfactants.
Highly preferred anionic surfactants include alkyl alkoxylated sulfate surfactants hereof are water soluble salts or acids of the formula RO(A)mS03M wherein R is an unsubstituted C1p-C24 alkyl or hydroxyalkyl group having a C10-C24 alkyl component, preferably a C12-C20 alkyl or hydroxyalkyl, more preferably C12-C1 g alkyl or hydroxyalkyl, A is an ethoxy or propoxy unit, m is greater than zero, typically between about 0.5 and about 6, more preferably between about 0.5 and about 3, and M is H or a ration which can be, for example, a metal ration (e.g., sodium, potassium, lithium, calcium, magnesium, etc.), ammonium or substituted-ammonium ration. Alkyl ethoxylated sulfates as well as alkyl propoxylated sulfates are contemplated herein. Specific examples of substituted ammonium rations include methyl-, dimethyl, trimethyl-ammonium rations and quaternary ammonium rations such as tetramethyl-ammonium and dimethyl piperdinium rations and those derived from alkylamines such as ethylamine, diethylamine, triethylamine, mixtures thereof, and the like. Exemplary surfactants are C12-C1g alkyl polyethoxylate (1.0) sulfate (C12-C18E(1.0)M), C12-C1g alkyl polyethoxylate (2.25) sulfate (C12-C18E(2.25)M), C12-C1g alkyl polyethoxylate ~5 {3.0) sulfate (C12-C18E(3.0)M), and C12-C1g alkyl polyethoxylate (4.0) sulfate {C12-C18E(4.0)M), wherein M is conveniently selected from sodium and potassium.
Cationic surfactants 2o Cationic detersive surfactants suitable for use in the detergent compositions of the present invention are those having one long-chain hydrocarbyl group.
Examples of such cationic surfactants include the ammonium surfactants such as alkyltrimethylammonium halogenides, and those surfactants having the formula 25 IR2(OR3)ylIR4(OR3)y12R5N+X_ wherein R2 is an alkyl or alkyl benzyl group having from about 8 to about 18 carbon atoms in the alkyl chain, each R3 is selected from the group consisting of -CH2CH2-, -CH2CH(CHg)-, -CH2CH(CH20H)-, -CH2CH2CH2-, and mixtures so thereof; each R4 is selected from the group consisting of C1-C4 alkyl, C1-hydroxyalkyl, benzyl ring structures formed by joining the two R4 groups, CH2CHOH-CHOHCOR6CHOHCH20H wherein R6 is any hexose or hexose polymer having a molecular weight less than about 1000, and hydrogen when y is not 0; R5 is the same as R4 or is an alkyl chain wherein the total number of 35 carbon atoms of R2 plus R5 is not more than about 18; each y is from 0 to about and the sum of the y values is from 0 to about 15; and X is any compatible anion.
Quaternary ammonium surfactant suitable for the present invention has the 5 formula (I):
R2 O ~ 3,,,,,,R4 R~ N' ~O 'RS X-Formula I
1o whereby R1 is a short chainlength alkyl (C6-C10} or alkyiamidoalkyl of the formula (II}
Cs C.~~N
~CH~
O
Formula II
y is 2-4, preferably 3.
whereby R2 is H or a C1-C3 alkyl, whereby x is 0-4, preferably 0-2, most preferably 0, whereby R3, R4 and R5 are either the same or different and can be either a short 2o chain alkyl (C1-C3} or aikoxylated alkyl of the formula III, whereby X- is a counterion, preferably a halide, e.g. chloride or methylsulfate.
Rs ~H
O ,z Formula III
R6 is C1-C~ and z is 1 or 2.
Preferred quat ammonium surfactants are those as defined in formula I whereby 3o R1 is Cg, C10 or mixtures thereof, x=o, Rg, R4 = CH3 and R5 = CH2CH20H.
Highly preferred cationic surfactants are the water-soluble quaternary ammonium compounds useful in the present composition having the formula R1R2R3R4N+X- (i) wherein R1 is Cg-C1g alkyl, each of R2, Rg and R4 is independently C1-C4 alkyl, C1-C4 hydroxy alkyl, benzyl, and -(C2H40)xH where x has a value from 2 to 5, and X is an anion. Not more than one of R2, R3 or R4 should be benzyl.
The preferred alkyl chain length for R1 is C12-C15 particularly where the alkyl group is a mixture of chain lengths derived from coconut or palm kernel fat or is derived synthetically by olefin build up or OXO alcohols synthesis. Preferred groups for R2R3 and R4 are methyl and hydroxyethyl groups and the anion X
~5 may be selected from halide, methosulphate, acetate and phosphate ions.
Examples of suitable quaternary ammonium compounds of formulae (i) for use herein are coconut trimethyl ammonium chloride or bromide;
coconut methyl dihydroxyethyi ammonium chloride or bromide;
2o decyl triethyl ammonium chloride;
decyl dimethyl hydroxyethyl ammonium chloride or bromide;
C12_15 dimethyl hydroxyethyl ammonium chloride or bromide;
coconut dimethyl hydroxyethyl ammonium chloride or bromide;
myristyl trimethyl ammonium methyl sulphate;
25 lauryl dimethyl benzyl ammonium chloride or bromide;
lauryl dimethyl (ethenoxy)4 ammonium chloride or bromide;
choline esters (compounds of formula (i) wherein R1 is CH2-CH2-O-C-C12-14 alkyl and R2R3R4 are methyl).
I

di-alkyl imidazolines [compounds of formula (i)].
Other cationic surfactants useful herein are also described in U.S. Patent 4,228,044, Cambre, issued October 14, 1980 and in European Patent 35 Application EP 000,224.

~: s Typical cationic fabric softening components include the water-insoluble quaternary-ammonium fabric softening actives or thei corresponding amine precursor, the most commonly used having been di-long alkyl chain ammonium chloride or methyl sulfate.
Preferred cationic softeners among these include the following:
1) ditallow dimethylamrnonium chloride (DTDMAC);
2) dihydrogenated tallow dimethylammonium chloride;
3) dihydrogenated tallow dimethylammonium methylsulfate;
4) distearyl dimethylammonium chloride;
~0 5) dioleyl dimethylammonium chloride;
8) dipalmityl hydroxyethyl methylammonium chloride;
7) stearyl benzyl dimethylammonium chloride;
8) tallow trimethylammonium chloride;
9) hydrogenated tallow trimethylammonium chloride;
~5 10) 012-14 alkyl hydroxyethyl dimethylammonium chloride;
11 ) 012-18 alkyl dihydroxyethyl methylammonium chloride;
12) di(stearoyloxyethyl) dimethylammonium chloride (DSOEDMAC);
13) di(tallow-oxy-ethyl) dimethylammonium chloride;
14) ditaliow imidazolinium methylsulfate;
20 15) 1-(2-tallowylamidoethyl)-2-tallowyl imidazolinium methylsulfate.
Biodegradable quaternary ammonium compounds have been presented as alternatives to the traditionally used di-long alkyl chain ammonium chlorides and methyl sulfates. Such quaternary ammonium compounds contain long chain 25 alk(en)yl groups interrupted by functional groups such as carboxy groups.
Said materials and fabric softening compositions containing them are disclosed in numerous publications such as EP-A-0,040,562, and EP-A-0,239,910.
The quaternary ammonium compounds and amine precursors herein have the 3o formula (I) or (II), below R~ R + N~ (CHZ)~-CH -CHZ X
N Own-Q-fT 1 X- R3 Q
R1 Tt T2 or *rB

wherein Q is selected from -O-C(O)-, -C(O)-O-, -O-C(O)-O-, -NR4-C(O)-, -C{O)-N R4-;
R1 is (CH2)n-Q-T2 or T3;
R2 is (CH2)m-Q-T4 or T5 or R3;
R3 is C1-C~ alkyl or C1-C4 hydroxyalkyl or H;
R4 is H or C1-Cq, alkyl or C1-C4 hydroxyalkyl;
T1, T2, T3, T4, T5 are independently C11-C22 alkyl or alkenyl;
n and m are integers from 1 to 4; and X- is a softener-compatible anion. Non-limiting examples of softener-compatible anions include chloride or methyl sulfate.
~5 The alkyl, or alkenyl, chain T1, T2, T3, T4, T~ must contain at least 11 carbon atoms, preferably at least 16 carbon atoms. The chain may be straight or branched. Tallow is a convenient and inexpensive source of long chain alkyl and alkenyl material. The compounds wherein T1, T2, T3, T4, T5 represents the mixture of long chain materials typical for tallow are particularly preferred.
Specific examples of quaternary ammonium compounds suitable for use in the aqueous fabric softening compositions herein include 1 ) N,N-di(tallowyl-oxy-ethyl)-N,N-dimethyl ammonium chloride;
2) N,N-di(tallowyl-oxy-ethyl)-N-methyl, N-(2-hydroxyethyl) ammonium methyl sulfate;
3) N,N-di(2-tallowyl-oxy-2-oxo-ethyl)-N,N-dimethyl ammonium chloride;
4) N,N-di(2-tallowyl-oxy-ethylcarbonyl-oxy-ethyl)-N,N-dimethyl ammonium chloride;
5) N-(2-tallowyl-oxy-2-ethyl)-N-(2-tallowyl-oxy-2-oxo-ethyl)-N,N-dimethyl 3o ammonium chloride;
6) N,N,N-tri(tallowyl-oxy-ethyl)-N-methyl ammonium chloride;
7) N-(2-tallowyl-oxy-2-oxo-ethyl)-N-(tallowyl-N,N-dimethyl-ammonium chloride; and 8) 1,2-ditallowyl-oxy-3-trimethylammoniopropane chloride;
and mixtures of any of the above materials.

When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 25%, preferably from about 1 % to about 8% by weight of such cationic surfactants.
Bleaching agent It has 'been surprisingly found that the detergent compositions of the present invention further comprising a bleaching agent, especially a bleach activator 1o bleaching system, provide enhanced food stain/soil removal, dingy cleaning and whiteness maintenance. Without wishing to be bound by theory, it is believed that the smaller chromophoric particles resulting from the combined enzymes' hydrolysis are more easily attacked by the bleach activated bleaching systems, especially at low temperature.
These bleaching agents include hydrogen peroxide, PB1, PB4 and percarbonate with a particle size of 400-800 microns. These bleaching agent components can include one or more oxygen bleaching agents and, depending upon the bleaching agent chosen, one or more bleach activators. When present oxygen 2o bleaching compounds will typically be present at levels of from about 1 %
to about 25%.
The bleaching agent component for use herein can be any of the bleaching agents useful for detergent compositions including oxygen bleaches as well as others known in the art. The bleaching agent suitable for the present invention can be an activated or non-activated bleaching agent.
One category of oxygen bleaching agent that can be used encompasses percarboxylic acid bleaching agents and salts thereof. Suitable examples of this 3o class of agents include magnesium monoperoxyphthalate hexahydrate, the magnesium salt of meta-chloro perbenzoic acid, 4-nonylamino-4-oxoperoxybutyric acid and diperoxydodecanedioic acid. Such bleaching agents are disclosed in U.S. Patent 4,483,781, U.S. Patent Application 740,446, European Patent Application 0,133,354 and U.S. Patent 4,412,934. Highly preferred bleaching agents also include 6-nonylamino-6-oxoperoxycaproic acid as described in U.S. Patent 4,634,551.

Another category of bleaching agents that can be used encompasses the halogen bleaching agents. Examples of hypohalite bleaching agents, for example, include trichloro isocyanuric acid and the sodium and potassium dichloroisocyanurates and N-chloro and N-bromo alkane sulphonamides. Such materials are normally added at 0.5-10% by weight of the finished product, preferably 1-5% by weight.
The hydrogen peroxide releasing agents can be used in combination with bleach activators such as tetraacetylethylenediamine (TAED), nonanoyloxybenzene-sulfonate (NOES, described in US 4,412,934), 3,5,-trimethylhexanoloxybenzenesulfonate (ISONOBS, described in EP 120,591) or pentaacetylglucose (PAG)or Phenolsulfonate ester of N-nonanoyl-6-aminocaproic acid (NACA-OBS, described in W094128106), which are perhydrolyzed to form a peracid as the active bleaching species, leading to improved bleaching effect. Also suitable activators are acylated citrate esters such as disclosed in co-pending European Patent Application No. 91870207.7 and unsymetrical acyclic imide bleach activator of the following formula as disclosed in the Procter & Gamble co-pending patent applications US serial No.
601022,786 (filed July 30, 1996) and No. 60/028,122 (filed October 15, 1996) O O
R;

wherein R1 is a C7-C13 linear or branched chain saturated or unsaturated alkyl group, R2 is a C1-Cg, linear or branched chain saturated or unsaturated alkyl group and R3 is a C1-C4 linear or branched chain saturated or unsaturated alkyl group.
Useful bleaching agents, including peroxyacids and bleaching systems comprising bleach activators and peroxygen bleaching compounds for use in detergent compositions according to the invention are described in our co-3o pending applications USSN 08/136,626, PCT/US95I07823, W095/27772, W095/27773, W095I27774 and W095/27775.

Y

The hydrogen peroxide may also be present by adding an enzymatic system (i.e.
an enzyme and a substrate therefore) which is capable of generating hydrogen peroxide at the beginning or during the washing and/or rinsing process. Such enzymatic systems are disclosed in EP Patent Application 91202655.6 filed 5 October 9, 1991.
Metal-containing catalysts for use in bleach compositions, include cobalt-containing catalysts such as Pentaamine acetate cobalt(III) salts and manganese-containing catalysts such as those described in EPA 549 271; EPA
549 272; EPA 458 397; US 5,246,621; EPA 458 398; US 5,194,416 and US
5,114,611. Bleaching composition comprising a peroxy compound, a manganese-containing bleach catalyst and a chelating agent is described in the patent application No 94870206.3.
15 Bleaching agents other than oxygen bleaching agents are also known in the art and can be utilized herein. One type of non-oxygen bleaching agent of particular interest includes photoactivated bleaching agents such as the sulfonated zinc andlor aluminum phthalocyanines. These materials can be deposited upon the substrate during the washing process. Upon irradiation with light, in the 2o presence of oxygen, such as by hanging clothes out to dry in the daylight, the sulfonated zinc phthalocyanine is activated and, consequently, the substrate is bleached. Preferred zinc phthalocyanine and a photoactivated bleaching process are described in U.S. Patent 4,033,718. Typically, detergent compositions will contain about 0.025% to about 1.25%, by weight, of sulfonated zinc 25 phthalocyanine.
Builder system 3o The detergent compositions of the present invention will preferably comprise builder, more preferably Zeolite, sodium layered silicate andlor Sodium tripolyphosphate. It has been surprisingly found that the detergent composition of the present invention further comprising a builder, provide enhanced cleaning.
Without wishing to be bound by theory, it is believed that the calcium 35 encrustation on the top of hydrocolloid gums-containg stains limits the enzyme hydrolysis. Therefore, the use of builder is expected to remove the entrapped WO 99/0912$ PCT/US98/11996 calcium and favouring the action of the combined enzymes of the present invention.
Any conventional builder system is suitable for use herein including s aluminosilicate materials, silicates, polycarboxylates, alkyl- or alkenyl-succinic acid and fatty acids, materials such as ethylenediamine tetraacetate, diethylene triamine pentamethyleneacetate, metal ion sequestrants such as aminopolyphosphonates, particularly ethylenediamine tetramethylene phosphonic acid and diethylene triamine pentamethylenephosphonic acid.
Phosphate builders can also be used herein.
Suitable builders can be an inorganic ion exchange material, commonly an inorganic hydrated aluminosilicate material, more particularly a hydrated synthetic zeolite such as hydrated zeolite A, X, B, HS or MAP.
~5 Another suitable inorganic builder material is layered silicate, e.g. SKS-6 (Hoechst). SKS-6 is a crystalline layered silicate consisting of sodium silicate (Na2Si205).
Suitable palycarboxylates containing one carboxy group include lactic acid, glycolic acid and ether derivatives thereof as disclosed in Belgian Patent Nos.
20 831,368, 821,369 and 821,370. Polycarboxylates containing two carboxy groups include the water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, malefic acid, diglycollic acid, tartaric acid, tartronic acid and fumaric acid, as well as the ether carboxylates described in German Offenlegenschrift 2,446,686, and 2,446,687 and U.S. Patent No. 3,935,257 and the sulfinyl 25 carboxylates described in Belgian Patent No. 840,623. Polycarboxylates containing three carboxy groups include, in particular, water-soluble citrates, aconitrates and citraconates as well as succinate derivatives such as the carboxymethyloxysuccinates described in British Patent No. 1,379,241, lactoxysuccinates described in Netherlands Application 7205873, and the 3o oxypolycarboxylate materials such as 2-oxa-1,1,3-propane tricarboxylates described in British Patent No. 1,387,447.
Polycarboxylates containing four carboxy groups include oxydisuccinates disclosed in British Patent No. 1,261,829, 1,1,2,2-ethane tetracarboxylates, 35 1,1,3,3-propane tetracarboxylates and 1,1,2,3-propane tetracarboxylates.
Polycarboxylates containing sulfo substituents include the sulfosuccinate derivatives disclosed in British Patent Nos. 1,398,421 and 1,398,422 and in U.S.
Patent No. 3,936,448, and the suifonated pyrolysed citrates described in British Patent No. 1,082,179, while polycarboxylates containing phosphone substituents are disclosed in British Patent No. 1,439,000.
Alicyclic and heterocyclic polycarboxylates include cyclopentane-cis,cis,cis-tetracarboxylates, cyclopentadienide pentacarboxylates, 2,3,4,5-tetrahydro-furan - cis, cis, cis-tetracarboxylates, 2,5-tetrahydro-furan -cis - dicarboxylates, 2,2,5,5-tetrahydrofuran - tetracarboxylates, 1,2,3,4,5,6-hexane -hexacar-boxylates and 1o and carboxymethyl derivatives of polyhydric alcohois such as sorbitol, mannitol and xylitol. Aromatic poly-carboxylates include mellitic acid, pyromellitic acid and the phthalic acid derivatives disclosed in British Patent No. 1,425,343.
Of the above, the preferred polycarboxylates are hydroxycarboxylates containing up to three carboxy groups per molecule, more particularly citrates.
Preferred builder systems for use in the present compositions include a mixture of a water-insoluble aluminosilicate builder such as zeolite A or of a layered silicate (SKS-6), and a water-soluble carboxylate chelating agent such as citric acid. Other preferred builder systems include a mixture of a water-insoluble 2o aluminosilicate builder such as zeolite A, and a watersoluble carboxylate chelating agent such as citric acid. Preferred builder systems for use in liquid detergent compositions of the present invention are soaps and polycarboxylates.
Other builder materials that can form part of the builder system for use in granular compositions include inorganic materials such as alkali metal carbonates, bicarbonates, silicates, and organic materials such as the organic phosphonates, amino polyalkylene phosphonates and amino polycarboxyiates.
Other suitable water-soluble organic salts are the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl 3o radicals separated from each other by not mare than two carbon atoms.
Polymers of this type are disclosed in GB-A-1,596,756. Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with malefic anhydride, such copolymers having a molecular weight of from 20,000 to 70,000, especially about 40,000.

