AU8065198A - Detergent compositions comprising a mannanase and a clay - Google Patents

Detergent compositions comprising a mannanase and a clay Download PDF

Info

Publication number
AU8065198A
AU8065198A AU80651/98A AU8065198A AU8065198A AU 8065198 A AU8065198 A AU 8065198A AU 80651/98 A AU80651/98 A AU 80651/98A AU 8065198 A AU8065198 A AU 8065198A AU 8065198 A AU8065198 A AU 8065198A
Authority
AU
Australia
Prior art keywords
mannanase
laundry detergent
fabric care
pct
enzyme
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
AU80651/98A
Inventor
Jean-Luc Philippe Bettiol
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Procter and Gamble Co
Original Assignee
Procter and Gamble Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Procter and Gamble Co filed Critical Procter and Gamble Co
Publication of AU8065198A publication Critical patent/AU8065198A/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/39Organic or inorganic per-compounds
    • C11D3/3942Inorganic per-compounds
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D1/00Detergent compositions based essentially on surface-active compounds; Use of these compounds as a detergent
    • C11D1/38Cationic compounds
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/0005Other compounding ingredients characterised by their effect
    • C11D3/0036Soil deposition preventing compositions; Antiredeposition agents
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/37Polymers
    • C11D3/3703Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds
    • C11D3/3723Polyamines or polyalkyleneimines
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38609Protease or amylase in solid compositions only
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38636Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38645Preparations containing enzymes, e.g. protease or amylase containing cellulase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D2111/00Cleaning compositions characterised by the objects to be cleaned; Cleaning compositions characterised by non-standard cleaning or washing processes
    • C11D2111/10Objects to be cleaned
    • C11D2111/12Soft surfaces, e.g. textile

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Wood Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Inorganic Chemistry (AREA)
  • Detergent Compositions (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

The present invention relates to laundry detergent compositions, comprising a saccharide gum degrading enzyme providing excellent cleaning performance, especially food stain/soil removal, dingy cleaning and whiteness benefits.

Description

WO 99/09129 PCT/US98/12015 1 DETERGENT COMPOSITIONS COMPRISING A MANNANASE AND A CLAY 5 10 Field of the Invention The present invention relates to laundry detergent and/or fabric care compositions comprising a mannanase and a clay. 15 Background of the invention Performance of a detergent product is judged by a number of factors, including the ability to remove soils, and the ability to prevent the redeposition of the 20 soils, or the breakdown products of the soils on the articles in the wash. Therefore, detergent compositions include nowadays a complex combination of active ingredients which fulfil certain specific needs. In particular, current detergent formulations generally include surfactants and detergent enzymes providing cleaning and fabric care benefits. Moreover, the need for detergent 25 compositions which exhibit not only good cleaning properties, but also fabric softening performance and other fabric care benefits, is well-established in the art. Softening clays are commonly used in current laundry detergent and fabric care 30 compositions to provide soft feeling. In EP-A-177 165, the use of softening clay together with cellulase in detergent compositions has been disclosed. EP-A-495 258 describes detergent compositions comprising a surfactant, a builder system, a softening clay and a cellulase. 35 Food and cosmetic stains/soils represent the majority of consumer relevant stains/soils and often comprise food additives such as thickener / stabiliser agents. Indeed, hydrocolloids gums and emulsifiers are commonly used food WO 99/09129 PCT/US98/12015 2 additives. The term "gum" denotes a group of industrially useful polysaccharides (long chain polymer) or their derivatives that hydrate in hot or cold water to from viscous solutions, dispersions or gels. Gums are classified as natural and modified. Natural gums include seaweed extracts, plant extrudates, gums from 5 seed or root, and gums obtained by microbial fermentation. Modified (semisynthetic) gums include cellulose and starch derivatives and certain synthetic gums such as low methoxyl pectin, propylene glycol alginate, and carboxymethyl and hydropropyl guar gum (Gums in Encyclopedia Chemical Technology 4 th Ed. Vol. 12, pp842-862, J. Baird, Kelco division of Merck). See 10 also Carbohydrate Chemistry for Food Scientists (Eagan Press - 1997) by R. L. Whistler and J.N. BeMiller, Chap 4, pp63-89 and Direct Food Additives in Fruit Processing by P. Laslo, Bioprinciples and Applications, Voll, Chapter II, pp313 325 (1996) Technomie publishing. Some of these gums such as guar gum (E412), locust bean (E410) are widely used alone or in combinations in many 15 food applications (Gums in ECT 4 th Ed., Vol. 12 pp842-862, J. Baird, Kelco division of Merck). The guar gum used in these food and cosmetic stains is obtained from the seed endosperm of the leguminous plant Cyamopsis tetragonoloba. The guar gum 20 (also called guaran) extracted from the dicotyledonous seed is composed of a 1 4, b-D-mannopyranosyl unit backbone and is used as a thickening agent in dressing and frozen products and cosmetics (H.-D. Belitz, Food Chemistry pp 243, English version of the second edition, Springer-verlag, 1987, ISBN 0-387 15043-9 (US)) & (Carbohydrate Chemistry for Food Scientists, R.L. Wilstler, 25 eagan press, 1997, ISBN 0-913250-92-9) & (Industrial Gum, second editions, R.L. Whistler pp 308, Academic Press, 1973, ISBN, 0-12-74-6252-x). The locus bean gum (also called carob bean gum or St Jon's bread) is also used in the food industry and is extracted from the seed of an evergreen cultivated in the Mediterranean area. The locus bean gum probably differs from the structure of 30 guar gum only in smaller number of D-galactosyl side chains and have the same 1-4, b-D-mannopyranosyl backbone. In leguminous seeds, water-soluble galactomanann is the main storage carbohydrate, comprising up to 20% of the total dry weight in some cases. Galactomannan has a a-galactose linked to 0-6 of mannose residues and it can also be acetylated to various degree on 0-2 and 35 0-3 of the mannose residues.