Detergency builder salts are normally included in amounts of from 5% to 80% by weight of the composition preferably from 10% to 70% and most usually from 30% to 60% by weight.
Other surtactant system The detergent compositions of the present invention may also contain cationic, ampholytic, zwitterionic, and semi-polar surfactants, as well as the nonionic and/or anionic surfactants other than those already described herein.
Ampholytic surfactants are also suitable for use in the detergent compositions of the present invention. These surfactants can be broadly described as aliphatic derivatives of secondary or tertiary amines, or aliphatic derivatives of hetervcyclic ~5 secondary and tertiary amines in which the aliphatic radical can be straight- or branched-chain. One of the aliphatic substituents contains at least about 8 carbon atoms, typically from about 8 to about 18 carbon atoms, and at least one contains an anionic water-solubiiizing group, e.g. carboxy, sulfonate, sulfate. See U.S. Patent No. 3,929,678 to Laughlin et al., issued December 30, 1975 at 2o column 19, lines 18-35, for examples of ampholytic surtactants.
When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1 % to about 10% by weight of such ampholytic surfactants.
25 Zwitterionic surfactants are also suitable for use in detergent compositions.
These surfactants can be broadly described as derivatives of secondary and tertiary amines, derivatives of heterocyclic secondary and tertiary amines, or derivatives of quaternary ammonium, quaternary phosphonium or tertiary sulfonium compounds. See U.S. Patent No. 3,929,678 to Laughlin et al., issued 3o December 30, 1975 at column 19, line 38 through column 22, line 48, for examples of zwitterionic surfactants.
When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1 % to about 10% by weight of such zwitterionic surfactants.

Semi-polar nonionic surfactants are a special category of nonionic surtactants which include water-soluble amine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; water-soluble phosphine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; and water-soluble sulfoxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and a moiety selected from the group consisting of alkyl and hydroxyalkyl moieties of from about 1 to about 3 carbon atoms.
Semi-polar nonionic detergent surtactants include the amine oxide surfactants having the formula p T
R3(OR4)xN(R5)2 wherein R3 is an alkyl, hydroxyalkyl, or alkyl phenyl group or mixtures thereof 2o containing from about 8 to about 22 carbon atoms; R4 is an alkylene or hydroxyalkylene group containing from about 2 to about 3 carbon atoms or mixtures thereof; x is from 0 to about 3; and each R5 is an alkyl or hydroxyalkyl group containing from about 1 to about 3 carbon atoms or a polyethylene oxide group containing from about 1 to about 3 ethylene oxide groups. The R5 groups can be attached to each other, e.g., through an oxygen or nitrogen atom, to form a ring structure.
These amine oxide surfactants in particular include C10-C1g alkyl dimethyl amine oxides and Cg-C12 alkoxy ethyl dihydroxy ethyl amine oxides.
When included therein, the cleaning compositions of the present invention 3o typically comprise from 0.2% to about 15%, preferably from about 1 % to about 10% by weight of such semi-polar nonionic surfactants.
The detergent composition of the present invention may further comprise a cosurfactant selected from the group of primary or tertiary amines.
Suitable primary amines for use herein include amines according to the formula R1NH2 wherein R1 is a Cg-C12, preferably Cg-C1p alkyl chain or R4X(CH2)~, X

is -O-,-C(O)NH- or -NH-, R4 is a Cg-C12 alkyl chain n is between 1 to 5, preferably 3. R1 alkyl chains may be straight or branched and may be interrupted with up to 12, preferably less than 5 ethylene oxide moieties.
Preferred amines according to the formula herein above are n-alkyl amines.
5 Suitable amines for use herein may be selected from 1-hexylamine, 1-octylamine, 1-decylamine and laurylamine. Other preferred primary amines include C8-C10 oxypropylamine, octyloxypropylamine, 2-ethylhexyl-oxypropylamine, lauryl amido propylamine and amido propylamine.
Suitable tertiary amines for use herein include tertiary amines having the formula R1 R2RgN wherein R1 and R2 are C1-Cg alkylchains or Rs I
-C CH,-CH-O ~H
15 R3 is either a Cg-C12, preferably Cg-C10 alkyl chain, or Rg is R4X(CH2)n, whereby X is -O-, -C(O)NH- or -NH-,Rq, is a C~-C12, n is between 1 to 5, preferably 2-3. R5 is H or C1-C2 alkyl and x is between 1 to 6 .
R3 and R4 may be linear or branched ; R3 alkyl chains may be interrupted with up to 12, preferably less than 5, ethylene oxide moieties.
Preferred tertiary amines are R1R2R3N where R1 is a C6-C12 alkyl chain, R2 and R3 are C1-C3 alkyl or Rs I
-'~ CH2-CH-Q ~H
where R5 is H or CH3 and x = 1-2.
Also preferred are the amidoamines of the formula:

I I
Ri -C-NH-( CH2 )-N-( R2 ) n 2 3o wherein R1 is Cg-C12 alkyl; n is 2-4, preferably n is 3; R2 and R3 is C1-C4 Most preferred amines of the present invention include 1-octylamine, 1-hexylamine, 1-decylamine, 1-dodecylamine,CB-10oxypropylamine, N coco 1-3diaminopropane, coconutalkyldimethylamine, lauryldimethylamine, lauryl bis(hydroxyethyl)amine, coco bis(hydroxyehtyl)amine, lauryl amine 2 moles propoxylated, octyl amine 2 moles propoxylated, lauryl amidopropyldimethylamine, C8-10 amidopropyldimethylamine and C10 amidopropyldimethylamine.
The most preferred amines for use in the compositions herein are 1-hexylamine, 1-octylamine, 1-decylamine, 1-dodecylamine. Especially desirable are n-dodecyldimethylamine and bishydroxyethylcoconutalkylamine and oleylamine 7 times ethoxylated, lauryl amido propylamine and cocoamido propylamine.
Conventional detergent enzymes The detergent compositions can in addition to the mannanase and protease enzymes further comprise one or more enzymes which provide cleaning performance, fabric care andlor sanitisation benefits.
2o Said enzymes include enzymes selected from cellulases, hemicellulases, peroxidases, gluco-amylases, amylases, xylanases, lipases, phosphoiipases, esterases, cutinases, pectinases, keratanases, reductases, oxidases, phenoioxidases, lipoxygenases, iigninases, pullulanases, tannases, pentosanases, mafanases, f3-glucanases, arabinosidases, hyaluronidase, chondroitinase, laccase or mixtures thereof.
A preferred combination is a detergent composition having cocktail of conventional applicable enzymes like amylase, lipase, cutinase andlor cellulase in conjunction with one or more plant cell wall degrading enzymes.
The cellulases usable in the present invention include both bacterial or fungal cellulases. Preferably, they will have a pH optimum of between 5 and 12 and a specific activity above 50 CEVU/mg (Cellulose Viscosity Unit). Suitable cellulases are disclosed in U.S. Patent 4,435,307, Barbesgoard et al, J61078384 and W096I02653 which discloses fungal cellulase produced respectively from Humicola insolens, Trichoderma, Thielavia and Sporotrichum. EP 739 982 describes cellulases isolated from novel Bacillus species. Suitable cellulases are also disclosed in GB-A-2.075.028; GB-A-2.095.275; DE-OS-2.247.832 and W095/26398.
Examples of such cellulases are cellulases produced by a strain of Humicofa insolens (Humicola grisea var. thermoidea), particularly the Humicola strain DSM
1800.
Other suitable cellulases are cellulases originated from Humicola insolens having a molecular weight of about 50KDa, an isoelectric point of 5.5 and containing amino acids; and a -43kD endoglucanase derived from Humicola insolens, DSM
1800, exhibiting cellulase activity; a preferred endoglucanase component has the amino acid sequence disclosed in PCT Patent Application No. WO 91/17243.
Also suitable cellulases are the EGIII cellulases from Trichoderma longibrachiaturn described in W094121801, Genencor, published September 29, 1994. Especially suitable cellulases are the cellulases having color care benefits.
~5 Examples of such cellulases are cellulases described in European patent application No. 91202879.2, filed November 6, 1991 (Novo). Carezyme and Celluzyme (Novo Nordisk A/S) are especially useful. See also W091/17244 and W091/21801. Other suitable cellulases for fabric care and/or cleaning properties are described in W096134092, W096/17994 and W095/24471.
2o Said cellulases are normally incorporated in the detergent composition at levels from 0.0001 % to 2% of pure enzyme by weight of the detergent composition.
Peroxidase enzymes are used in combination with oxygen sources, e.g.
percarbonate, perborate, persulfate, hydrogen peroxide, etc and with a phenolic 25 substrate as bleach enhancing molecule. They are used for "solution bleaching", i.e. to prevent transfer of dyes or pigments removed from substrates during wash operations to other substrates in the wash solution. Peroxidase enzymes are known in the art, and include, for example, horseradish peroxidase, ligninase and haloperoxidase such as chloro- and bromo-peroxidase. Peroxidase-containing 30 detergent compositions are disclosed, for example, in PCT International Application WO 89/099813, W089/09813 and in European Patent application EP
No. 91202882.6, filed on November 6, 1991 and EP No. 96870013.8, filed February 20, 1996. Also suitable is the iaccase enzyme.
Enhancers are generally comprised at a level of from 0.1% to 5% by weight of 35 total composition. Preferred enhancers are substitued phenthiazine and phenoxasine 10-Phenothiazinepropionicacid (PPT), 10-ethylphenothiazine-4 PCT/E1S98/l 1996 carboxylic acid (EPC), 10-phenoxazinepropionic acid (POP) and 10-methylphenoxazine (described in WO 94/12621) and substitued syringates (C3-C5 substitued alkyl syringates) and phenols. Sodium percarbonate or perborate are preferred sources of hydrogen peroxide.
Said peroxidases are normally incorporated in the detergent composition at levels from 0.0001 % to 2% of pure enzyme by weight of the detergent composition.
Other preferred enzymes that can be included in the detergent compositions of the present invention include lipases. Suitable lipase enzymes for detergent usage include those produced by microorganisms of the Pseudomonas group, such as Pseudomonas stutzeri ATCC 19.154, as disclosed in British Patent 1,372,034. Suitable lipases include those which show a positive immunological cross-reaction with the antibody of the lipase, produced by the microorganism ~5 Pseudomonas fluorescent IAM 1057. This lipase is available from Amano Pharmaceutical Co. Ltd., Nagoya, Japan, under the trade name Lipase P
"Amano," hereinafter referred to as "Amano-P". Other suitable commercial lipases include Amano-CES, lipases ex Chromobacter viscosum, e.g.
Chromobacter viscosum var. lipolyticum NRRLB 3673 from Toyo Jozo Co., 2o Tagata, Japan; Chromobacter viscosum lipases from U.S. Biochemical Corp., U.S.A. and Disoynth Co., The Netherlands, and lipases ex Pseudomonas gladioli. Especially suitable lipases are lipases such as M1 LipaseR and LipomaxR (Gist-Brocades) and LipolaseR and Lipolase UitraR(Novo) which have found to be very effective when used in combination with the compositions of the 25 present invention. Also suitables are the lipolytic enzymes described in EP

068, WO 92/05249 and WO 95122615 by Novo Nordisk and in WO 94/03578, WO 95135381 and WO 96/00292 by Unilever.
Also suitable are cutinases [EC 3.1.1.50] which can be considered as a special kind of lipase, namely lipases which do not require interfacial activation.
Addition 30 of cutinases to detergent compositions have been described in e.g. WO-A
88109367 (Genencor); WO 90109446 (Plant Genetic System) and WO 94/14963 and WO 94/14964 (Unilever).
The lipases and/or cutinases are normally incorporated in the detergent composition at levels from 0.0001 % to 2% of pure enzyme by weight of the 35 detergent composition.