WO 99/09129 PCT/US98/12015 3 However, clay is not compatible with some hydrocolloid gums contained in those food and cosmetic stains. It is recognised in the art that guar gum induces precipitation of clay due to its potential to coagulate slimes or clay particles (see Industrial Gum, second editions, R.L. Whistler pp 307, Academic Press, 1973, 5 ISBN, 0-12-74-6252-x). Accordingly, it is an object of the present invention to provide laundry detergent and/or fabric care compositions exhibiting an optimum softening performance and providing an optimum stain removal and cleaning performance, especially on 10 cosmetic and food stains. The above objectives have been met by formulating laundry detergent and/or fabric care compositions comprising a mannanase enzyme and a clay as a softening agent. 15 It has been further found that the performance of the detergent compositions of the present invention is enhanced by the addition of a laundry detergent and/or fabric care ingredient selected from a builder, a cellulase and/or a cationic surfactant. 20 Mannanases have been identified in several Bacillus organisms. For example, Talbot et al., Appl. Environ. Microbiol., vol. 56, No. 11, pp. 3505-3510 (1990) describes a P-mannanase derived from Bacillus stearothermophilus in dimer form having a MW of 162 kDa and an optimum pH of 5.5-7.5. Mendoza et al., World J. 25 Micobio. Boitech., vol. 10, no. 5, pp. 551-555 (1994) describes a p-mannanase derived from Bacillus subtilisis having a MW of 38 kDa, an optimum activity at pH 5.0 / 55 0 C and a pl of 4.8. J0304706 discloses a p-mannanase derived from Bacillus sp. having a MW of 37+/- 3kDa measured by gel filtration, an optimum pH of 8-10 and a pl of 5.3-5.4. J63056289 describes the production of an 30 alkaline, thermostable p-mannase, which hydrolyses p-1,4-D-mannopyranoside bonds of e.g. mannans and produces manno:oligo: saccharides. J63036774 relates to a Bacillus micro-organism FERM P-8856 which produces P3 mannanase and 1-mannosidase, at an alkaline pH. A purified mannanase from Bacillus amyloliquefaciens and its method of preparation useful in the bleaching 35 of pulp and paper, is disclosed in WO97/11164. WO91/18974 describes an hemicellulase such as a glucanase, xylanase or mannanase, active at extreme WO 99/09129 PCT/US98/12015 4 pH and temperature and the production thereof. W094/25576 describes an enzyme exhibiting a mannanase activity derived from Aspergillus aculeatus CBS 101.43, that might be used for various purposes for which degradation or modification of plant or algae cell wall material is desired. W093/24622 discloses 5 a mannanase isolated from Trichoderma reesie for bleaching lignocellulosic pulps. However, the synergistic combination of a mannanase and a clay for optimum softening performance and optimum stain removal and cleaning performance, 10 especially on cosmetic and food stains in a laundry detergent and/or fabric care composition, has never been previously recognised. Summary of the invention 15 The present invention relates to laundry detergent and/or fabric care compositions comprising a mannanase and clay for providing an optimum softening performance and providing an optimum stain removal and cleaning performance, especially on cosmetic and food stains. 20 Detailed description of the invention It is known in the art that clay is not compatible with some the hydrocolloid gums 25 contained in for example food and cosmetics stains. It is has been recognised that guar gum induces precipitation of clay due to its potential to coagulate slimes or clay particles (see Industrial Gum, second editions, R.L. Whistler pp 307, Academic Press, 1973, ISBN, 0-12-74-6252-x). 30 Without wishing to be bound by theory, it has been found that such flocculated clay have a reduced softening effect. Moreover, it has been observed that clay and soil from the wash load redeposit on the guar gum residues and cause staining. It is been surprisingly found that the mannanase enzyme hydrolyse hydrocolloid gums, in particular guar gums. This enzyme hydrolysis results in the 35 absence of guar gum in the wash. Therefore, there is no clay flocculation and the clay retains its full fabric care potential. Moreover, there is no guar gum WO 99/09129 PCT/US98/12015 5 residues remaining on the fabric and therefore no redeposition of clay and soil with the following wash load and therefore no staining. 5 The mannanase enzyme An essential element of the laundry detergent and/or fabric care compositions of the present invention is a mannanase enzyme. 10 Encompassed in the present invention are the following three mannans degrading enzymes : EC 3.2.1.25 : P-mannosidase, EC 3.2.1.78 : Endo-1,4-p mannosidase, referred therein after as "mannanase" and EC 3.2.1.100 : 1,4-3 mannobiosidase (IUPAC Classification- Enzyme nomenclature, 1992 ISBN 0-12 227165-3 Academic Press). 15 More preferably, the laundry detergent and/or fabric care compositions of the present invention comprise a P-1,4-Mannosidase (E.C. 3.2.1.78) referred to as Mannanase. The term "mannanase" or "galactomannanase" denotes a mannanase enzyme defined according to the art as officially being named 20 mannan endo-1,4-beta-mannosidase and having the alternative names beta mannanase and endo-1,4-mannanase and catalysing the reaction: random hydrolysis of 1,4-beta-D- mannosidic linkages in mannans, galactomannans, glucomannans, and galactoglucomannans. 25 In particular, Mannanases (EC 3.2.1.78) constitute a group of polysaccharases which degrade mannans and denote enzymes which are capable of cleaving polyose chains contaning mannose units, i.e. are capable of cleaving glycosidic bonds in mannans, glucomannans, galactomannans and galactogluco-mannans. Mannans are polysaccharides having a backbone composed of 3-1,4- linked 30 mannose; glucomannans are polysaccharides having a backbone or more or less regularly alternating P3-1,4 linked mannose and glucose; galactomannans and galactoglucomannans are mannans and glucomannans with a-1,6 linked galactose sidebranches. These compounds may be acetylated. 