Amylases (a andlor f3) can be included for removal of carbohydrate-based stains.
W094/02597, Novo Nordisk AlS published February 03, 1994, describes detergent compositions which incorporate mutant amylases. See also W095110603, Novo Nordisk A/S, published April 20, 1995. Other amylases s known for use in detergent compositions include both a- and ~i-amylases. a-Amylases are known in the art and include those disclosed in US Pat. no.
5,003,257; EP 252,666; W0/91100353; FR 2,676,456; EP 285,123; EP 525,610;
EP 368,341; and British Patent specification no. 1,296,839 (Novo). Other suitable amylases are stability-enhanced amylases described in W094/18314, published 1o August 18, 1994 and W096I05295, Genencor, published February 22, 1996 and amylase variants having additional modification in the immediate parent available from Novo Nordisk AIS, disclosed in WO 95110603, published April 95. Also suitable are amylases described in EP 277 216, W095I26397 and W096/23873 (all by Novo Nordisk).
~5 Examples of commercial a-amylases products are Purafect Ox Am~ from Genencor and Termamyl~, Ban~ ,Fungamyl~ and Duramyl~, all available from Novo Nordisk AIS Denmark. W095I26397 describes other suitable amylases : a-amylases characterised by having a specific activity at least 25% higher than the specific activity of Termamyl~ at a temperature range of 25°C to 55°C and at a 2o pH value in the range of 8 to 10, measured by the Phadebas~ a-amylase activity assay. Suitable are variants of the above enzymes, described in W096123873 (Novo Nordisk). Other amylolytic enzymes with improved properties with respect to the activity level and the combination of thermostability and a higher activity level are described in W095/35382.
25 The amylolytic enzymes are incorporated in the detergent compositions of the present invention a level of from 0.0001 % to 2%, preferably from 0.00018% to 0.06%, more preferably from 0.00024% to 0.048% pure enzyme by weight of the composition.
3o The above-mentioned enzymes may be of any suitable origin, such as vegetable, animal, bacterial, fungal and yeast origin. Origin can further be mesophilic or extremophilic (psychrophilic, psychrotrophic, thermophilic, barophiiic, alkalophilic, acidophilic, halophilic, etc.). Purified or non-purified forms of these enzymes may be used. Nowadays, it is common practice to modify wild-type enzymes via 35 protein I genetic engineering techniques in order to optimise their performance efficiency in the detergent compositions of the invention. For example, the ~0 variants may be designed such that the compatibility of the enzyme to commonly encountered ingredients of such compositions is increased. Alternatively, the variant may be designed such that the optimal pH, bleach or chelant stability, catalytic activity and the like, of the enzyme variant is tailored to suit the particular cleaning application.
In particular, attention should be focused on amino acids sensitive to oxidation in the case of bleach stability and on surface charges for the surfactant compatibility. The isoelectric point of such enzymes may be modified by the substitution of some charged amino acids, e.g. an increase in isoelectric point may help to improve compatibility with anionic surfactants. The stability of the enzymes may be further enhanced by the creation of e.g. additional salt bridges and enforcing calcium binding sites to increase chelant stability. Special attention must be paid to the cellulases as most of the cellulases have separate binding domains (CBD). Properties of such enzymes can be altered by modifications in these domains.
Said enzymes are normally incorporated in the detergent composition at levels from 0.0001 % to 2% of pure enzyme by weight of the detergent composition. The 2o enzymes can be added as separate single ingredients (priils, granulates, stabilized liquids, etc. containing one enzyme ) or as mixtures of two or more enzymes (e.g., cogranulates ).
Other suitable detergent ingredients that can be added are enzyme oxidation scavengers which are described in Co-pending European Patent application 92870018.6 filed on January 31, 1992. Examples of such enzyme oxidation scavengers are ethoxylated tetraethylene polyamines.
A range of enzyme materials and means for their incorporation into synthetic 3o detergent compositions is also disclosed in WO 9307263 A and WO 9307260 A
to Genencor International, WO 8908694 A to Novo, and U.S. 3,553,139, January 5, 1971 to McCarty et al. Enzymes are further disclosed in U.S. 4,101,457, Pface et al, July 18, 1978, and in U.S. 4,507,219, Hughes, March 26, 1985. Enzyme materials useful for liquid detergent formulations, and their incorporation into such formulations, are disclosed in U.S. 4,261,868, Hora et al, April 14, 1981.
Enzymes for use in detergents can be stabilised by various techniques. Enzyme stabilisation techniques are disclosed and exemplified in U.S. 3,600,319, August 17, 1971, Gedge et al, EP 199,405 and EP 200,586, October 29, 1986, Venegas. Enzyme stabilisation systems are also described, for example, in U.S.
3,519,570. A useful Bacillus, sp. AC13 giving proteases, xylanases and cellulases, is described in WO 9401532 A to Novo.
Color care and fabric care benefits Technologies which provide a type of color care benefit can also be included.
Examples of these technologies are metallo catalysts for color maintenance.
Such metallo catalysts are described in co-pending European Patent Application No. 92870181.2. Dye fixing agents, polyolefin dispersion for anti-wrinkles and improved water absorbancy, pertume and amino-functional polymer (PCT/US97116546) for color care treatment and perfume substantivity are further ~ 5 examples of color care / fabric care technologies and are described in the co-pending Patent Application No. 96870140.9, filed November 07, 1996.
Fabric softening agents can also be incorporated into detergent compositions in accordance with the present invention. These agents may be inorganic or 20 organic in type. Inorganic softening agents are exemplified by the smectite clays disclosed in GB-A-1 400 898 and in USP 5,019,292. Organic fabric softening agents include the water insoluble tertiary amines as disclosed in GB-A1 514 and EP-BO 011 340 and their combination with mono C12-C14 quaternary ammonium salts are disclosed in EP-B-0 026 527 and EP-B-0 026 528 and di-25 long-chain amides as disclosed in EP-B-0 242 919. Other useful organic ingredients of fabric softening systems include high molecular weight polyethylene oxide materials as disclosed in EP-A-0 299 575 and 0 313 146.
Levels of smectite clay are normally in the range from 2% to 20%, more 3o preferably from 5% to 15% by weight, with the material being added as a dry mixed component to the remainder of the formulation. Organic fabric softening agents such as the water-insoluble tertiary amines or dilong chain amide materials are incorporated at levels of from 0.5% to 5% by weight, normally from 1 % to 3% by weight whilst the high molecular weight polyethylene oxide 35 materials and the water soluble cationic materials are added at levels of from 0.1 % to 2%, normally from 0.15% to 1.5% by weight. These materials are WO 99/09128 PCTIUS98/1199b normally added to the spray dried portion of the composition, although in some instances it may be more convenient to add them as a dry mixed particulate, or spray them as molten liquid on to other solid components of the composition.
Chelating Agents The detergent compositions herein may also optionally contain one or more iron andlor manganese chelating agents. Such chelating agents can be selected from the group consisting of amino carboxylates, amino phosphonates, 1o polyfunctionally-substituted aromatic chelating agents and mixtures therein, all as hereinafter defined. Without intending to be bound by theory, it is believed that the benefit of these materials is due in part to their exceptional ability to remove iron and manganese ions from washing solutions by formation of soluble chelates.
Amino carboxylates useful as optional chelating agents include ethylenediaminetetracetates, N-hydroxyethylethylenediaminetriacetates, nitrilo-triacetates, ethylenediamine tetraproprionates, triethylenetetraaminehexacetates, diethylenetriaminepentaacetates, and ethanoldiglycines, alkali metal, ammonium, and substituted ammonium salts therein and mixtures therein.
Amino phosphonates are also suitable for use as chelating agents in the compositions of the invention when at lease low levels of total phosphorus are permitted in detergent compositions, and include ethylenediaminetetrakis (methylenephosphonates) as DEQUEST. Preferably, these amino phosphonates do not contain alkyl or alkenyl groups with more than about 6 carbon atoms.
Polyfunctionally-substituted aromatic chelating agents are also useful in the compositions herein. See U.S. Patent 3,812,044, issued May 21, 1974, to Connor et al. Preferred compounds of this type in acid form are dihydroxydisulfobenzenes such as 1,2-dihydroxy-3,5-disulfobenzene.
A preferred biodegradable chelator for use herein is ethylenediamine disuccinate ("EDDS"), especially the [S,S] isomer as described in U.S. Patent 4,704,233, November 3, 1987, to Hartman and Perkins.

The compositions herein may also contain water-soluble methyl glycine diacetic acid (MGDA) salts (or acid form) as a chefant or co-builder useful with, for example, insoluble builders such as zeolites, layered silicates and the like.
If utilized, these chelating agents will generally comprise from about 0.1 %
to about 15% by weight of the detergent compositions herein. More preferably, if utilized, the chelating agents will comprise from about 0.1 % to about 3.0% by weight of such compositions.
Suds suppressor Another optional ingredient is a suds suppressor, exemplified by silicones, and silica-silicone mixtures. Silicones can be generally represented by alkylated polysiloxane materials while silica is normally used in finely divided forms ~5 exemplified by silica aerogels and xerogels and hydrophobic silicas of various types. These materials can be incorporated as particulates in which the suds suppressor is advantageously releasably incorporated in a water-soluble or water-dispersible, substantially non-surface-active detergent impermeable carrier. Alternatively the suds suppressor can be dissolved or dispersed in a liquid carrier and applied by spraying on to one or more of the other components.
A preferred silicone suds controlling agent is disclosed in Bartollota et al.
U.S.
Patent 3 933 672. Other particularly useful suds suppressors are the self-emulsifying silicone suds suppressors, described in German Patent Application DTOS 2 646 126 published April 28, 1977. An example of such a compound is DC-544, commercially available from Dow Corning, which is a siloxane-glycol copolymer. Especially preferred suds controlling agent are the suds suppressor system comprising a mixture of silicone oils and 2-alkyl-alcanols. Suitable 2-alkyl-alkanols are 2-butyl-octanol which are commercially available under the trade name Isofol 12 R.
3o Such suds suppressor system are described in Co-pending European Patent application N 92870174.7 filed 10 November, 1992.
Especially preferred silicone suds controlling agents are described in co-pending European Patent application N°92201649.8. Said compositions can comprise a silicone/silica mixture in combination with fumed nonporous silica such as AerosilR.

The suds suppressors described above are normally employed at levels of from 0.001 % to 2% by weight of the composition, preferably from 0.01 % to 1 % by weight.
Others Other components used in detergent compositions may be employed, such as soil-suspending agents, soil-release agents, optical brighteners, abrasives, bactericides, tarnish inhibitors, coloring agents, andlor encapsulated or non-encapsulated perfumes.
Especially suitable encapsulating materials are water soluble capsules which consist of a matrix of polysaccharide and polyhydroxy compounds such as described in GB 1,464,616. Other suitable water soluble encapsulating materials ~5 comprise dextrins derived from ungelatinized starch acid-esters of substituted dicarboxylic acids such as described in US 3,455,838. These acid-ester dextrins are,preferably, prepared from such starches as waxy maize, waxy sorghum, sago, tapioca and potato. Suitable examples of said encapsulating materials include N-Lok manufactured by National Starch. The N-Lok encapsulating 2o material consists of a modified maize starch and glucose. The starch is modified by adding monofunctional substituted groups such as octenyi succinic acid anhydride.
Antiredepasition and soil suspension agents suitable herein include cellulose 25 derivatives such as methylcellulose, carboxymethylceliulose and hydroxyethylcellulose, and homo- or co-polymeric polycarboxylic acids or their salts. Polymers of this type include the polyacrylates and malefic anhydride-acrylic acid copolymers previously mentioned as builders, as well as copolymers of malefic anhydride with ethylene, methylvinyl ether or methacrylic acid, the 3o malefic anhydride constituting at least 20 mole percent of the copolymer.
These materials are normally used at levels of from 0.5% to 10% by weight, more preferably from 0.75% to 8%, most preferably from 1 % to 6% by weight of the composition.
35 Preferred optical brighteners are anionic in character, examples of which are disodium 4,4'-bis-(2-diethanolamino-4-anilino -s- triazin-6-ylamino)stilbene-2:2' disulphonate, disodium 4, - 4'-bis-{2-morpholino-4-anilino-s-triazin-6-ylamino-stilbene-2:2' - disulphonate, disodium 4,4' - bis-(2,4-dianilino-s-triazin-6-ylamino)stilbene-2:2' - disulphonate, monosodium 4',4" -bis-(2,4-dianilino-s-tri-azin-6 ylamino)stilbene-2-sulphonate, disodium 4,4' -bis-(2-anilino-4-(N-methyl-N-5 2-hydroxyethylamino)-s-triazin-6-ylamino)stilbene-2,2' - disulphonate, di-sodium 4,4' -bis-(4-phenyl-2,1,3-triazol-2-yl)-stilbene-2,2' disulphonate, di-so-dium 4,4'bis(2-anilino-4-(1-methyl-2-hydroxyethylamino)-s-triazin-6- ylami-no)stilbene-2,2'disulphonate, sodium 2{stilbyl-4"-(naphtho-1',2':4,5)-1,2,3 - triazole-2"-sulphonate and 4,4'-bis(2-sulphostyryl)biphenyl. Highly preferred brighteners are the specific brighteners disclosed in EP 753 567.
Other useful polymeric materials are the polyethylene glycols, particularly those of molecular weight 1000-10000, more particularly 2000 to 8000 and most preferably about 4000. These are used at levels of from 0.20% to 5% more ~5 preferably from 0.25% to 2.5% by weight. These polymers and the previously mentioned homo- or co-polymeric polycarboxylate salts are valuable for improving whiteness maintenance, fabric ash deposition, and cleaning performance on clay, proteinaceous and oxidizable soils in the presence of transition metal impurities.
Soil release agents useful in compositions of the present invention are conventionally copolymers or terpolymers of terephthalic acid with ethylene glycol andlor propylene glycol units in various arrangements. Examples of such polymers are disclosed in the commonly assigned US Patent Nos. 4116885 and 2s 4711730 and European Published Patent Application No. 0 272 033. A
particular preferred polymer in accordance with EP-A-0 272 033 has the formula (CH3(PEG)43)0.75(POH)0.25IT-PO)2.8(T-PEG)p.4lT(PO
H)0.25((PEG)43CH3)0.75 where PEG is -(OC2H4)O-,PO is (OC3Hg0) and T is (pcOCgH4C0).
Also very useful are modified polyesters as random copolymers of dimethyl terephthalate, dimethyl sulfoisophthalate, ethylene glycol and 1-2 propane diol, the end groups consisting primarily of sulphobenzoate and secondarily of mono esters of ethylene glycol andlor propane-diol. The target is to obtain a polymer capped at both end by sulphobenzoate groups, "primarily", in the present context most of said copolymers herein will be end-capped by sulphobenzoate groups.
However, some copolymers will be less than fully capped, and therefore their end groups may consist of monoester of ethylene glycol and/or propane 1-2 diol, thereof consist "secondarily" of such species.
The selected polyesters herein contain about 46% by weight of dimethyf terephthalic acid, about 16% by weight of propane -1.2 diol, about 10% by weight ethylene glycol about 13% by weight of dimethyl sulfobenzoic acid and about 15% by weight of sulfoisophthalic acid, and have a molecular weight of about 3.000. The polyesters and their method of preparation are described in detail in EPA 311 342.
It is well-known in the art that free chlorine in tap water rapidly deactivates the enzymes comprised in detergent compositions. Therefore, using chlorine 'S scavenger such as perborate, ammonium sulfate, sodium sulphite or polyethyleneimine at a level above 0.1 % by weight of total composition, in the formulas will provide improved through the wash stability of the detergent enzymes. Compositions comprising chlorine scavenger are descri4ed in the European patent application 92870018.6 filed January 31, 1992.
Alkoxylated polycarboxylates such as those prepared from polyacrylates are useful herein to provide additional grease removal performance. Such materials are described in WO 91/08281 and PCT 90/01815 at p. 4 et seq., incorporated herein by reference. Chemically, these materials comprise polyacrylates having one ethoxy side-chain per every 7-8 acrylate units. The side-chains are of the formula -(CH2CH20)m(CH2)nCH3 wherein m is 2-3 and n is 6-12. The side-chains are ester-linked to the polyacrylate "backbone" to provide a "comb"
polymer type structure. The molecular weight can vary, but is typically in the range of about 2000 to about 50,000. Such alkoxylated polycarboxylates can 3o comprise from about 0.05% to about 10%, by weight, of the compositions herein.
Dispersants The detergent compositions of the present invention can also contain dispersants Suitable water-soluble organic salts are the homo- or co-polymeric acids or their *rB

salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms. Polymers of this type are disclosed in GB-A-1,596,756. Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with malefic anhydride, such copolymers having a molecular weight of from 1,000 to 100,000.
Especially, copolymer of acrylate and methylacrylate such as the 480N having a molecular weight of 4000, at a level from 0.5-20% by weight of composition can be added in the detergent compositions of the present invention.
1o The compositions of the invention may contain a lime soap peptiser compound, which has preferably a lime soap dispersing power (LSDP), as defined hereinafter of no more than 8, preferably no more than 7, most preferably no more than 6. The lime soap peptiser compound is preferably present at a level from 0% to 20% by weight.
A numerical measure of the effectiveness of a lime soap peptiser is given by the lime soap dispersant power (LSDP) which is determined using the lime soap dispersant test as described in an article by H.C. Borghetty and C.A. Bergman, J.
Am. Oif. Chem. Soc., volume 27, pages 88-90, (1950). This lime soap dispersion 2o test method is widely used by practitioners in this art field being referred to, for example, in the following review articles; W.N. Linfield, Surfactant science Series, Volume 7, page 3; W.N. Linfield, Tenside surf. det., volume 27, pages 159-163, (1990); and M.K. Nagarajan, W.F. Masler, Cosmetics and Toiletries, volume 104, pages 71-73, (1989). The LSDP is the % weight ratio of dispersing agent to sodium oieate required to disperse the lime soap deposits formed by 0.025g of sodium oleate in 30m1 of water of 333ppm CaCa3 (Ca:Mg=3:2) equivalent hardness.
Surfactants having good lime soap peptiser capability will include certain amine oxides, betaines, sulfobetaines, alkyl ethoxysulfates and ethoxylated aicohols.
Exemplary surfactants having a LSDP of no more than 8 for use in accord with the present invention include C1g-C1g dimethyl amine oxide, C12-C1g alkyl ethoxysulfates with an average degree of ethoxyiation of from 1-5, particularly C12-C15 alkyl ethoxysulfate surfactant with a degree of ethoxylation of amount (LSDP=4), and the C14-C15 ethoxylated alcohols with an average degree of ethoxylation of either 12 (LSDP=6) or 30, sold under the tradenames Lutensol A012 and Lutensol A030 respectively, by BASF GmbH.
Polymeric lime soap peptisers suitable for use herein are described in the article by M.K. Nagarajan, W.F. Masler, to be found in Cosmetics and Toiletries, volume 104, pages 71-73, (1989).
Hydrophobic bleaches such as 4-[N-octanoyl-6-aminohexanoyl]benzene sulfonate, 4-[N-nonanoyl-6-aminohexanoyl]benzene sulfonate, 4-[N-decanoyl-6-aminohexanoyl]benzene sulfonate and mixtures thereof; and nonanoyloxy benzene sulfonate together with hydrophilic / hydrophobic bleach formulations can also be used as lime soap peptisers compounds.
Dye transfer inhibition The detergent compositions of the present invention can also include compounds for inhibiting dye transfer from one fabric to another of solubilized and suspended dyes encountered during fabric laundering operations involving colored fabrics.
2o Polymeric dye transfer inhibiting agents The detergent compositions according to the present invention also comprise from 0.001 % to 10 %, preferably from 0.01 % to 2%, more preferably from 0.05%
to 1 % by weight of polymeric dye transfer inhibiting agents. Said polymeric dye transfer inhibiting agents are normally incorporated into detergent compositions in order to inhibit the transfer of dyes from colored fabrics onto fabrics washed therewith. These polymers have the ability to complex or adsorb the fugitive dyes washed out of dyed fabrics before the dyes have the opportunity to become attached to other articles in the wash.
3o Especially suitable polymeric dye transfer inhibiting agents are polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinylpyrrolidone polymers, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof.
Addition of such polymers also enhances the performance of the enzymes according the invention.

a) Polyamine N-oxide polymers The polyarnine N-oxide polymers suitable for use contain units having the following structure formula P
I
(I) Ax R
wherein P is a polymerisable unit, whereto the R-N-O group can be attached to or 1o wherein the R-N-O group forms part of the polymerisable unit or a combination of both.
O O O
II II II
A is NC, CO, C, -O-,-S-, -N- ; x is O or 1;
R are aliphatic, ethoxylated aliphatics, aromatic, heterocyclic or alicyclic groups or any combination thereof whereto the nitrogen of the N-O group can be attached or wherein the nitrogen of the N-O group is part of these groups.
2o The N-O group can be represented by the following general structures O O
I I
(R1)x -N- (R2)y =N- (R1)x I
(R3)z wherein R1, R2, and R3 are aliphatic groups, aromatic, heterocyclic or alicyclic groups or combinations thereof, x or/and y or/and z is 0 or 1 and wherein the 3o nitrogen of the N-O group can be attached or wherein the nitrogen of the N-O
group forms part of these groups.
The N-O group can be part of the polymerisable unit (P) or can be attached to the polymeric backbone or a combination of both.

Suitable polyamine N-oxides wherein the N-O group forms part of the polymerisable unit comprise polyamine N-oxides wherein R is selected from aliphatic, aromatic, alicyciic or heterocyclic groups.
One class of said polyamine N-oxides comprises the group of polyamine N
5 oxides wherein the nitrogen of the N-O group forms part of the R-group.
Preferred polyamine N-oxides are those wherein R is a heterocyclic group such as pyrridine, pyrrole, imidazole, pyrrolidine, piperidine, quinoline, acridine and derivatives thereof.
Another class of said polyamine N-oxides comprises the group of polyamine N-oxides wherein the nitrogen of the N-O group is attached to the R-group.
Other suitable polyamine N-oxides are the polyamine oxides whereto the N-O
group is attached to the polymerisable unit.
Preferred class of these polyamine N-oxides are the polyamine N-oxides having ~5 the general formula (I) wherein R is an aromatic, heterocyclic or alicyclic groups wherein the nitrogen of the N-0 functional group is part of said R group.
Examples of these classes are polyamine oxides wherein R is a heterocyclic compound such as pyrridine, pyrrole, imidazole and derivatives thereof.
Another preferred class of polyamine N-oxides are the polyamine oxides having 2o the general formula (I) wherein R are aromatic, heterocyclic or alicyclic groups wherein the nitrogen of the N-0 functional group is attached to said R groups.
Examples of these classes are polyamine oxides wherein R groups can be aromatic such as phenyl.
25 Any polymer backbone can be used as long as the amine oxide polymer formed is water-soluble and has dye transfer inhibiting properties. Examples of suitable polymeric backbones are pofyvinyls, polyalkylenes, polyesters, polyethers, polyamide, polyimides, polyacrylates and mixtures thereof.
3o The amine N-oxide polymers of the present invention typically have a ratio of amine to the amine N-oxide of 10:1 to 1:1000000. However the amount of amine oxide groups present in the polyamine oxide polymer can be varied by appropriate copolymerization or by appropriate degree of N-oxidation.
Preferably, the ratio of amine to amine N-oxide is from 2:3 to 1:1000000. More preferably 35 from 1:4 to 1:1000000, most preferably from 1:7 to 1:1000000. The polymers of the present invention actually encompass random or block copolymers where one monomer type is an amine N-oxide and the other monomer type is either an amine N-oxide or not. The amine oxide unit of the polyamine N-oxides has a PKa < 10, preferably PKa < 7, more preferred PKa < 6.
The polyamine oxides can be obtained in almost any degree of polymerisation.
The degree of polymerisation is not critical provided the material has the desired water-solubility and dye-suspending power.
Typically, the average molecular weight is within the range of 500 to 1000,000;
preferably from 1,000 to 50,000, more preferably from 2,000 to 30,000, most preferably from 3,000 to 20,000.
b) Copolymers of N-vinylpyrrolidone and N-vinylimidazole The N-vinylimidazole N-vinylpyrrolidane polymers used in the present invention have an average molecular weight range from 5,000-1,000,000, preferably from 5, 000-200, 000.
Highly preferred polymers for use in detergent compositions according to the present invention comprise a polymer selected from N-vinylimidazole N-vinylpyrrolidone copolymers wherein said polymer has an average molecular weight range from 5,000 to 50,000 more preferably from 8,000 to 30,000, most preferably from 10,000 to 20,000.
2o The average molecular weight range was determined by light scattering as described in Barth H.G. and Mays J.W. Chemical Analysis Vol 113,"Modern Methods of Polymer Characterization".
Highly preferred N-vinylimidazole N-vinylpyrrolidone copolymers have an average molecular weight range from 5,000 to 50,000; more preferably from 8,000 to 30,000; most preferably from 10,000 to 20,000.
The N-vinylimidazole N-vinylpyrrolidone copolymers characterized by having said average molecular weight range provide excellent dye transfer inhibiting properties while not adversely affecting the cleaning performance of detergent 3o compositions formulated therewith.
The N-vinylimidazole N-vinylpyrrolidone copolymer of the present invention has a molar ratio of N-vinylimidazole to N-vinylpyrrolidone from 1 to 0.2, more preferably from 0.8 to 0.3, most preferably from 0.6 to 0.4 .
3s c) Polyvinylpyrrolidone The detergent compositions of the present invention may also utilize polyvinylpyrrolidone ("PVP") having an average molecular weight of from abaut 2,500 to about 400,000, preferably from about 5,000 to about 200,000, more preferably from about 5,000 to about 50,000, and most preferably from about 5,000 to about 15,000. Suitable polyvinylpyrrofidones are commercially available from ISP Corporation, New York, NY and Montreal, Canada under the product names PVP K-15 (viscosity molecular weight of 10,000), PVP K-30 (average molecular weight of 40,000), PVP K-60 (average molecular weight of 160,000), and PVP K-90 (average molecular weight of 360,000). Other suitable polyvinylpyrrolidones which are commercially available from BASF Cooperation include Sokalan HP 165 and Sokalan HP 12; polyvinylpyrrolidones known to persons skilled in the detergent field (see for example EP-A-262,897 and EP-A-256,696).
~5 d) Polyvinyloxazolidone The detergent compositions of the present invention may also utilize polyvinyloxazolidone as a polymeric dye transfer inhibiting agent. Said polyvinyloxazolidones have an average molecular weight of from about 2,500 to about 400,000, preferably from about 5,000 to about 200,000, more preferably 2o from about 5,000 to about 50,000, and most preferably from about 5,000 to about 15, 000.
25 e) Polyvinylimidazole The detergent compositions of the present invention may also utilize polyvinylimidazole as polymeric dye transfer inhibiting agent. Said polyvinylimidazoles have an average about 2,500 to about 400,000, preferably from about 5,000 to about 200,000, more preferably from about 5,000 to about 30 50,000, and most preferably from about 5,000 to about 15,000.
f) Cross-linked polymers Cross-linked polymers are polymers whose backbone are interconnected to a certain degree; these Links can be of chemical or physical nature, possibly with 35 active groups n the backbone or on branches; cross-linked polymers have been described in the Journal of Polymer Science, volume 22, pages 1035-1039.

In one embodiment, the cross-linked polymers are made in such a way that they form a three-dimensional rigid structure, which can entrap dyes in the pores formed by the three-dimensional structure. In another embodiment, the cross-linked polymers entrap the dyes by swelling. Such cross-linked polymers are described in the co-pending patent application 94870213.9 Method of washing The compositions of the invention may be used in essentially any washing or cleaning methods, including soaking methods, pretreatment methods and methods with rinsing steps for which a separate rinse aid composition may be added.
~5 The process described herein comprises contacting fabrics, dishware or any other hard surface with a cleaning solution in the usual manner and exemplified hereunder.
The process of the invention is conveniently carried out in the course of the 2o cleaning process. The method of cleaning is preferably carried out at 5°C to 95°C, especially between 10°C and 60°C. The pH of the treatment solution is preferably from 7 to 12.
A preferred machine dishwashing method comprises treating soiled articles with 25 an aqueous liquid having dissolved or dispensed therein an effective amount of the machine diswashing or rinsing composition. A conventional effective amount of the machine dishwashing composition means from 8-60 g of product dissolved or dispersed in a wash volume from 3-10 litres. According to a manual dishwashing method, soiled dishes are contacted with an effective amount of the 3o diswashing composition, typically from 0.5-20g (per 25 dishes being treated}.
Preferred manual dishwashing methods include the application of a concentrated solution to the surfaces of the dishes or the soaking in large volume of dilute solution of the detergent composition.

The following examples are meant to exemplify compositions of the present invention, but are not necessarily meant to limit or otherwise define the scope of the invention.
s In the detergent compositions, the enzymes levels are expressed by pure enzyme by weight of the total composition and unless otherwise specified, the detergent ingredients are expressed by weight of the total compositions. The abbreviated component identifications therein have the following meanings:
LAS : Sodium linear C11-13 alkyl benzene sulphonate.

TAS : Sodium tallow alkyl sulphate.

CxyAS : Sodium C1x - C1y alkyl sulfate.

CxySAS : Sodium C1x - C1y secondary (2,3) alkyl sulfate.

CxyEz : C1x - C1y predominantly linear primary alcohol condensed with an average of z moles of ethylene oxide.

CxyEzS : C1x - C1y sodium alkyl sulfate condensed with an average of z moles of ethylene oxide.

QAS : R2.N+(CH3)2(C2H40H) with R2 = C12-C14-QAS 1 : R2.N+(CH3)2(C2H40H) with R2 = Cg-C11.

APA : Cg_10 amido propyl dimethyl amine.

Soap : Sodium linear alkyl carboxyfate derived from a 80120 mixture of tallow and coconut fatty acids.

Nonionic : C13-C15 mixed ethoxylatedlpropoxyiated fatty alcohol with an average degree of ethoxylation of 3.8 and an average degree of propoxylation of 4.5.

Neodol 45-13 : C14-C15 linear primary alcohol ethoxylate, sold by Shell Chemical CO.

STS : Sodium toluene sulphonate.

CFAA : C12-C14 alkyl N-methyl glucamide.

TFAA : C1g-C1g alkyl N-methyl glucamide.

TPKFA : C 12-C 14 topped whole cut fatty acids.

Silicate : Amorphous Sodium Silicate (Si02:Na20 ratio = 1.6-3.2).

Metasilicate : Sodium metasilicate (Si02:Na20 ratio = 1.0).

Zeolite A : Hydrated Sodium Aluminosilicate of formula Nal2(A102Si02)12. 27H20 having a primary particle size in the range from 0.1 to 10 micrometers (Weight expressed on an anhydrous basis).

Na-SKS-6 : Crystalline layered silicate of formula b-Na2Si205_ Citrate : Tri-sodium citrate dihydrate of activity 8fi.4% with a particle size distribution between 425 and micrometres.

Citric : Anhydrous citric acid.

Borate : Sodium borate Carbonate : Anhydrous sodium carbonate with a particle size between 200 and 900 micrometres.

Bicarbonate : Anhydrous sodium hydrogen carbonate with a particle size distribution between 400 and 1200 micrometres.

Sulphate : Anhydrous sodium sulphate.

Mg Sulphate : Anhydrous magnesium sulfate.

STPP : Sodium tripolyphosphate.

TSPP : Tetrasodium pyrophosphate.

MA/AA : Random copolymer of 4:1 acrylate/maleate, average molecular weight about 70,000-80,000.

MA/AA 1 : Random copolymer of 6:4 acrylatelmaleate, average molecular weight about 10,000.

AA : Sodium polyacrylate polymer of average molecular weight 4,500.

PA30 : Polyacrylic acid of average molecular weight of between about 4,500 - 8,000.

480N : Random copolymer of 7:3 acrylate/methacrylate, average molecular weight about 3,500.

Polygellcarbopol: High molecular weight crosslinked polyacrylates.

PB1 : Anhydrous sodium perborate monohydrate of nominal formula NaB02.H202.

PB4 : Sodium perborate tetrahydrate of nominal formula NaB02.3H20. H202.

Percarbonate : Anhydrous sodium percarbonate of nominal formula 2Na2C03.3H202 .

NaDCC : Sodium dichforoisocyanurate.

TAED : Tetraacetylethylenediamine.

NOBS : Nonanoyloxybenzene sulfonate in the form of the sodium salt.

NACA-OBS : (6-nonamidocaproyl) oxybenzene sulfonate.

DTPA : Diethylene triamine pentaacetic acrd.

HEDP : 1,1-hydroxyethane diphosphonic acid.

DETPMP : Diethyltriamine penta (methylene) phosphonate, marketed by Monsanto under the Trade name bequest 2060.

EDDS : Ethylenediamine-N,N'-disuccinic acid, (S,S) isomer in the form of its sodium salt MnTACN : Manganese 1,4,7-trimethyl-1,4,7-triazacyclononane.

Photoactivated: Sulfonated zinc phtalocyanine encapsulated in dextrin Bleach soluble polymer.

Photoactivated: Sulfonated alumino phtalocyanine encapsulated in Bleach 1 dextrin soluble polymer.

PAAC : Pentaamine acetate cobalt(///) salt.

Paraffin : Paraffin oil sold under the tradename Winog 70 by Wintershall.

NaBz : Sodium benzoate.

BzP : Benzoyl Peroxide.

Mannanase : Mannanase from Bacillus agaradherens , NCIMB
40482.

Protease : Proteolytic enzyme sold under the tradename Savinase, Alcalase, Durazym by Novo Nordisk A/S, Maxacal, Maxapem sold by Gist-Brocades and proteases described in patents W091I06637 andlor W095110591 and/or EP 251 446.

Amylase : Amylolytic enzyme sold under the tradename Purafact Ox AmR described in WO 94/18314, W096105295 sold by Genencor; Termamyl~, Fungamyl~ and Duramyi~, all available from Novo Nordisk A/S and those described in W095126397.

Lipase : Lipolytic enzyme sold under the tradename Lipolase, Lipoiase Ultra by Novo Nordisk A/S and Lipomax by Gist-Brocades.

Celluiase : Cellulytic enzyme sold under the tradename Carezyme, Celluzyme and/or Endolase by Novo Nordisk AIS.

CMC : Sodium carboxymethyl cellulose.

PVP : Polyvinyl polymer, with an average molecular weight of 60, 000.

PVNO : Polyvinylpyridine-N-Oxide, with an average molecular weight of 50,000.

PVPVI : Copolymer of vinylimidazole and vinylpyrrolidone, with an average molecular weight of 20,000.

Brightener 1 : Disodium 4,4'-bis(2-sulphostyryl)biphenyl.

Brightener 2 : Disodium 4,4'-bis(4-anilino-6-morpholino-1.3.5-triazin-2-yl) stilbene-2:2'-disulfonate.

Silicone antifoam: Polydimethylsiloxane foam controller with siloxane-oxyalkylene copolymer as dispersing agent with a ratio of said foam controller to said dispersing agent of 10:1 to 100:1.

Suds Suppressor: 12% Silicone/silica, 18% stearyl alcoho1,70%
starch in granular form.

Opacifier : Water based monostyrene latex mixture, sold by BASF

Aktiengesellschaft under the tradename Lytron 621.

SRP 1 : Anionically end capped poly esters.

SRP 2 : Diethoxylated poly (1,2 propylene terephthalate) short block polymer.

QEA : bis((C2H50)(C2H40)n)(CH3) -N+-C6H12-N+-(CH3) bis((C2H50)-(C2H4O))n, wherein n = from 20 to 30.

PEi : Polyethyleneimine with an average molecular weight of 1800 and an average ethoxylation degree of ethyleneoxy residues per nitrogen.

SCS : Sodium cumene sulphonate.

HMWPEO : High molecular weight polyethylene oxide.

PEGx : Polyethylene glycol, of a molecular weight of x .

PEO : Polyethylene oxide, with an average molecular weight of 5,000.

TEPAE : Tetreaethylenepentaamine ethoxylate.

BTA : Benzotriazole.

PH : Measured as a 1 % solution in distilled water at 20C.