35 The degradation of galactomannans and galactoglucomannans is facilitated by full or partial removal of the galactose sidebranches. Further the degradation of the acetylated mannans, glucomannans, galactomannans and WO 99/09129 PCT/US98/12015 6 galactoglucomannans is facilitated by full or partial deacetylation. Acetyl groups can be removed by alkali or by mannan acetylesterases. The oligomers which are released from the mannanases or by a combination of mannanases and X galactosidase and/or mannan acetyl esterases can be further degraded to 5 release free maltose by P-mannosidase and/or P-glucosidase. Mannanases have been identified in several Bacillus organisms. For example, Talbot et al., Appl. Environ. Microbiol., Vol.56, No. 11, pp. 3505-3510 (1990) describes a beta-mannanase derived from Bacillus stearothermophilus in dimer 10 form having molecular weight of 162 kDa and an optimum pH of 5.5-7.5. Mendoza et al., World J. Microbiol. Biotech., Vol. 10, No. 5, pp. 551-555 (1994) describes a beta-mannanase derived from Bacillus subtilis having a molecular weight of 38 kDa, an optimum activity at pH 5.0 and 55C and a pl of 4.8. JP 0304706 discloses a beta-mannanase derived from Bacillus sp., having a 15 molecular weight of 373 kDa measured by gel filtration, an optimum pH of 8-10 and a pl of 5.3-5.4. JP-63056289 describes the production of an alkaline, thermostable beta-mannanase which hydrolyses beta-1,4-D-mannopyranoside bonds of e.g. mannans and produces manno-oligosaccharides. JP-63036774 relates to the Bacillus microorganism FERM P-8856 which produces beta 20 mannanse and beta-mannosidase at an alkaline pH. JP-08051975 discloses alkaline beta-mannanases from alkalophilic Bacillus sp. AM-001. A purified mannanase from Bacillus amyloliquefaciens useful in the bleaching of pulp and paper and a method of preparation thereof is disclosed in WO 97/11164. WO 91/18974 describes a hemicellulase such as a glucanase, xylanase or 25 mannanase active at an extreme pH and temperature. WO 94/25576 discloses an enzyme from Aspergillus aculeatus, CBS 101.43, exhibiting mannanase activity which may be useful for degradation or modification of plant or algae cell wall material. WO 93/24622 discloses a mannanase isolated from Trichoderma reseei useful for bleaching lignocellulosic pulps. An hemicellulase capable of 30 degrading mannan-containing hemicellulose is described in WO91/18974 and a purified mannanase from Bacillus amyloliquefaciens is described in WO97/11164. In particular, this mannanase enzyme will be an alkaline mannanase as defined 35 below, most preferably, a mannanase originating from a bacterial source. Especially, the laundry detergent composition of the present invention will WO 99/09129 PCT/US98/12015 7 comprise an alkaline mannanase selected from the mannanase from the strain Bacillus agaradherens and/or Bacillus subtilisis strain 168, gene yght. The term "alkaline mannanase enzyme" is meant to encompass enzyme having 5 an enzymatic activity of at least 10%, preferably at least 25%, more preferably at least 40% of its maximum activity at a given pH ranging from 7 to 12, preferably 7.5 to 10.5. Most preferably, the laundry detergent and/or fabric care compositions of the 10 present invention will comprise the alkaline mannanase from Bacillus agaradherens. Said mannanase is i) a polypeptide produced by Bacillus agaradherens, NCIMB 40482, or ii) a polypeptide comprising an amino acid sequence as shown in positions 32-343 of SEQ ID NO:2 or 15 iii) an analogue of the polypeptide defined in i) or ii) which is at least 70% homologous with said polypeptide, or is derived from said polypeptide by substitution, deletion or addition of one or several amino acids, or is immunologically reactive with a polyclonal antibody raised against said polypeptide in purified form. 20 The present invention also encompasses an isolated polypeptide having mannanase activity selected from the group consisting of (a) polynucleotide molecules encoding a polypeptide having mannanase activity and comprising a sequence of nucleotides as shown in SEQ ID NO: 25 1 from nucleotide 97 to nucleotide 1029; (b) species homologs of (a); (c) polynucleotide molecules that encode a polypeptide having mannanase activity that is at least 70% identical to the amino acid sequence of SEQ ID NO: 2 from amino acid residue 32 to amino acid residue 343; 30 (d) molecules complementary to (a), (b) or (c); and (e) degenerate nucleotide sequences of (a), (b), (c) or (d). The plasmid pSJ1678 comprising the polynucleotide molecule (the DNA sequence) encoding a mannanase of the present invention has been 35 transformed into a strain of the Escherichia col which was deposited by the inventors according to the Budapest Treaty on the International Recognition of WO 99/09129 PCT/US98/12015 8 the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg lb, D-38124 Braunschweig, Federal Republic of Germany, on 18 May 1998 under the deposition number DSM 12180. 5 A second most preferred enzyme is the mannanase from the Bacillus subtilisis strain 168, which mannanase: i) is encoded by the coding part of the DNA sequence shown in SED ID No. 5 or an analogue of said sequence and/or 10 ii) a polypeptide comprising an amino acid sequence as shown SEQ ID NO:6 or iii) an analogue of the polypeptide defined in ii) which is at least 70% homologous with said polypeptide, or is derived from said polypeptide by substitution, deletion or addition of one or several amino acids, or is 15 immunologically reactive with a polyclonal antibody raised against said polypeptide in purified form. The present invention also encompasses an isolated polypeptide having mannanase activity selected from the group consisting of 20 (a) polynucleotide molecules encoding a polypeptide having mannanase activity and comprising a sequence of nucleotides as shown in SEQ ID NO:5 (b) species homologs of (a); (c) polynucleotide molecules that encode a polypeptide having mannanase 25 activity that is at least 70% identical to the amino acid sequence of SEQ ID NO: 6; (d) molecules complementary to (a), (b) or (c); and (e) degenerate nucleotide sequences of (a), (b), (c) or (d). 30 DEFINITIONS Prior to discussing this invention in further detail, the following terms will first be defined: The term "ortholog" (or "species homolog") denotes a polypeptide or protein obtained from one species that has homology to an analogous polypeptide or 35 protein from a different species.