Example 1 The following high densitylaundrydetergentcompositions prepared were according to the present invention I II III IV V VI

LAS 8.0 8.0 8.0 2.0 6.0 6.0 TAS - 0.5 - 0.5 1.0 0.1 C46(S)AS 2.0 2.5 - - - -C25AS - - - 7.0 4.5 5.5 C68AS 2.0 5.0 7.0 - - -C25E5 - - 3.4 10.0 4.6 4.6 C25E7 3.4 3.4 1.0 - - -C25E3S - - - 2.0 5.0 4.5 QAS - 0.8 - - - _ QAS 1 - - - 0.8 0.5 1.0 Zeolite A 18.1 18.0 14.1 18.1 20.0 18.1 Citric - - - 2.5 - 2.5 Carbonate 13.0 13.0 27.0 10.0 10.0 13.0 Na-SKS-6 - - - 10.0 - 10.0 Silicate 1.4 1.4 3.0 0.3 0.5 0.3 Citrate - 1.0 - 3.0 -Sulfate 26.1 26.1 26.1 6.0 - -Mg sulfate 0.3 - - 0.2 - 0.2 MA/AA 0.3 0.3 0.3 4.0 1.0 1.0 CMC 0.2 0.2 0.2 0.2 0.4 0.4 PB4 9.0 9.0 5.0 - - -Percarbonate - - - - 18.0 18.0 TAED 1.5 0.4 1.5 - 3.9 4.2 NACA-OBS - 2.0 1.0 - - -DETPMP 0.25 0.25 0.25 0.25 - -SRP 1 - - - 0.2 - 0.2 EDDS - 0.25 0.4 - 0.5 0.5 I II III IV V VI

CFAA - 1.0 - 2.0 - -HEDP 0.3 0.3 0.3 0.3 0.4 0.4 Q~ - - - 0.2 - 0.5 Protease 0.009 0.009 0.01 0.04 0.05 0.03 Mannanase 0.05 0.009 0.03 0.009 0.03 0.009 Amylase 0.002 0.002 0.002 0.006 0.008 0.008 Cellulase 0.0007 - - 0.0007 0.0007 0.0007 Lipase 0.006 - - 0.01 0.01 0.01 Photoactivated 15 15 15 - 20 20 bleach (ppm) PVNOIPVPVI - - - 0.1 - -Brightener 1 0.09 0.09 0.09 - 0.09 0.09 Perfume 0.3 0.3 0.3 0.4 0.4 0.4 Silicone antifoam0.5 0.5 0.5 - 0.3 0.3 Density in gllitre850 850 850 850 850 850 Miscellaneous Up to 100%
and minors Example 2 s The following granular laundry detergent compositions of particular utility under European machine wash conditions were prepared according to the present invention I II III IV V VI

LAS 5.5 7.5 5.0 5.0 6.0 7.0 TAS 1.25 1.9 - 0.8 0.4 0.3 C24AS/C25AS - 2.2 5.0 5.0 5.0 2.2 C25E3S - 0.8 1.0 1.5 3.0 1.0 C45E7 3.25 - - - - 3.0 TFAA - - 2.0 - _ _ C25E5 - 5.5 - - - -QAS 0.8 - - - - -QAS 1 - 0.7 1.0 0.5 1.0 0.7 STPP 19.7 - - - - _ Zeolite A - 19.5 25.0 19.5 20.0 17.0 NaSKS-6/citric - 10.6 - 10.6 - -acid (79:21 ) Na-SKS-6 - - 9.0 - 10.0 10.0 Carbonate 6.1 21.4 9.0 10.0 10.0 18.0 Bicarbonate - 2.0 7.0 5.0 - 2.0 Silicate 6.8 - - 0.3 0.5 -Citrate - - 4.0 4.0 - -Sulfate 39.8 - - 5.0 - 12.0 Mg sulfate - - 0.1 0.2 0.2 -MA/AA 0.5 1.6 3.0 4.0 1.0 1.0 CMC 0.2 0.4 1.0 1.0 0.4 0.4 PB4 5.0 12.7 - - - -Percarbonate - - - - 18.0 15.0 TAED 0.5 3.1 - - 5.0 -NACA-OBS 1.0 3.5 - - - 2.5 DETPMP 0.25 0.2 0.3 0.4 - 0.2 HEDP - 0.3 - 0.3 0.3 0.3 Q EA - - 1. 0 1.0 1.0 -Protease 0.009 0.03 0.03 0.05 0.05 0.02 Mannanase 0.03 0.03 0.001 0.03 0.005 0.009 Lipase 0.003 0.003 0.006 0.006 0.006 0.004 Cellulase 0.0006 0.0006 0.0005 0.0005 0.00070.0007 Amylase 0.002 0.002 0.006 0.006 0.01 0.003 PVNO/PVPVI - - 0.2 0.2 - -PVP 0.9 1.3 - - - 0.9 SRP 1 - - 0.2 0.2 0.2 -Photoactivated 15 27 - - 20 20 bleach (ppm) Photoactivated 15 - - - - -bleach 1 (ppm) Brightener 1 0.08 0.2 - - 0.09 0.15 Brightener 2 - 0.04 - - - -Perfume 0.3 0.5 0.4 0.3 0.4 0.3 Silicone antifoam0.5 2.4 0.3 0.5 0.3 2.0 Density in g/litre750 750 750 750 750 750 Miscellaneous and minors Up to 100%

Example 3 The following detergentcompositionsof particularutilityunder European machine wash conditions according were prepared to the present invention I II III IV

Blown Powder LAS 6.0 5.0 11.0 6.0 TAS 2.0 - - 2,0 Zeolite A 24.0 - - 20.0 STPP - 27.0 24.0 -Sulfate 4.0 6.0 13.0 -MAIAA 1.0 4.0 6.0 2.0 Silicate 1.0 7.0 3.0 3.0 CMC 1.0 1.0 0.5 0.6 Brightener 1 0.2 0.2 0.2 0.2 Silicone antifoam 1.0 1.0 1.0 0.3 DETPMP 0.4 0.4 0.2 0.4 Spray On Brightener 0.02 - - 0.02 C45E7 - - - 5.0 C45E2 2.5 2.5 2.0 -C45E3 2.6 ~ 2.5 2.0 -Perfume 0.5 0.3 0.5 0.2 Silicone antifoam 0.3 0.3 0.3 -Dry additives Q EA - - - 1.0 EDDS 0.3 - - -Sulfate 2.0 3.0 5.0 10.0 Carbonate 6.0 13.0 15.0 14.0 Citric 2.5 - - 2.0 QAS 1 0.5 - - 0.5 N a-S KS-6 10. 0 - - -Percarbonate 18.5 - - -I II III IV

PB4 - 18.0 10.0 21.5 TAED 2.0 2.0 - 2.0 NACA-OBS 3.0 2.0 4.0 -Protease 0.03 0.03 0.03 0.03 Mannanase 0.009 0.01 0.03 0.001 Lipase 0.008 0.008 0.008 0.004 Amylase 0.003 0.003 0.003 0.006 Brightener 1 0.05 - - 0.05 Miscellaneous and minors Up to 100%

Example 4 The following granular sitions accordingto detergent compo were the prepared present invention I II III IV V VI

Blown Powder LAS 23.0 8.0 7.0 9.0 7.0 7.0 TAS - - - - 1.0 C45AS 6.0 6.0 5.0 8.0 - -C45AES - 1.0 1.0 1.0 - -C45E35 - - - - 2.0 4.0 Zeolite A 10.0 18.0 14.0 12.0 10.0 10.0 MA/AA - 0.5 - _ _ 2.0 MAIAA 1 7.0 - - - _ _ AA - 3.0 3.0 2.0 3.0 3.0 Sulfate 5.0 6.3 14.3 11.0 15.0 19.3 Silicate 10.0 1.0 1.0 1.0 1.0 1.0 Carbonate 15.0 20.0 10.0 20.7 8.0 6.0 PEG 4000 0.4 1.5 1.5 1.0 1.0 1.0 DTPA - 0.9 0.5 - - 0.5 Brightener 2 0.3 0.2 0.3 - 0.1 0.3 Spray On C45E7 - 2.0 - - 2.0 2.0 G25E9 3.0 - - - - _ I II III IV V VI
C23E9 - - 1.5 2.0 - 2.0 Perfume 0.3 0.3 0.3 2.0 0.3 0.3 Agglomerates C45AS - 5.0 5.0 2.0 - 5,0 LAS - 2.0 2.0 - - 2,0 Zeolite A - 7.5 7.5 8.0 - 7.5 Carbonate - 4.0 4.0 5.0 - 4.0 PEG 4000 - 0.5 0.5 - - 0,5 Misc (Water etc.)- 2.0 2.0 2.0 - 2.0 Dry additives QAS - - - - 1.0 -Citric - - - - 2.0 -PB4 - - - - 12.0 1.0 PB1 4.0 1.0 3.0 2.0 - -Percarbonate - - - - 2.0 10.0 Carbonate - 5.3 1.8 - 4.0 4.0 NOBS 4.0 - 6.0 - - 0.6 Methyl cellulose0.2 - - _ _ _ Na-SKS-8 8.0 - - - - _ STS - - 2.0 - 1.0 -Culmene sulfonic- 1.0 - - - 2.0 acid Protease 0.02 0.02 0.02 0.01 0.02 0.02 Mannanase 0.009 0.01 0.03 0.009 0.01 0.001 Lipase 0.004 - 0.004 - 0.004 0.008 Amylase 0.003 - 0.002 - 0.003 -Celfulase 0.0005 0.0005 0.0005 0.0007 0.0005 0.0005 PVPVI - - - - 0.5 0.1 PVP - - - - 0.5 -PVNO - - 0.5 0.3 - -QEA - - - - 1.0 -SRP 1 0.2 0.5 0.3 - 0.2 -Silicone antifoam0.2 0.4 0.2 0.4 0.1 -Mg sulfate - - _ _ 0.2 0.2 Miscellaneous and minors Up to 100%
Example 5 The following nil bleach-containing detergent compositions of particular use in the washing of colored clothing were prepared according to the present invention ~0 Blown Powder Zeolite A 15.0 15.0 -Suffate - 5.0 -LAS 3.0 3.0 -DETPMP 0.4 0.5 -CMC 0.4 0.4 MAIAA 4.0 4.0 -Agglomerates C45AS - - 11.0 LAS 6.0 5.0 -TAS 3.0 2.0 -Silicate 4.0 4.0 Zeolite A 10.0 15.0 13.0 CMC - - 0.5 M~~ - - 2.0 Carbonate 9.0 1.0 7.0 Spray-on Perfume 0.3 0.3 0.5 C45E7 4.0 4.0 4.0 C25E3 2.0 2.0 2.0 Dry additives M~~ - - 3.0 Na-SKS-6 - - 12.0 Citrate 10.0 - 8.0 Bicarbonate 7.0 3.0 5.0 Carbonate 8.0 5.0 7.0 I I) III
PVPVIIPVNO 0.5 0.5 0.5 Protease 0.03 0.02 0.05 Mannanase 0.001 0.004 0.03 Lipase 0.008 0.008 0.008 Amylase 0.01 0.01 0.01 Celluiase 0.001 0.001 0.001 Silicone antifoam 5.0 5.0 5.0 S a Ifate - 9. -Density (gllitre) 700 700 700 Miscellaneous and minors Up to 100%

Example 6 The following detergent accordingto the present compositions were prepared invention I II III IV

Base granule Zeolite A 30.0 22.0 24.0 10.0 Sulfate 10.0 5.0 10.0 7.0 MAIAA 3.0 - - -AA - 1.6 2.0 -MA/AA 1 - 12.0 - 6.0 , LAS 14.0 10.0 9.0 20.0 C45AS 8.0 7.0 9.0 7.0 C45AES - 1.0 1.0 -Silicate - 1.0 0.5 10.0 Soap - 2.0 - -Brightener 1 0.2 0.2 0.2 0.2 Carbonate 6.0 9.0 10.0 10.0 PEG 4000 - 1.0 1.5 -DTPA - 0.4 - -Spray On C25E9 - - - 5.0 C45E7 1.0 1.0 - -C23E9 - 1.0 2.5 -Perfume 0.2 0.3 0.3 -Dry additives Carbonate 5.0 10.0 18.0 8.0 PVPVI/PVNO 0.5 - 0.3 -Protease 0.03 0.03 0.03 0.02 Mannanase 0.002 0.009 0.015 0.03 Lipase 0.008 - - 0.008 Amylase 0.002 - - 0.002 Cellulase 0.0002 0.0005 0.0005 0.0002 NOBS - 4.0 - 4.5 PB1 1.0 5.0 1.5 6.0 Sulfate 4.0 5.0 - 5.0 SRP 1 - 0.4 - -Suds suppressor - 0.5 0.5 -Miscellaneous and minors Up to 100%

Example 7 The following granular according detergent compositions to the were prepared present invention Blown Powder Zeolite A 20.0 - 15.0 STPP - 20.0 -Sulfate - - 5.0 Carbonate - - 5.0 TAS - - 1.0 LAS 6.0 6.0 6.0 C68AS 2.0 2.0 -Silicate 3.0 8.0 -MAIAA 4.0 2.0 2.0 CMC 0.6 0.6 0.2 Brightener 1 0.2 0.2 0.1 DETPMP 0.4 0.4 0.1 I II III
STS - - 1.0 Spray On C45E7 5.0 5.0 4.0 Silicone antifoam 0.3 0.3 0.1 Perfume 0.2 0.2 0.3 Dry additives QEA - - 1.0 Carbonate 14.0 9.0 10.0 PB 1 1.5 2.0 -PB4 18.5 13.0 13.0 TAED 2.0 2.0 2.0 QAS - - 1.0 Photoactivated bleach 15 ppm 15 ppm 15 ppm Na-SKS-6 - - 3.0 Protease 0.03 0.03 0.007 Mannanase 0.001 0.005 0.02 Lipase 0.004 0.004 0.004 Amylase 0.006 0.006 0.003 Cellulase 0.0002 0.0002 0.0005 Sulfate 10.0 20.0 5.0 Density (g/litre) 700 700 700 Miscellaneous and minors Up to 100%

Example 8 The following detergent compositions to the present were prepared according invention Blown Powder Zeolite A 15.0 15.0 15.0 Sulfate - 5.0 -LAS 3.0 3.0 3.0 QAS - 1.5 1.5 I II III
DETPMP 0.4 0.2 0.4 EDDS - 0.4 0.2 CMC 0.4 0.4 0.4 MAIAA 4.0 2.0 2.0 Agglomerate LAS 5.0 5.0 5.0 TAS 2.0 2.0 1.0 Silicate 3.0 3.0 4.0 Zeolite A 8.0 8.0 8.0 Carbonate 8.0 8.0 4.0 Spray On Perfume 0.3 0.3 0.3 C45E7 2.0 2.0 2.0 C25E3 2.0 - _ Dry Additives Citrate 5.0 - 2.0 Bicarbonate - 3.0 -Carbonate 8.0 15.0 10.0 TAED 6.0 2.0 5.0 PB1 14.0 7.0 10.0 PEO - - 0.2 Bentonite clay - - 10.0 Protease 0.03 0.03 0.03 Mannanase 0.001 0.005 0.01 Lipase 0.008 0.008 0.008 Cellulase 0.001 0.001 0.001 Amylase 0.01 0.01 0.01 Silicone antifoam 5.0 5.0 5.0 Sulfate - 3.0 -Density (g/litre) 850 850 850 Miscellaneous and minors Up to 100%

Example 9 The following detergent compositions were prepared according to the present invention I If III 1V

LAS 18.0 14.0 24.0 20.0 QAS 0.7 1.0 - 0.7 TFAA - 1.0 - _ C23E56.5 - - 1.0 -C45E7 - 1.0 - -C45E3S 1.0 2.5 1.0 -STPP 32.0 18.0 30.0 22.0 Silicate 9.0 5.0 9.0 8.0 Carbonate 11.0 7.5 10.0 5.0 Bicarbonate - 7,5 - _ PB1 3.0 1.0 - -PB4 - 1.0 - _ NOBS 2.0 1.0 - -DETPMP - 1.0 - -DTPA 0.5 - 0.2 0.3 SRP 1 0.3 0.2 - 0.1 MAIAA 1.0 1.5 2.0 0.5 CMC 0.8 0.4 0.4 0.2 PEI - - 0.4 -Sulfate 20.0 10.0 20.0 30.0 Mg sulfate 0.2 - 0.4 0.9 Mannanase 0.001 0.005 0.01 0.015 Protease 0.03 0.03 0.02 0.02 Amylase 0.008 0.007 - 0.004 Lipase 0.004 - 0.002 -Cellulase 0.0003 - - 0.0001 Photoactivated bleach 30 ppm 20 ppm - 10 ppm Perfume 0.3 0.3 0.1 0.2 Brightener 112 0.05 0.02 0.08 0.1 Miscellaneous and minors up to 100%

Example 10 The following liquid detergent formulations were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme) I II III IV V

~S 11.5 8.8 - 3.9 -C25E2.5S - 3.0 18.0 - 16.0 C45E2.25S 11.5 3.0 - 15.7 -C23E9 - 2.7 1.8 2.0 1.0 C23E7 3,2 _ _ _ -C FAA - - 5 . 2 - 3.1 TPKFA 1.6 - 2.0 0.5 2.0 Citric (50%) 6.5 1.2 2.5 4.4 2.5 Ca formate 0.1 0.06 0.1 - -Na formate 0.5 0.06 0.1 0.05 0.05 SCS 4.0 1.0 3.0 1.2 -Borate 0.6 - 3.0 2.0 2.9 Na hydroxide 5.8 2.0 3.5 3.7 2.7 Ethanol 1.75 1.0 3.6 4.2 2.9 1,2 Propanediol 3.3 2.0 8.0 7.9 5.3 Monoethanolamine 3.0 1.5 1.3 2.5 0.8 TEPAE 1.6 - 1.3 1.2 1.2 Mannanase 0.001 0.01 0.015 0.015 0.001 Protease 0.03 0.01 0.03 0.02 0.02 Lipase - - 0.002 - -Amylase - - - 0.002 -Cellulase - - 0.0002 0.0005 0.0001 SRP 1 0.2 - 0.1 - _ DTPA - - 0.3 - -PVNO - - 0.3 - 0.2 Brightener 1 0.2 0.07 0.1 - -Silicone antifoam 0.04 0.02 0.1 0.1 0.1 Miscellaneous and water Example 11 The following liquid detergent formulations were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme) I II III IV

10.0 13.0 9,0 _ C25AS 4.0 1.0 2.0 10.0 C25E3S 1.0 - - 3.0 C25E7 6.0 8.0 13.0 2.5 TFAA - - - 4.5 APA - 1.4 - _ TPKFA 2.0 - 13.0 7.0 Citric 2.0 3.0 1.0 1.5 Dodecenyl I tetradecenyl succinic12.0 10.0 - _ acid Rapeseed fatty acid 4.0 2.0 1.0 -Ethanol 4.0 4.0 7.0 2.0 1,2 Propanediol 4.0 4.0 2.0 7.0 Monoethanolamine - - - 5.0 Triethanoiamine _ - 8.0 _ TEPAE 0.5 - 0.5 0.2 DETPMP 1.0 1.0 0.5 1.0 Mannanase 0.001 0.015 0.01 0.03 Protease 0.02 0.02 0.01 0.008 Lipase - 0.002 - 0.002 Amylase 0.004 0.004 0.01 0.008 Cellulase - - - 0.002 SRP 2 0.3 - 0.3 0.1 Boric acid 0.1 0.2 1.0 2.0 Ca chloride - 0.02 - 0.01 Brightener 1 - 0.4 - -Suds suppressor 0.1 0.3 _ 0.1 Opacifier 0.5 0.4 - 0.3 NaOH up to pH 8.0 8.0 7.6 7.7 Miscellaneous and water Example 12 The following liquid detergent compositions were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme) I II III IV

LAS 25.0 - _ _ C25AS - 13.0 18.0 15.0 C25E3S - 2.0 2.0 4.0 C25E7 - - 4.0 4.0 TFAA - 6.0 8.0 8.0 APA 3.0 1.0 2.0 TP KFA - 15.0 11.0 11.0 Citric 1.0 1.0 1.0 1.0 Dodecenyl I tetradecenyl 15.0 - _ _ succinic acid Rapeseed fatty acid 1.0 - 3.5 -Ethanol 7.0 2.0 3.0 2.0 1,2 Propanediol 6.0 8.0 10.0 13.0 Monoethanolamine _ g,0 g.0 TEPAE - - 0.4 0.3 DETPMP 2.0 1.2 1.0 -Mannanase 0.001 0.0015 0.01 0.01 Protease 0.05 0.02 0.01 0.02 Lipase - - 0.003 0.003 Amylase 0.004 0.01 0.01 0.01 Cellulase - - 0.004 0.003 SRP 2 - - 0.2 0.1 Boric acid 1.0 1.5 2.5 2.5 Bentonite clay 4.0 4.0 -Brightener 1 0.1 0.2 0.3 -Suds suppressor 0.4 - _ _ Opacifier p,g 0.7 - -NaOH up to pH 8.0 7.5 8.0 8.2 Miscellaneous and water Example 13 The following liquid detergent compositions were prepared according to the present invention {Levels are given in parts by weight, enzyme are expressed in pure enzyme) I II
~S 27.6 18.9 C45AS 13.g 5,9 C13E8 3,p 3.1 Oleic acid 3.4 2.5 Citric 5.4 5.4 Na hydroxide 0.4 3.6 Ca Formate 0.2 0.1 Na Formate - 0.5 Ethanol 7,p _ Monoethanolamine 16.5 g.0 1,2 propanediol 5.9 5.5 Xylene sulfonic acid - 2.4 TEPAE 7.5 0.8 Protease 0.05 0.02 Mannanase 0.001 0.01 PEG - 0.7 Brightener 2 0.4 0.1 Perfume 0.5 0.3 Water and Minors ~o Example 14 The following granular fabric detergent compositions which provide "softening through the wash" capability were prepared according to the present invention I II
C45AS - 10.0 ~S 7.6 -WO 99/09128 PCT/US9$/11996 I II
C6$AS 1.3 -C45E7 4,0 -C25E3 _ 5.0 Coco-alkyl-dimethyl hydroxy-1.4 1.0 ethyl ammonium chloride C itrate 5.0 3.0 Na-SKS-6 - 11.0 Zeolite A 15.0 15.0 MA/AA 4.0 4.0 DETPMP 0.4 0.4 PB1 15.0 -Percarbonate _ 15.0 TAED 5.0 5.0 Smectite clay 10.0 10.0 HMWPEO - 0.1 Mannanase 0.001 0.01 Protease 0.02 0.01 Lipase . 0.02 0.01 Amylase 0.03 0.005 Cellulase 0.001 -Silicate 3_0 5.0 Carbonate 10.0 10.0 Suds suppressor 1.0 4.0 CMC 0.2 0.1 Miscellaneous and minors Up to 100%

Example 15 The following laundry bar detergent compositions were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme) I II III VI V III VI V
~S - - 19.0 15.0 21.0 6.75 8.8 C28AS 30.0 13.5 - - - 15.75 11.2 22.5 I II lil VI V Ill VI V

Na Laurate 2.5 9.0 - - _ _ - _ Zeolite A 2.0 1.25 - - - 1.25 1.25 1.25 Carbonate 20.0 3.0 13.0 8.0 10.0 15.0 15.0 10.0 Ca Carbonate27.5 39.0 35.0 - - 40.0 - 40.0 Sulfate 5.0 5.0 3.0 5.0 3.0 - - 5.0 TSPP 5.0 - - - - 5.0 2.5 -STPP 5.0 15.0 10.0 - - 7.0 8.0 10.0 Bentonite - 10.0 - - 5.0 - - -clay DETPMP - 0.7 0.6 - 0.6 0.7 0.7 0.7 CMC - 1.0 1.0 1.0 1.0 - - 1.0 Talc - - 10.0 15.0 10.0 - - -Silicate - - 4.0 5.0 3.0 - - -PVNO 0.02 0.03 - 0.01 - 0.02 - -MA/AA 0.4 1.0 - - 0.2 0.4 0.5 0.4 SRP 1 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 Mannanase 0.001 0.001 0.01 0.01 0.015 0.001 0.05 0.01 Amylase - - 0.01 - - - 0.002 -Protease 0.001 0.004 0.001 0.003 0.003 0.001 0.001 0.003 Lipase - 0.002 - 0.002 - - _ _ Cellulase - .0003 - - .0003 .0002 - -PEO - 0.2 - 0.2 0.3 - - 0.3 Perfume 1.0 0.5 0.3 0.2 0.4 - - 0.4 Mg sulfate - - 3.0 3.0 3.0 - - -Brightener 0.15 0.1 0.15 - - - - 0.1 Photoactivated- 15.0 15.0 15.0 15.0 - - 15.0 bleach (ppm) Example 16 The following detergent additive compositions were prepared according to the s present invention I II III
LAS - 5.0 5.0 STPP 30.0 - 20.0 WO 99109128 PCT/US98/1199b I II III
Zeolite A - 35.0 20.0 PB1 20.0 15.0 -TAED 10.0 8.0 _ Mannanase 0.001 0.01 0.01 P rotease 0. 3 0. 3 0.

Amylase - 0.06 0.06 Minors, water and miscellaneous Up to 100%

Example 17 The following compact high density (0.96Kg/l) dishwashing detergent compositions were prepared according to the present invention I II III IV V V! VII VIII

STPP - - 54.3 51.4 51.4 - - 50.9 Citrate 35.0 17.0 - - - 4fi.1 40.2 -Carbonate - 17.5 14.0 14.0 14.0 - 8.0 32.1 Bicarbonate- - - - - 25.4 - -Silicate 32.0 74.8 14.8 10.0 10.0 1.0 25.0 3.1 Metasiiicate- 2.5 - 9.0 9.0 - -PB1 1.9 9.7 7.8 7.8 7.8 - -PB4 8.6 - _ _ _ _ _ _ Percarbonate- - - - - 6.7 11.8 4.8 Nonionic 1.5 2.0 1.5 1.7 1.5 2.6 1.9 5.3 TAED 5.2 2.4 - - - 2.2 - 1.4 HEDP - 1.0 - - _ _ _ _ DETPMP - 0.6 - - - _ _ _ MnTACN - - - - - - 0.008 -C - - 0.008 0.01 0.007 - - _ BzP _ _ _ - 1.4 - _ _ Paraffin 0.5 0.5 0.5 0.5 0.5 0.6 - -Mannanase 0.001 0.001 0.002 0.0020.001 0.003 0.002 0.002 Protease 0.072 0.072 0.029 0.0530.046 0.026 0.059 0.06 Amylase 0.012 0.012 0.006 0.0120.013 0.009 0.017 0.03 I II III IV V VI VII VIII

Lipase - 0.001 - 0.005 - - _ _ BTA 0.3 0.3 0.3 0.3 0.3 - 0.3 0.3 MAIAA - - - - - - 4.2 -480N 3.3 6.0 - - _ _ _ 0.9 Perfume 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 Sulphate 7.0 20.0 5.0 2.2 0.8 12.0 4.6 pH 10.8 11.0 10.8 11.3 11.3 9.6 10.8 10.9 Miscellaneous and Up to 100%
water Example 18 The following granular dishwashing detergent compositions of bulk density 1.02Kg/L were prepared according to the present invention I II III IV V VI VII VII

STPP 30.0 30.0 33.0 34.2 29.6 31.1 26.6 17.6 Carbonate 30.5 30.5 31.0 30.0 23.0 39.4 4.2 45.0 Silicate 7.4 7.4 7.5 7.2 13.3 3.4 43.7 12.4 Metasilicate- - 4.5 5.1 - - - _ Percarbonate- - - - - 4.0 - -PB1 4.4 4.2 4.5 4.5 - - _ _ NADCC - - - - 2.0 - 1.6 1.0 Nonionic 1.2 1.0 0.7 0.8 1.9 0.7 0.6 0.3 TAED 1.0 - - _ _ O.g _ -PAAC - 0.004 0.004 0.004 - - _ _ BzP _ _ - 1.4 - - _ _ Paraffin 0.25 0.25 0.25 0.25 - - _ _ Mannanase 0.001 0.001 0.001 0.001 0.001 0.001 0.001 0.001 Protease 0.036 0.015 0.03 0.028 0.001 0.03 0.03 0.03 Amylase 0.003 0.003 0.01 0.006 - 0.01 - -Lipase 0.005 - 0.001 - - _ _ _ BTA 0.15 0.15 0.15 0.15 - - - _ Perfume 0.2 0.2 0.2 0.2 0.1 0.2 0.2 -I II III IV V VI VII VII
Sulphate 23.4 25.0 22.0 18.5 30.1 19.3 23.1 23.6 pH 10.8 10.8 11.3 11.3 10.7 11.5 12.7 10.9 Miscellaneous and water Up to 100%
Example 19 The following tablet detergent compositions were prepared according to the present invention by compression of a granular dishwashing detergent composition at a pressure of 13KN/cm2 using a standard 12 head rotary press:
I II III IV V VI

STPP - 48.8 49.2 38.0 - 46.8 Citrate 26.4 - - - 31.1 -Carbonate - 5.0 14.0 15.4 14.4 23.0 Silicate 26.4 14.8 15.0 12.6 17.7 2.4 Mannanase 0.001 0.001 0.001 0.001 0.001 0.02 Protease 0.058 0.072 0.041 0.033 0.052 0.013 Amylase 0.01 0.03 0.012 0.007 0.016 0.002 Lipase 0.005 - - _ _ _ PB1 1.6 7.7 12.2 10.6 15.7 -PB4 6.9 - - - - 14.4 Nonionic 1.5 2.0 1.5 1.65 0.8 6.3 PAAC - - 0.02 0.009 - -MnTACN - - - - 0.007 -TAED 4.3 2.5 - - 1.3 1.8 HEDP 0.7 - _ 0.7 _ 0.4 DETPMP 0.65 - - - - -Paraffin 0.4 0.5 0.5 0.55 - -BTA 0.2 0.3 0.3 0.3 - -PA30 3.2 - _ _ _ M''/~ - - - - 4.5 0.

Perfume - - 0.05 0.05 0.2 0.2 Sulphate 24.0 13.0 2.3 - 10.7 3.4 Weight of tablet25g 25g 20g 30g 18g 20g pH 10.6 10.6 10.7 10.7 10.9 11.2 Miscellaneous and water Up to 100%
Example 20 The following liquid dishwashing compositions were prepared according to the present invention I II Ill IV V

C17ES 28.5 27.4 19.2 34.1 34.1 Amine oxide 2.6 5.0 2.0 3.0 3.0 C12 glucose amide - _ 6.0 _ -Betaine 0.9 - - 2.0 2.0 Xylene sulfonate 2.0 4.0 - 2.0 -Neodol C11 E9 - _ 5.0 - _ Polyhydroxy fatty acid - - - 6.5 6.5 amide Sodium diethylene penta - - 0.03 - -acetate (40%) TAED - - - 0.06 0.06 Sucrose - - - 1.5 1.5 Ethanol 4.0 5.5 5.5 9.1 9.1 Alkyl diphenyl oxide disulfonate- - - - 2.3 Ca formate - - - 0.5 1.1 Ammonium citrate 0.06 0.1 - - -Na chloride - 1.0 _ _ _ Mg chloride 3.3 - 0.7 - -Ca chloride - - 0.4 - -Na sulfate - - 0.06 - -Mg sulfate 0.08 - - - _ Mg hydroxide - - - 2.2 2.2 Na hydroxide - - - 1.1 1.1 Hydrogen peroxide 200ppm 0.16 0.006 - -Mannanase 0.001 0.05 0.001 0.001 0.015 Protease 0.017 0.005 0.035 0.003 0.002 Pertume 0.18 0.09 0.09 0.2 0.2 Water and minors Up to 100%

WO 99109128 PCT/US98/1199b Example 21 The following liquid hard surface cleaning compositions were prepared according to the present invention I ll III IV V

Mannanase 0.001 0.0015 0.0015 0.05 0.01 Amylase 0.01 0.002 0.005 - _ Protease 0.05 0.01 0.02 0.01 0.01 Hydrogen peroxide - - - 6.0 6.8 Acetyl triethyl citrate- _ _ 2.5 -DTPA - - - 0.2 -Butyl hydroxy toluene- - - 0.05 -EDTA* 0.05 0.05 0.05 - -Citric / Citrate 2.9 2.9 2.9 1.0 -0.5 0.5 0.5 - _ C 12 AS 0.5 0.5 0. 5 - -C 1 OAS - - - - 1.7 C12(E)S 0.5 0.5 0.5 - -C12,13 E6.5 nonionic7.0 7.0 7.0 -Neodol23-6.5 - - - 12.0 Dobanol23-3 - _ _ - 1.5 Dobanol91-10 - - - - 1.6 C25AE1.8S - - - 6.0 Na paraffin sulphonate- - - 6.0 Perfume 1.0 1.0 1.0 0.5 0.2 Propanediol - _ _ 1.5 Ethoxylated tetraethylene- - - 1.0 -pentaimine 2, Butyl octanol - _ _ _ 0.5 Hexyl carbitol** 1.0 1.0 1.0 -SCS 1.3 1.3 1.3 _ pH adjusted to 7-12 7-12 7-12 4 -Miscellaneous and Up to water 100%