WO 99/09129 PCT/US98/12015 9 The term "paralog" denotes a polypeptide or protein obtained from a given species that has homology to a distinct polypeptide or protein from that same species. The term "expression vector" denotes a DNA molecule, linear or circular, that 5 comprises a segment encoding a polypeptide of interest operably linked to additional segments that provide for its transcription. Such additional segments may include promoter and terminator sequences, and may optionally include one or more origins of replication, one or more selectable markers, an enhancer, a polyadenylation signal, and the like. Expression vectors are generally derived 10 from plasmid or viral DNA, or may contain elements of both. The expression vector of the invention may be any expression vector that is conveniently subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which the vector it is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e. a vector which exists as 15 an extra chromosomal entity, the replication of which is independent of chromosomal replication, e.g. a plasmid. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated. 20 The term "recombinant expressed" or "recombinantly expressed" used herein in connection with expression of a polypeptide or protein is defined according to the standard definition in the art. Recombinantly expression of a protein is generally performed by using an expression vector as described immediately above. 25 The term "isolated", when applied to a polynucleotide molecule, denotes that the polynucleotide has been removed from its natural genetic milieu and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and 30 include cDNA and genomic clones. Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, but may include naturally occurring 5' and 3' untranslated regions such as promoters and terminators. The identification of associated regions will be evident to one of ordinary skill in the art (see for example, Dynan and Tijan, Nature 316:774-78, 35 1985).
WO 99/09129 PCT/US98/12015 10 The term "an isolated polynucleotide" may alternatively be termed "a cloned polynucleotide". When applied to a protein/polypeptide, the term "isolated" indicates that the protein is found in a condition other than its native environment. In a preferred form, the isolated protein is substantially free of other proteins, 5 particularly other homologous proteins (i.e. "homologous impurities" (see below)). It is preferred to provide the protein in a greater than 40% pure form, more preferably greater than 60% pure form. Even more preferably it is preferred to provide the protein in a highly purified form, i.e., greater than 80% pure, more preferably greater than 95% pure, and even more preferably greater than 99% 10 pure, as determined by SDS-PAGE. The term "isolated protein/polypeptide may alternatively be termed "purified protein/polypeptide". The term "homologous impurities" means any impurity (e.g. another polypeptide than the polypeptide of the invention) which originate from the 15 homologous cell where the polypeptide of the invention is originally obtained from. The term "obtained from" as used herein in connection with a specific microbial source, means that the polynucleotide and/or polypeptide produced by the specific source, or by a cell in which a gene from the source have been inserted. 20 The term "operably linked", when referring to DNA segments, denotes that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in the promoter and proceeds through the coding segment to the terminator. The term "polynucleotide" denotes a single- or double- stranded polymer of 25 deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end. Polynucleotides include RNA and DNA, and may be isolated from natural sources, synthesized in vitro, or prepared from a combination of natural and synthetic molecules. The term "complements of polynucleotide molecules" denotes polynucleotide 30 molecules having a complementary base sequence and reverse orientation as compared to a reference sequence. For example, the sequence 5' ATGCACGGG 3' is complementary to 5' CCCGTGCAT 3'. The term "degenerate nucleotide sequence" denotes a sequence of nucleotides that includes one or more degenerate codons (as compared to a 35 reference polynucleotide molecule that encodes a polypeptide). Degenerate codons contain different triplets of WO 99/09129 PCT/US98/12015 11 nucleotides, but encode the same amino acid residue (i.e., GAU and GAC triplets each encode Asp). The term "promoter" denotes a portion of a gene containing DNA sequences that provide for the binding of RNA polymerase and initiation of transcription. 5 Promoter sequences are commonly, but not always, found in the 5' non-coding regions of genes. The term "secretory signal sequence" denotes a DNA sequence that encodes a polypeptide (a "secretory peptide") that, as a component of a larger polypeptide, directs the larger polypeptide through a secretory pathway of a cell in which it is 10 synthesized. The larger peptide is commonly cleaved to remove the secretory peptide during transit through the secretory pathway. HOW TO USE A SEQUENCE OF THE INVENTION TO GET OTHER RELATED SEQUENCES: 15 The disclosed sequence information herein relating to a polynucleotide sequence encoding a mannanase of the invention can be used as a tool to identify other homologous mannanases. For instance, polymerase chain reaction (PCR) can be used to amplify sequences encoding other homologous mannanases from a variety of microbial sources, in particular of different Bacillus species. 20 ASSAY FOR ACTIVITY TEST A polypeptide of the invention having mannanase activity may be tested for mannanase activity according to standard test procedures known in the art, such as by applying a solution to be tested to 4 mm diameter holes punched out in 25 agar plates containing 0.2% AZCL galactomannan (carob), i.e. substrate for the assay of endo-1,4-beta-D-mannanase available as CatNo.I- AZGMA from the company Megazyme for US$110.00 per 3 grams (Megazyme's Internet address: http://www.megazyme.com/Purchase/index.html). 30 POLYNUCLEOTIDES: An isolated polynucleotide of the invention will hybridize to similar sized regions of SEQ ID No. 1, or a sequence complementary thereto, under at least medium stringency conditions. In particular polynucleotides of the invention will hybridize to a denatured double 35 stranded DNA probe comprising either the full sequence shown in positions 97 1029 of SEQ ID NO:1 or any probe comprising a subsequence of SEQ ID NO:1 WO 99/09129 PCT/US98/12015 12 having a length of at least about 100 base pairs under at least medium stringency conditions, but preferably at high stringency conditions as described in detail below. Suitable experimental conditions for determining hybridization at medium, or high stringency between a nucleotide probe and a homologous DNA 5 or RNA sequence involves presoaking of the filter containing the DNA fragments or RNA to hybridize in 5 x SSC (Sodium chloride/Sodium citrate, Sambrook et al. 1989) for 10 min, and prehybridization of the filter in a solution of 5 x SSC, 5 x Denhardt's solution (Sambrook et al. 1989), 0.5 % SDS and 100 pg/ml of denatured sonicated salmon sperm DNA (Sambrook et al. 1989), followed by 10 hybridization in the same solution containing a concentration of 10ng/ml of a random-primed (Feinberg, A. P. and Vogelstein, B. (1983) Anal. Biochem. 132:6 13), 32P-dCTP-labeled (specific activity higher than 1 x 109 cpm/pg ) probe for 12 hours at ca. 450C. The filter is then washed twice for 30 minutes in 2 x SSC, 0.5 % SDS at least 600C (medium stringency), still more preferably at least 650C 15 (medium/high stringency), even more preferably at least 700C (high stringency), and even more preferably at least 750C (very high stringency). Molecules to which the oligonucleotide probe hybridizes under these conditions are detected using a x-ray film. As previously noted, the isolated polynucleotides of the present invention include 20 DNA and RNA. Methods for isolating DNA and RNA are well-known in the art. DNA and RNA encoding genes of interest can be cloned in Gene Banks or DNA libraries by means of methods known in the art. Polynucleotides encoding polypeptides having mannanase activity of the invention are then identified and isolated by, for example, hybridization or PCR. 25 The present invention further provides counterpart polypeptides and polynucleotides from different bacterial strains (orthologs or paralogs). Of particular interest are mannanase polypeptides from gram-positive alkalophilic strains, including species of Bacillus. Species homologues of a polypeptide with mannanase activity of the invention 30 can be cloned using information and compositions provided by the present invention in combination with conventional cloning techniques. For example, a DNA sequence of the present invention can be cloned using chromosomal DNA obtained from a cell type that expresses the protein. Suitable sources of DNA can be identified by probing Northern blots with probes designed from the 35 sequences disclosed herein. A library is then prepared from chromosomal DNA of a positive cell line. A DNA sequence of the invention encoding an polypeptide WO 99/09129 PCT/US98/12015 13 having mannanase activity can then be isolated by a variety of methods, such as by probing with probes designed from the sequences disclosed in the present specification and claims or with one or more sets of degenerate probes based on the disclosed sequences. A DNA sequence of the invention can also be cloned 5 using the polymerase chain reaction, or PCR (Mullis, U.S. Patent 4,683,202), using primers designed from the sequences disclosed herein. Within an additional method, the DNA library can be used to transform or transfect host cells, and expression of the DNA of interest can be detected with an antibody (mono-clonal or polyclonal) raised against the mannanase cloned from o10 B.agaradherens, NCIMB 40482, expressed and purified as described in Materials and Methods and Example 1, or by an activity test relating to a polypeptide having mannanase activity. The mannanase encoding part of the DNA sequence cloned into plasmid pSJ1678 present in Escherichia coli DSM 12180 and/or an analogue DNA 15 sequence of the invention may be cloned from a strain of the bacterial species Bacillus agaradherens, preferably the strain NCIMB 40482, producing the enzyme with mannan degrading activity, or another or related organism as described herein. Alternatively, the analogous sequence may be constructed on the basis of the 20 DNA sequence obtainable from the plasmid present in Escherichia coli DSM 12180 (which is believed to be identical to the attached SEQ ID NO:1), e.g be a sub-sequence thereof, and/or by introduction of nucleotide substitutions which do not give rise to another amino acid sequence of the mannanase encoded by the DNA sequence, but which corresponds to the codon usage of the host organism 25 intended for production of the enzyme, or by introduction of nucleotide substitutions which may give rise to a different amino acid sequence (i.e. a variant of the mannan degrading enzyme of the invention). POLYPEPTIDES: 30 The sequence of amino acids nos. 32-343 of SEQ ID NO: 2 is a mature mannanase sequence. The present invention also provides mannanase polypeptides that are substantially homologous to the polypeptide of SEQ ID NO:2 and species homologs (paralogs or orthologs) thereof. The