*Na4 ethylenediamine diacetic acid **Diethylene glycol monohexyl ether Example 22 The following spray composition for cleaning of hard surfaces and removing s household mildew was prepared according to the present invention Mannanase 0.01 Amylase 0.01 Protease 0.01 Na octyl sulfate 2.0 Na dodecyl sulfate 4.0 Na hydroxide O,g Silicate 0.04 Butyl carbitol* 4.0 Perfume 0.35 Waterlminors up to 100%

*Diethylene glycol monobutyl ether SEQUENCE LISTING
(1 ) GENERAL INFORMATION:
APPLICANT:
NAME: The Procter & Gamble Company STREET: One Procter & Gamble Plaza CITY: Cincinnati, OHIO
COUNTRY: USA
POSTAL CODE: 45202 TITLE OF INVENTION: Detergent compositions comprising a mannanase and a protease.
NUMBER OF SEQUENCES: 6 COMPUTER READABLE FORM:
MEDIUM TYPE: Diskette COMPUTER: IBM PC compatible OPERATING SYSTEM: PC-DOSIMS-DOS
2o SOFTWARE: Patentln Release # 1.0 Version 1.25 (EPO) SEQ ID N0:1 SEQUENCE CHARACTERISITICS:
LENGTH: 1407 base pairs TYPE: nucleic acid STRANDEDNESS: single TOPOLOGY: linear 3o MOLECULE TYPE: genornic DNA
ORIGINAL SOURCE
FEATURE:
NAME/KEY: CDS
LOCATION:1-1482 SEQUENCE DESCRIPTION: SEQ ID NO: 1 ATGAA~AAAAAAGTTATCACAGATTTATCATTTAATTATTTGCACACTTATAATA
AGTGTGGGAATAATGGGGATTACAACGTCCCCATCAGCAGCAAGTACAGGC
TTTTATGTTGATGGCAATACGTTATATGACGCAAATGGGCAGCCATTTGTCAT
GAGAGGTATTAACCATGGACATGCTTGGTATAAAGACACCGCTTCAACAGCT
ATTCCTGCCATTGCAGAGCAAGGCGCCAACACGATTCGTATTGTTTTATCAG
ATGGCGGTCAATGGGAAAAAGACGACATTGACACCATTCGTGAAGTCATTG
AGCTTGCGGAGCAAAATAAAATGGTGGCTGTCGTTGAAGTTCATGATGCCA
CGGGTCGCGATTCGCGCAGTGATTTAAATCGAGCCGTTGATTATTGGATAG
~ o AAATGAAAGATGCGCTTATCGGTAAAGAAGATACGGTTATTATTAACATTGCA
AACGAGTGGTATGGGAGTTGGGATGGCTCAGCTTGGGCCGATGGCTATATT
GATGTCATTCCGAAGCTTCGCGATGCCGGCTTAACACACACCTTAATGGTTG
ATGCAGCAGGATGGGGGCAATATCCGCAATCTATTCATGATTACGGACAAG
ATGTGTTTAATGCAGATCCGTTAAAAAATACGATGTTCTCCATCCATATGTAT
~5 GAGTATGCTGGTGGTGATGCTAACACTGTTAGATCAAATATTGATAGAGTCA
TAGATCAAGACCTTGCTCTCGTAATAGGTGAATTCGGTCATAGACATACTGA
TGGTGATGTTGATGAAGATACAATCCTTAGTTATTCTGAAGAAACTGGCACA
GGGTGGCTCGCTTGGTCTTGGAAAGGCAACAGTACCGAATGGGACTATTTA
GACCTTTCAGAAGACTGGGCTGGTCAACATTTAACTGATTGGGGGAATAGAA
2o TTGTCCACGGGGCCGATGGCTTACAGGAAACCTCCAAACCATCCACCGTAT
TTACAGATGATAACGGTGGTCACCCTGAACCGCCAACTGCTACTACCTTGTA
TGACTTTGAAGGAAGCACACAAGGGTGGCATGGAAGCAACGTGACCGGTG
GCCCTTGGTCCGTAACAGAATGGGGTGCTTCAGGTAACTACTCTTTAAAAGC
CGATGTAAATTTAACCTCAAATTCTTCACATGAACTGTATAGTGAACAAAGTC

GGGAAATCCCGGTAATGGCATGAATGCAAGACTTTACGTGAAAACGGGCTC
TGATTATACATGGCATAGCGGTCCTTTTACACGTATCAATAGCTCCAACTCA
GGAACAACGTTATCTTTTGATTTAAACAACATCGAAAATAGTCATCATGTTAG
GGAAATAGGCGTGCAATTTTCAGCGGCAGATAATAGCAGTGGTCAAACTGC

SEQ ID N0:2 35 SEQUENCE CHARACTERISITICS:
LENGTH: 493 amino acids TYPE: amino acid TOPOLOGY: linear MOLECULE TYPE: protein SEQUENCE DESCRIPTION: SEQ ID NO: 2 HGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKM
VAWEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGS
~o AWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTM
FSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEE
TGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKP
STVFTDDNGGHPEPPTATTLYDFEGSTQGWHGSNVTGGPWSVTEWGASGNY
SLKADVNLTSNSSHELYSEQSRNLHGYSQLNATVRHANWGNPGNGMNARLYV
~5 KTGSDYTWHSGPFTRINSSNSGTTLSFDLNNIENSHHVREIGVQFSAADNSSGQ
TALYVDNVTLR
SEQ ID N0:3 SEQUENCE CHARACTERISITICS:
LENGTH: 1407 base pairs TYPE: nucleic acid STRANDEDNESS: single TOPOLOGY: linear MOLECULE TYPE: genomic DNA
SEQUENCE DESCRIPTION: SEQ ID NO: 3 ATGAAAAAAAAGTTATCACAGATTTATCATTTAATTATTTGCACACTTATAATA
AGTGTGGGAATAATGGGGATTACAACGTCCCCATCAGCAGCAAGTACAGGC
TTTTATGTTGATGGCAATACGTTATATGACGCAAATGGGCAGCCATTTGTCAT
GAGAGGTATTAACCATGGACATGCTTGGTATAAAGACACCGCTTCAACAGCT
ATTCCTGCCATTGCAGAGCAAGGCGCCAACACGATTCGTATTGTTTTATCAG
ATGGCGGTCAATGGGAAAAAGACGACATTGACACCATTCGTGAAGTCATTG

AGCTTGCGGAGCAAAATAAAATGGTGGCTGTCGTTGAAGTTCATGATGCCA
CGGGTCGCGATTCGCGCAGTGATTTAAATCGAGCCGTTGATTATTGGATAG
AAATGAAAGATGCGCTTATCGGTAAAGAAGATACGGTTATTATTAACATTGCA
AACGAGTGGTATGGGAGTTGGGATGGCTCAGCTTGGGCCGATGGCTATATT
GATGTCATTCCGAAGCTTCGCGATGCCGGCTTAACACACACCTTAATGGTTG
ATGCAGCAGGATGGGGGCAATATCCGCAATCTATTCATGATTACGGACAAG
ATGTGTT'fAATGCAGATCCGTTAAAAAATACGATGTTCTCCATCCATATGTAT
GAGTATGCTGGTGGTGATGCTAACACTGTTAGATCAAATATTGATAGAGTCA
TAGATCAAGACCTTGCTCTCGTAATAGGTGAATTCGGTCATAGACATACTGA
~o TGGTGATGTTGATGAAGATACAATCCTTAGTTATTCTGAAGAAACTGGCACA
GGGTGGCTCGCTTGGTCTTGGAAAGGCAACAGTACCGAATGGGACTATTTA
GACCTTTCAGAAGACTGGGCTGGTCAACAI-fTAACTGATTGGGGGAATAGAA
TTGTCCACGGGGCCGATGGCTTACAGGAAACCTCCAAACCATCCACCGTAT
TTACAGATGATAACGGTGGTCACCCTGAACCGCCAACTGCTACTACCTTGTA
TGACTTTGAAGGAAGCACACAAGGGTGGCATGGAAGCAACGTGACCGGTG
GCCCTTGGTCCGTAACAGAATGGGGTGCTTCAGGTAACTACTCTTTAAAAGC
CGATGTAAATTTAACCTCAAATTCTTCACATGAACTGTATAGTGAACAAAGTC
GTAATCTACACGGATACTCTCAGCTCAACGCAACCGTTCGCCATGCCAATTG
GGGAAATCCCGGTAATGGCATGAATGCAAGACTTTACGTGAAAACGGGCTC
2o TGATTATACATGGCATAGCGGTCCTTTTACACGTATCAATAGCTCCAACTCA
GGAACAACGTTATCTTTTGATTTAAACAACATCGAAAATATCATCATGTTAGG
GAAATAG
SEQ ID N0:4 SEQUENCE CHARACTERISITICS:
LENGTH: 468 amino acids TYPE: amino acid 3o TOPOLOGY: linear MOLECULE TYPE: protein SEQUENCE DESCRIPTION: SEQ ID NO: 4 MKKKLSQIYHLIiCTLIISVGIMGITTSPSAASTGFYVDGNTLYDANGQPFVMRGIN
HGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKM

VAWEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGS
AWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTM
FSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEE
TGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKP
STVFTDDNGGHPEPPTATTLYDFEGSTQGWHGSNVTGGPWSVTEWGASGNY
SLKADVNLTSNSSHELYSEQSRNLHGYSQLNATVRHANWGNPGNGMNARLYV
KTGSDYTWHSGPFTRINSSNSGTTLSFDLNNIENIIMLGK
~o SEQ ID NC):5 SEQUENCE CHARACTERISITICS:
LENGTH: 'i029 base pairs TYPE: nucleic acid ~5 STRANDEDNESS: single TOPOLOGY: linear MOLECULE TYPE: genomic DNA
2o SEQUENCE DESCRIPTION SEQ ID No:S
5' AAT TGG CGC ATA CTG TGT CGC CTG TGA ATC CTA ATG CCC AGC
AGA CAA CAA AAA CAG TGA TGA ACT GGC TTG CGC ACC TGC CGA ACC
GAA CGG AAA ACA GAG TCC TTT CCG GAG CGT TCG GAG GTT ACA GCC

CCG GGC AAT CGC CTG CTA TTT ATG GCT GCG ATT ATG CCA GAG GAT
GGC TTG AAA CAG CAA ATA TTG AAG ATT CAA TAG ATG TAA GCT GCA
ACG GCG ATT TAA TGT CGT ATT GGA AAA ATG GCG GAA TTC CGC AAA
TCA GTT TGC ACC TGG CGA ACC CTG CTT TTC AGT CAG GGC ATT TTA
3o AAA CAC CGA TTA CAA ATG ATC AGT ATA AAA ACA TAT TAG ATT CAG
CAA CAG CGG AAG GGA AGC GGC TAA ATG CCA TGC TCA GCA AAA TTG
CTG ACG GAC TTC AAG AGT TGG AGA ACC AAG GTG TGC CTG TTC TGT
TCA GGC CGC TGC ATG AAA TGA ACG GCG AAT GGT TTT GGT GGG GAC
TCA CAT CAT ATA ACC AAA AGG ATA ATG AAA GAA TCT CTC TAT ATA

GAC TTG ATC ATT TGA TTT GGG TTT ACT CTC CCG ACG CCA ACC GAG

ATT TTA AAA CTG ATT TTT ACC CGG GCG CGT CTT ACG TGG ATA TTG
TCG GAT TAG ATG CGT ATT TTC AAG ATG CCT ACT CGA TCA ATG GAT
ACG ATC AGC TAA CAG CGC TTA ATA AAC CAT TTG CTT TTA CAG AAG
TCG GCC CGC AAA CAG CAA ACG GCA GCT TCG ATT ACA GCC TGT TCA
TCA ATG CAA TAA AAC AAA AAT ATC CTA AAA CCA TTT ACT TTC TGG
CAT GGA ATG ATG AAT GGA GCG CAG CAG TAA ACA AGG GTG CTT CAG
CTT TAT ATC ATG ACA GCT GGA CAC TCA ACA AGG GAG AAA TAT GGA
ATG GTG ATT CTT TAA CGC CAA TCG TTG AGT GAA TCC GGG ATC 3' SEQ ID N0:6 SEQUENCE CHARACTERISITICS:
LENGTH: 363 amino acids TYPE: amino acid TOPOLOGY: linear MOLECULE TYPE: protein 2o SEQUENCE DESCRIPTION: SEQ ID NO: 6 ydhT 1 ydhT 51 ydhT 101 ydhT

3o ydhT

ydhT

ydhT

yd hT 351 IWNGDSLTPIVE*. 363

Claims (8)

109
1. A detergent composition comprising a detergent ingredient, a mannanase enzyme and a protease enzyme.
2. A detergent composition according to claim 1 wherein said mannanase is present at a level of from 0.0001% to 2%, preferably from 0.0005% to 0.5%, more preferably from 0.001% to 0.02% pure enzyme by weight of total composition.
3. A detergent composition according to claims 1-2 wherein the protease enzyme is present at a level of from 0.0001% to 2%, preferably from 0.001% to 0.2%, more preferably from 0.005% to 0.1% pure enzyme by weight of the composition.
4. A detergent composition wherein the protease is a protease from the IUPAC classification EC 3.4.-.-, preferably an Endo-serine protease from the IUPAC classification EC 3.4.21.-, more preferably a Subtilisin proteases from the IUPAC classification EC 3.4.21.62 and variants thereof.
5. A detergent composition according to any of the preceding claims further comprising a surfactant selected from anionic, nonionic, cationic surfactant, and/or mixtures thereof.
6. A detergent composition according to any of the preceding claims further comprising a bleaching agent.
7. A detergent composition according to any of the preceding claims further comprising a builder, preferably a zeolite, a sodium layered silicate, sodium tripolyphosphate andlor mixtures thereof.
8. A method of cleaning a fabric, dishware or hard surface with a detergent composition according to any of the preceding claims for cleaning performance.
CA002300696A 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a protease Abandoned CA2300696A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP97870120.9 1997-08-14
EP97870120A EP0896998A1 (en) 1997-08-14 1997-08-14 Laundry detergent compositions comprising a saccharide gum degrading enzyme
PCT/US1998/011996 WO1999009128A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a protease

Publications (1)

Publication Number Publication Date
CA2300696A1 true CA2300696A1 (en) 1999-02-25

Family

ID=8231031

Family Applications (8)

Application Number Title Priority Date Filing Date
CA002300696A Abandoned CA2300696A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a protease
CA002299410A Abandoned CA2299410A1 (en) 1997-08-14 1998-06-10 Enzymatic cleaning compositions
CA002301205A Abandoned CA2301205A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a hydrophobic bleach activator
CA002301168A Abandoned CA2301168A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a cationic surfactant
CA002301156A Abandoned CA2301156A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and percarbonate
CA002301404A Abandoned CA2301404A1 (en) 1997-08-14 1998-06-10 Laundry detergent compositions comprising a saccharide gum degrading enzyme
CA002301200A Abandoned CA2301200A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a clay
CA002301167A Abandoned CA2301167A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a soil release polymer

Family Applications After (7)

Application Number Title Priority Date Filing Date
CA002299410A Abandoned CA2299410A1 (en) 1997-08-14 1998-06-10 Enzymatic cleaning compositions
CA002301205A Abandoned CA2301205A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a hydrophobic bleach activator
CA002301168A Abandoned CA2301168A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a cationic surfactant
CA002301156A Abandoned CA2301156A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and percarbonate
CA002301404A Abandoned CA2301404A1 (en) 1997-08-14 1998-06-10 Laundry detergent compositions comprising a saccharide gum degrading enzyme
CA002301200A Abandoned CA2301200A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a clay
CA002301167A Abandoned CA2301167A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a soil release polymer

Country Status (18)

Country Link
EP (4) EP0896998A1 (en)
JP (8) JP4090688B2 (en)
KR (2) KR20010022893A (en)
CN (8) CN1276826A (en)
AT (4) ATE363527T1 (en)
AU (8) AU8064298A (en)
BR (8) BR9811191A (en)
CA (8) CA2300696A1 (en)
CZ (2) CZ2000506A3 (en)
DE (4) DE69826294T2 (en)
DK (1) DK1009795T3 (en)
ES (3) ES2268780T3 (en)
HU (1) HUP0003670A3 (en)
ID (1) ID23442A (en)
MX (7) MXPA00001567A (en)
PT (1) PT1009795E (en)
TR (2) TR200000339T2 (en)
WO (8) WO1999009133A1 (en)