term "substantially homologous" is 35 used herein to denote polypeptides having 70%, preferably at least 80%, more preferably at least 85%, and even more preferably at least 90%, sequence WO 99/09129 PCT/US98/12015 14 identity to the sequence shown in amino acids nos. 32-343 of SEQ ID NO:2 or their orthologs or paralogs. Such polypeptides will more preferably be at least 95% identical, and most preferably 98% or more identical to the sequence shown in amino acids nos. 32-343 of SEQ ID NO:2 or its orthologs or paralogs. Percent 5 sequence identity is determined by conventional methods, by means of computer programs known in the art such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) as disclosed in Needleman, S.B. and Wunsch, C.D., (1970), Journal of Molecular 10 Biology, 48, 443-453, which is hereby incorporated by reference in its entirety. GAP is used with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1. Sequence identity of polynucleotide molecules is determined by similar methods using GAP with the following settings for DNA sequence comparison: GAP 15 creation penalty of 5.0 and GAP extension penalty of 0.3. The enzyme preparation of the invention is preferably derived from a microorganism, preferably from a bacterium, an archea or a fungus, especially from a bacterium such as a bacterium belonging to Bacillus, preferably to an alkalophilic Bacillus strain which may be selected from the group consisting of the species Bacillus agaradherens and highly related Bacillus species in which all species preferably are at least 95%, even more preferably at least 98%, homologous to Bacillus agaradherens based on aligned 16S rDNA sequences. Substantially homologous proteins and polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably of a minor nature, that is conservative amino acid substitutions (see Table 2) and other substitutions that do not significantly affect the folding or 20 activity of the protein or polypeptide; small deletions, typically of one to about 30 amino acids; and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or a small extension that facilitates purification (an affinity tag), such as a poly-histidine tract, protein A (Nilsson et al., EMBO J. 4:1075, 1985; Nilsson et 25 al., Methods Enzymol. 198:3, 1991. See, in general Ford et al., Protein Expression and Purification 2: 95-107, 1991, which is incorporated herein by reference. DNAs encoding affinity tags are available from commercial suppliers (e.g., Pharmacia Biotech, Piscataway, NJ; New England Biolabs, Beverly, MA).
WO 99/09129 PCT/US98/12015 15 However, even though the changes described above preferably are of a minor nature, such changes may also be of a larger nature such as fusion of larger polypeptides of up to 300 amino acids or more both as amino- or carboxyl terminal extensions to a Mannanase polypeptide of the invention. 5 Table 1 Conservative amino acid substitutions Basic arginine, lysine, histidine Acidic glutamic acid, aspartic acid Polar glutamine, asparagine Hydrophobic leucine, isoleucine, valine Aromatic phenylalanine, tryptophan, tyrosine Small glycine, alanine, serine, threonine, methionine 10 In addition to the 20 standard amino acids, non-standard amino acids (such as 4 hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline and a-methyl serine) may be substituted for amino acid residues of a polypeptide according to the invention. A limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be 15 substituted for amino acid residues. "Unnatural amino acids" have been modified after protein synthesis, and/or have a chemical structure in their side chain(s) different from that of the standard amino acids. Unnatural amino acids can be chemically synthesized, or preferably, are commercially available, and include pipecolic acid, thiazolidine carboxylic acid, dehydroproline, 3- and 4 20 methylproline, and 3,3-dimethylproline. Essential amino acids in the mannanase polypeptides of the present invention can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244: 1081-1085, 1989). In the latter technique, single alanine mutations are 25 introduced at every residue in the molecule, and the resultant mutant molecules are tested for biological activity (i.e mannanase activity) to identify amino acid residues that are critical to the activity of the molecule. See also, Hilton et al., J. Biol. Chem. 271:4699-4708, 1996. The active site of the enzyme or other biological interaction can also be determined by physical analysis of structure, as 30 determined by such techniques as nuclear magnetic resonance, crystallography, WO 99/09129 PCT/US98/12015 16 electron diffraction or photoaffinity labeling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., Science 255:306-312, 1992; Smith et al., J. Mol. Biol. 224:899-904, 1992; Wlodaver et al., FEBS Lett. 309:59-64, 1992. The identities of essential amino acids can also be 5 inferred from analysis of homologies with polypeptides which are related to a polypeptide according to the invention. Multiple amino acid substitutions can be made and tested using known methods of mutagenesis, recombination and/or shuffling followed by a relevant screening procedure, such as those disclosed by Reidhaar-Olson and Sauer (Science 10 241:53-57, 1988), Bowie and Sauer (Proc. Natl. Acad. Sci. USA 86:2152-2156, 1989), WO95/17413, or WO 95/22625. Briefly, these authors disclose methods for simultaneously randomizing two or more positions in a polypeptide, or recombination/shuffling of different mutations (WO95/17413, WO95/22625), followed by selecting for functional a polypeptide, and then sequencing the 15 mutagenized polypeptides to determine the spectrum of allowable substitutions at each position. Other methods that can be used include phage display (e.g., Lowman et al., Biochem. 30:10832-10837, 1991; Ladner et al., U.S. Patent No. 5,223,409; Huse, WIPO Publication WO 92/06204) and region-directed mutagenesis (Derbyshire et al., Gene 46:145, 1986; Ner et al., DNA 7:127, 20 1988). Mutagenesis/shuffling methods as disclosed above can be combined with high throughput, automated screening methods to detect activity of cloned, mutagenized polypeptides in host cells. Mutagenized DNA molecules that encode active polypeptides can be recovered from the host cells and rapidly 25 sequenced using modern equipment. These methods allow the rapid determination of the importance of individual amino acid residues in a polypeptide of interest, and can be applied to polypeptides of unknown structure. Using the methods discussed above, one of ordinary skill in the art can identify and/or prepare a variety of polypeptides that are substantially homologous to 30 residues 32 to 343 of SEQ ID NO: 2 and retain the mannanase activity of the wild-type protein. PROTEIN PRODUCTION: The proteins and polypeptides of the present invention, including full-length 35 proteins, fragments thereof and fusion proteins, can be produced in genetically engineered host cells according to conventional techniques. Suitable host cells WO 99/09129 PCT/US98/12015 17 are those cell types that can be transformed or transfected with exogenous DNA and grown in culture, and include bacteria, fungal cells, and cultured higher eukaryotic cells. Bacterial cells, particularly cultured cells of gram-positive organisms, are preferred. Gram-positive cells from the genus of Bacillus are 5 especially preferred, such as from the group consisting of Bacillus subtilis, Bacillus lentus, Bacillus brevis, Bacillus stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus circulans, Bacillus lautus, Bacillus thuringiensis, Bacillus licheniformis, and Bacillus agaradherens, in particular Bacillus agaradherens. 10 Techniques for manipulating cloned DNA molecules and introducing exogenous DNA into a variety of host cells are disclosed by Sambrook et al., Molecular Cloninq: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley and Sons, Inc., NY, 1987; and "Bacillus subtilis 15 and Other Gram-Positive Bacteria", Sonensheim et al., 1993, American Society for Microbiology, Washington D.C., which are incorporated herein by reference. In general, a DNA sequence encoding a mannanase of the present invention is operably linked to other genetic elements required for its expression, generally including a transcription promoter and terminator within an expression vector. 20 The vector will also commonly contain one or more selectable markers and one or more origins of replication, although those skilled in the art will recognize that within certain systems selectable markers may be provided on separate vectors, and replication of the exogenous DNA may be provided by integration into the host cell genome. Selection of promoters, terminators, selectable markers, 25 vectors and other elements is a matter of routine design within the level of ordinary skill in the art. Many such elements are described in the literature and are available through commercial suppliers. To direct a polypeptide into the secretory pathway of a host cell, a secretory signal sequence (also known as a leader sequence, prepro sequence or pre 30 sequence) is provided in the expression vector. The secretory signal sequence may be that of the polypeptide, or may be derived from another secreted protein or synthesized de novo. Numerous suitable secretory signal sequences are known in the art and reference is made to "Bacillus subtilis and Other Gram Positive Bacteria", Sonensheim et al., 1993, American Society for Microbiology, 35 Washington D.C.; and Cutting, S. M.(eds.) "Molecular Biological Methods for Bacillus", John Wiley and Sons, 1990, for further description of suitable secretory WO 99/09129 PCT/US98/12015 18 signal sequences especially for secretion in a Bacillus host cell. The secretory signal sequence is joined to the DNA sequence in the correct reading frame. Secretory signal sequences are commonly positioned 5' to the DNA sequence encoding the polypeptide of interest, although certain signal sequences may be 5 positioned elsewhere in the DNA sequence of interest (see, e.g., Welch et al., U.S. Patent No. 5,037,743; Holland et al., U.S. Patent No. 5,143,830). Transformed or transfected host cells are cultured according to conventional procedures in a culture medium containing nutrients and other components required for the growth of the chosen host cells. A variety of suitable media, 10 including defined media and complex media, are known in the art and generally include a carbon source, a nitrogen source, essential amino acids, vitamins and minerals. Media may also contain such components as growth factors or serum, as required. The growth medium will generally select for cells containing the exogenously added DNA by, for example, drug selection or deficiency in an 15 essential nutrient which is complemented by the selectable marker carried on the expression vector or co-transfected into the host cell. PROTEIN ISOLATION: When the expressed recombinant polypeptide is secreted the polypeptide may 20 be purified from the growth media. Preferably the expression host cells are removed from the media before purification of the polypeptide (e.g. by centrifugation). When the expressed recombinant polypeptide is not secreted from the host cell, the host cell are preferably disrupted and the polypeptide released into an 25 aqueous "extract" which is the first stage of such purification techniques. Preferably the expression host cells are collected from the media before the cell disruption (e.g. by centrifugation). The cell disruption may be performed by conventional techniques such as by lysozyme digestion or by forcing the cells through high pressure. See (Robert K. 30 Scobes, Protein Purification, Second edition, Springer-Verlag) for further description of such cell disruption techniques. Whether or not the expressed recombinant polypeptides (or chimeric polypeptides) is secreted or not it can be purified using fractionation and/or conventional purification methods and media. 