Families Citing this family (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6376445B1 (en) * 1997-08-14 2002-04-23 Procter & Gamble Company Detergent compositions comprising a mannanase and a protease
DE19752844A1 (en) * 1997-11-28 1999-06-02 Henkel Kgaa Increasing the cleaning performance of detergents
AU755850B2 (en) * 1998-06-10 2002-12-19 Novozymes A/S Novel mannanases
AU5744199A (en) 1998-09-16 2000-04-03 Unilever Plc Fabric care composition
GB2348434A (en) * 1999-04-01 2000-10-04 Procter & Gamble Detergent compositions
FI109921B (en) * 1999-09-29 2002-10-31 Valtion Teknillinen Method and enzyme preparation for process industry
US6949503B2 (en) * 1999-10-05 2005-09-27 Ciba Specialty Chemicals Corporation Fabric softener compositions
AU7907500A (en) * 1999-10-05 2001-05-10 Ciba Specialty Chemicals Holding Inc. Fabric softener compositions
CN1378587A (en) * 1999-10-05 2002-11-06 西巴特殊化学品控股有限公司 Fabric softener compositions
ES2250194T3 (en) * 1999-10-05 2006-04-16 Ciba Specialty Chemicals Holding Inc. IMPROVED COMPOSITIONS OF SOFTENERS FOR FABRICS.
GB0030669D0 (en) 2000-12-15 2001-01-31 Unilever Plc Detergent compositions
GB0222501D0 (en) 2002-09-27 2002-11-06 Unilever Plc Composition and method for bleaching a substrate
JP2004211080A (en) * 2002-12-19 2004-07-29 Kao Corp Bleaching detergent composition
EP2404931A1 (en) * 2003-07-02 2012-01-11 Verenium Corporation Glucanases, nucleic acids encoding them and methods for making and using them
ES2435773T3 (en) 2005-09-02 2013-12-23 The Procter & Gamble Company Aroma customization for laundry
DE102006038448A1 (en) 2005-12-28 2008-02-21 Henkel Kgaa Enzyme-containing cleaning agent
EP1867708B1 (en) * 2006-06-16 2017-05-03 The Procter and Gamble Company Detergent compositions
EP1867707B1 (en) * 2006-06-16 2011-09-07 The Procter & Gamble Company Detergent compositions
EP1882731A1 (en) * 2006-06-16 2008-01-30 The Procter and Gamble Company Detergent compositions
EP1876227B2 (en) * 2006-07-07 2020-08-12 The Procter and Gamble Company Detergent Compositions
MX2009008903A (en) * 2007-02-28 2009-09-24 Danisco Us Inc Cleaning compositions comprising alpha-galactosidase.
US20080229514A1 (en) * 2007-03-22 2008-09-25 Poulose Ayrookaran J Cleaning compositions comprising transglucosidase
US20090048136A1 (en) * 2007-08-15 2009-02-19 Mcdonald Hugh C Kappa-carrageenase and kappa-carrageenase-containing compositions
BRPI0821904A2 (en) 2008-01-04 2019-10-01 Procter & Gamble laundry detergent composition comprising glycosyl hydralase
CN101910391B (en) * 2008-01-04 2013-04-17 宝洁公司 Laundry detergent composition comprising a glycosyl hydrolase and a benefit agent-containing delivery particle
BR112012000531A2 (en) 2009-07-09 2019-09-24 Procter & Gamble catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte
EP2451915A1 (en) 2009-07-09 2012-05-16 The Procter & Gamble Company A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte
EP2292725B2 (en) 2009-08-13 2022-08-24 The Procter & Gamble Company Method of laundering fabrics at low temperature
BR112012029177A2 (en) * 2010-05-14 2017-07-18 The Sun Products Corp cleaning compositions containing polymers and methods for producing and using these
DE102010041351A1 (en) * 2010-09-24 2012-03-29 Krones Aktiengesellschaft filling
JP2012111810A (en) * 2010-11-22 2012-06-14 Kao Corp Powder detergent composition for use in automatic washer
US8652455B2 (en) * 2010-12-20 2014-02-18 E I Du Pont De Nemours And Company Targeted perhydrolases
DE102012200333A1 (en) 2012-01-11 2013-07-11 Henkel Ag & Co. Kgaa Acylhydrazones as bleach-enhancing agents
US10087401B2 (en) * 2012-03-16 2018-10-02 Monosol, Llc Water soluble compositions incorporating enzymes, and method of making same
AR090971A1 (en) 2012-05-07 2014-12-17 Novozymes As POLYPEPTIDES THAT HAVE XANTANE DEGRADATION ACTIVITY AND POLYCINOCYLODES THAT CODE THEM
US9011610B2 (en) * 2012-06-22 2015-04-21 Ecolab Usa Inc. Solid fast draining/drying rinse aid for high total dissolved solid water conditions
US9567551B2 (en) 2012-06-22 2017-02-14 Ecolab Usa Inc. Solid rinse aid composition and method of making same
WO2014068109A2 (en) * 2012-11-05 2014-05-08 Novozymes A/S Enzyme compositions enabling re-use of water in laundry
EP2929021A1 (en) * 2012-12-07 2015-10-14 Danisco US Inc. Compositions and methods of use
AU2014241193B2 (en) * 2013-03-28 2016-10-20 The Procter And Gamble Company Cleaning compositions containing a polyetheramine
DE102013103463A1 (en) 2013-04-08 2014-10-09 Ludwig Hettich & Co. Kg Tool, screw and system for transmitting a drive torque
JP6235120B2 (en) * 2013-04-23 2017-11-22 ビーエーエスエフ ソシエタス・ヨーロピアBasf Se Formulations, their use as dishwashing detergents, or their use for the production of dishwashing detergents, and their production
US20160152925A1 (en) * 2013-07-04 2016-06-02 Novozymes A/S Polypeptides Having Anti-Redeposition Effect and Polynucleotides Encoding Same
CN103695394B (en) * 2013-12-18 2015-07-29 青岛根源生物技术集团有限公司 Acid resistance mannase MAN26gy of a kind of optimization and its preparation method and application
JP6184024B2 (en) * 2014-06-30 2017-08-23 ライオン株式会社 Granular detergent
JP6192231B2 (en) * 2014-07-02 2017-09-06 ライオン株式会社 Liquid detergent for dishwashing
CN104843844A (en) * 2015-05-07 2015-08-19 苏州能华节能环保科技有限公司 Environmental protection treating agent for metal processing waste water and preparation method thereof
EP3292191B1 (en) 2015-05-07 2019-06-05 Unilever N.V. Alkaline dishwash composition
TR201906232T4 (en) 2015-06-11 2019-05-21 Unilever Nv Detergent composition for laundry.
WO2016198263A1 (en) * 2015-06-11 2016-12-15 Unilever Plc Laundry detergent composition
CN108350443B (en) * 2015-09-17 2022-06-28 诺维信公司 Polypeptides having xanthan degrading activity and polynucleotides encoding same
JP6591277B2 (en) * 2015-12-15 2019-10-16 花王株式会社 Liquid detergent composition for tableware
WO2017102868A1 (en) * 2015-12-18 2017-06-22 Henkel Ag & Co. Kgaa Penta-built liquid detergent composition
WO2017202887A1 (en) * 2016-05-26 2017-11-30 Novozymes A/S Use of enzymes, cleaning composition and method for washing
JP6749199B2 (en) * 2016-09-30 2020-09-02 ライオン株式会社 Glitter generation inhibitor for textile products, treatment liquid for gloss product suppression for textile products, and method for suppressing gloss growth of textile products
JP6981871B2 (en) * 2016-12-27 2021-12-17 花王株式会社 Powder detergent composition for textile products
JP6862035B2 (en) * 2017-01-20 2021-04-21 株式会社Adeka Neutral cleaning agent composition
JP6976704B2 (en) * 2017-04-12 2021-12-08 花王株式会社 Liquid detergent composition for hard surfaces
JP7273126B2 (en) * 2017-04-12 2023-05-12 花王株式会社 LIQUID CLEANER COMPOSITION FOR HARD SURFACES
EP3409767B1 (en) * 2017-05-30 2020-10-21 AB Enzymes Oy Mannanase variants
EP3409768B1 (en) * 2017-05-30 2020-03-11 AB Enzymes Oy Mannanase variants
CN107490253A (en) * 2017-07-31 2017-12-19 兰溪市捷喜食品加工技术有限公司 The industrial drying machine of high temperature, thermal balance
US11814607B2 (en) 2018-03-02 2023-11-14 Conopco, Inc. Laundry additive composition comprising a soil release polymer/silicone mixture
CN111868222A (en) * 2018-03-02 2020-10-30 荷兰联合利华有限公司 Laundry compositions
CA3138778C (en) * 2019-06-28 2023-12-12 The Procter & Gamble Company Cleaning composition
JP2023547843A (en) * 2020-10-29 2023-11-14 ザ プロクター アンド ギャンブル カンパニー Cleaning composition containing alginate lyase enzyme
GB202020463D0 (en) * 2020-12-23 2021-02-03 Reckitt Benckiser Vanish Bv Mono-phase laundry composition
CN116334043A (en) * 2023-04-25 2023-06-27 云南师范大学 Beta-mannase mutant V337E with improved acid resistance and preparation and application thereof

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4597898A (en) * 1982-12-23 1986-07-01 The Proctor & Gamble Company Detergent compositions containing ethoxylated amines having clay soil removal/anti-redeposition properties
US4548744A (en) * 1983-07-22 1985-10-22 Connor Daniel S Ethoxylated amine oxides having clay soil removal/anti-redeposition properties useful in detergent compositions
PL143146B1 (en) * 1984-12-18 1988-01-30 Ts Osrodek Badawczo Rozwo Method of purifying fabrics from plant and other cellulosic impurities
JPS62913A (en) * 1985-06-26 1987-01-06 Lion Corp Cleaner for contact lens
GB8905439D0 (en) * 1989-03-09 1989-04-19 Unilever Plc Enzymatic dishwashing compositions
ATE219136T1 (en) * 1991-01-16 2002-06-15 Procter & Gamble COMPACT DETERGENT COMPOSITIONS WITH HIGHLY ACTIVE CELLULASES
CN1134726A (en) * 1993-10-04 1996-10-30 诺沃挪第克公司 An enzyme preparation comprising a modified enzyme
EP0736085B2 (en) * 1993-12-21 2009-12-16 The Procter & Gamble Company Detergent compositions containing percarbonate, amylase and protease
PE6995A1 (en) * 1994-05-25 1995-03-20 Procter & Gamble COMPOSITION INCLUDING A PROPOXYLATED POLYKYLENE OAMINE POLYKYLENE OAMINE POLYMER AS DIRT SEPARATION AGENT
DE69527793T2 (en) * 1994-06-17 2003-01-02 Genencor Int PLANT CELL WALL CLEANING METHODS OF COMPOSITION CONTAINING HEMICELLULASE ENZYME AND THEIR USE IN CLEANING METHODS
EP0709452A1 (en) * 1994-10-27 1996-05-01 The Procter & Gamble Company Cleaning compositions comprising xylanases
ATE191497T1 (en) * 1994-11-18 2000-04-15 Procter & Gamble DETERGENT COMPOSITIONS CONTAINING LIPASE AND PROTEASE
TW474900B (en) * 1995-05-19 2002-02-01 Betzdearborn Inc Use of mannanases as slime control agents
EP0756000A1 (en) * 1995-07-24 1997-01-29 The Procter & Gamble Company Detergent compositions comprising specific amylase and linear alkyl benzene sulfonate surfactant
DE69628656D1 (en) * 1995-09-20 2003-07-17 Genencor Int MANNASE OF BACILLUS AMYLOLIQUEFACIENS AND METHOD FOR YOUR PREPARATION
CN1207759A (en) * 1995-11-17 1999-02-10 普罗格特-甘布尔公司 Laundry detergent compositions contg. lipolytic enzyme and selected quaternary ammonium compounds
ES2225954T3 (en) * 1996-01-11 2005-03-16 Diversa Corporation GLUCOSIDASE ENZYMES.
ES2230594T3 (en) * 1996-01-29 2005-05-01 Novozymes A/S PROCESS FOR ELIMINATION OR DECOLORATION OF DIRT OR CELLULOSE FABRICS.
US5968893A (en) * 1996-05-03 1999-10-19 The Procter & Gamble Company Laundry detergent compositions and methods for providing soil release to cotton fabric

Also Published As

Publication number Publication date
MXPA00001610A (en) 2001-06-01
WO1999009132A1 (en) 1999-02-25
JP2001515128A (en) 2001-09-18
AU7832798A (en) 1999-03-08
CN1336953A (en) 2002-02-20
JP4090689B2 (en) 2008-05-28
ES2185172T3 (en) 2003-04-16
DE69826294T2 (en) 2005-11-17
CN1469919A (en) 2004-01-21
JP2001515127A (en) 2001-09-18
EP1009794A1 (en) 2000-06-21
AU8065398A (en) 1999-03-08
MXPA00001614A (en) 2001-06-01
CZ2000502A3 (en) 2001-03-14
ATE230013T1 (en) 2003-01-15
AU8064298A (en) 1999-03-08
CZ2000506A3 (en) 2001-03-14
WO1999009128A1 (en) 1999-02-25
BR9811195A (en) 2000-07-25
PT1009795E (en) 2005-02-28
BR9811190A (en) 2000-07-18
JP4090688B2 (en) 2008-05-28
MXPA00001613A (en) 2001-06-01
AU8065198A (en) 1999-03-08
TR200000340T2 (en) 2000-11-21
BR9811189A (en) 2000-07-25
MXPA00001616A (en) 2001-06-01
EP1009796A1 (en) 2000-06-21
WO1999009131A1 (en) 1999-02-25
DK1009795T3 (en) 2005-01-24
CN1301294A (en) 2001-06-27
WO1999009130A1 (en) 1999-02-25
JP2001515130A (en) 2001-09-18
EP0896998A1 (en) 1999-02-17
CA2301205A1 (en) 1999-02-25
BR9811192A (en) 2000-07-18
CA2301168A1 (en) 1999-02-25
BR9811186A (en) 2000-07-25
KR20010022893A (en) 2001-03-26
AU7958198A (en) 1999-03-08
ATE363527T1 (en) 2007-06-15
BR9811191A (en) 2000-07-18
JP2001515132A (en) 2001-09-18
ES2268780T3 (en) 2007-03-16
HUP0003670A3 (en) 2001-06-28
CA2301156A1 (en) 1999-02-25
CA2301200A1 (en) 1999-02-25
JP2001515126A (en) 2001-09-18
CN1276826A (en) 2000-12-13
JP2001515131A (en) 2001-09-18
CA2299410A1 (en) 1999-02-25
ATE332958T1 (en) 2006-08-15
HUP0003670A2 (en) 2001-05-28
DE69835214D1 (en) 2006-08-24
CA2301404A1 (en) 1999-02-25
MXPA00001567A (en) 2001-06-01
JP4090690B2 (en) 2008-05-28
TR200000339T2 (en) 2000-07-21
JP2001515129A (en) 2001-09-18
DE69826294D1 (en) 2004-10-21
AU8064198A (en) 1999-03-08
WO1999009126A1 (en) 1999-02-25
KR20010022908A (en) 2001-03-26
ATE276344T1 (en) 2004-10-15
CA2301167A1 (en) 1999-02-25
DE69810309T2 (en) 2003-10-16
JP2001515133A (en) 2001-09-18
WO1999009127A1 (en) 1999-02-25
ID23442A (en) 2000-04-20
CN1276825A (en) 2000-12-13
AU7833398A (en) 1999-03-08
WO1999009129A1 (en) 1999-02-25
CN1276824A (en) 2000-12-13
DE69810309D1 (en) 2003-01-30
DE69837850D1 (en) 2007-07-12
WO1999009133A1 (en) 1999-02-25
DE69835214T2 (en) 2007-06-21
ES2227845T3 (en) 2005-04-01
MXPA00001618A (en) 2001-06-01
MXPA00001617A (en) 2001-06-01
DE69837850T2 (en) 2008-01-24
AU7833498A (en) 1999-03-08
CN1276005A (en) 2000-12-06
BR9811196A (en) 2000-07-25
CN1306566A (en) 2001-08-01
BR9811187A (en) 2000-07-25
EP1036151A1 (en) 2000-09-20

Similar Documents

Publication Publication Date Title
US6376445B1 (en) Detergent compositions comprising a mannanase and a protease
CA2300696A1 (en) Detergent compositions comprising a mannanase and a protease
US6440911B1 (en) Enzymatic cleaning compositions
US6964943B1 (en) Detergent compositions comprising a mannanase and a soil release polymer
US6486112B1 (en) Laundry detergent compositions comprising a saccharide gum degrading enzyme
EP1141203A1 (en) Detergent compositions comprising a pectin degrading enzymes system
US6420331B1 (en) Detergent compositions comprising a mannanase and a bleach system
EP1009793B1 (en) Enzymatic cleaning compositions
EP1007617B1 (en) Detergent compositions comprising a mannanase and percarbonate
EP1009797B1 (en) Detergent compositions comprising a mannanase and a soil release polymer
WO1999064552A1 (en) Detergent compositions comprising a mannanase and a mid-branched anionic surfactant
EP1009795B1 (en) Detergent compositions comprising a mannanase and a protease

Legal Events

Date Code Title Description
EEER Examination request
FZDE Discontinued