35 Ammonium sulfate precipitation and acid or chaotrope extraction may be used for fractionation of samples. Exemplary purification steps may include WO 99/09129 PCT/US98/12015 19 hydroxyapatite, size exclusion, FPLC and reverse-phase high performance liquid chromatography. Suitable anion exchange media include derivatized dextrans, agarose, cellulose, polyacrylamide, specialty silicas, and the like. PEI, DEAE, QAE and Q derivatives are preferred, with DEAE Fast-Flow Sepharose 5 (Pharmacia, Piscataway, NJ) being particularly preferred. Exemplary chromatographic media include those media derivatized with phenyl, butyl, or octyl groups, such as Phenyl-Sepharose FF (Pharmacia), Toyopearl butyl 650 (Toso Haas, Montgomeryville, PA), Octyl-Sepharose (Pharmacia) and the like; or polyacrylic resins, such as Amberchrom CG 71 (Toso Haas) and the like. o10 Suitable solid supports include glass beads, silica-based resins, cellulosic resins, agarose beads, cross-linked agarose beads, polystyrene beads, cross-linked polyacrylamide resins and the like that are insoluble under the conditions in which they are to be used. These supports may be modified with reactive groups that allow attachment of proteins by amino groups, carboxyl groups, sulfhydryl 15 groups, hydroxyl groups and/or carbohydrate moieties. Examples of coupling chemistries include cyanogen bromide activation, N-hydroxysuccinimide activation, epoxide activation, sulfhydryl activation, hydrazide activation, and carboxyl and amino derivatives for carbodiimide coupling chemistries. These and other solid media are well-known and widely used in the art, and are available 20 from commercial suppliers. Selection of a particular method is a matter of routine design and is determined in part by the properties of the chosen support. See, for example, Affinity Chromatography: Principles & Methods, Pharmacia LKB Biotechnology, Uppsala, Sweden, 1988. 25 Polypeptides of the invention or fragments thereof may also be prepared through chemical synthesis. Polypeptides of the invention may be monomers or multimers; glycosylated or non-glycosylated; pegylated or non-pegylated; and may or may not include an initial methionine amino acid residue. 30 Based on the sequence information disclosed herein a full length DNA sequence encoding a mannanase of the invention and comprising the DNA sequence shown in SEQ ID No 1, at least the DNA sequence from position 97 to position 1029, may be cloned. Cloning is performed by standard procedures known in the art such as by, 35 U preparing a genomic library from a Bacillus strain, especially the strain B. agaradherens, NCIMB 40482; WO 99/09129 PCT/US98/12015 20 a plating such a library on suitable substrate plates; * identifying a clone comprising a polynucleotide sequence of the invention by standard hybridization techniques using a probe based on SEQ ID No 1; or by * identifying a clone from said Bacillus agaradherens NCIMB 40482 genomic 5 library by an Inverse PCR strategy using primers based on sequence information from SEQ ID No 1. Reference is made to M.J. MCPherson et al. ("PCR A practical approach" Information Press Ltd, Oxford England) for further details relating to Inverse PCR. Based on the sequence information disclosed herein (SEQ ID No 1, SEQ ID No 10 2) is it routine work for a person skilled in the art to isolate homologous polynucleotide sequences encoding homologous mannanase of the invention by a similar strategy using genomic libraries from related microbial organisms, in particular from genomic libraries from other strains of the genus Bacillus such as alkalophilic species of Bacillus. 15 Alternatively, the DNA encoding the mannan or galactomannan-degrading enzyme of the invention may, in accordance with well-known procedures, conveniently be cloned from a suitable source, such as any of the above mentioned organisms, by use of synthetic oligonucleotide probes prepared on the basis of the DNA sequence obtainable from the plasmid present in 20 Escherichia col DSM 12180. Accordingly, the polynucleotide molecule of the invention may be isolated from Escherichia col, DSM 12180, in which the plasmid obtained by cloning such as described above is deposited. Also, the present invention relates to an isolated substantially pure biological culture of the strain Escherichia col, DSM 12180. In the present context, the term "enzyme preparation" is intended to mean either a conventional enzymatic fermentation product, possibly isolated and purified, from a single species of a microorganism, such preparation usually comprising a number of different enzymatic activities; or a mixture of 25 monocomponent enzymes, preferably enzymes derived from bacterial or fungal species by using conventional recombinant techniques, which enzymes have been fermented and possibly isolated and purified separately and which may originate from different species, preferably fungal or bacterial species; or the fermentation product of a microorganism which acts as a host cell for expression 30 of a recombinant mannanase, but which microorganism simultaneously produces other enzymes, e.g. pectin degrading enzymes, proteases, or cellulases, being naturally occurring fermentation products of the microorganism, i.e. the enzyme WO 99/09129 PCT/US98/12015 21 complex conventionally produced by the corresponding naturally occurring microorganism. A method of producing the enzyme preparation of the invention, the method 5 comprising culturing a microorganism, eg a wild-type strain, capable of producing the mannanase under conditions permitting the production of the enzyme, and recovering the enzyme from the culture. Culturing may be carried out using conventional fermentation techniques, e.g. culturing in shake flasks or fermentors with agitation to ensure sufficient aeration on a growth medium inducing 10 production of the mannanase enzyme. The growth medium may contain a conventional N-source such as peptone, yeast extract or casamino acids, a reduced amount of a conventional C-source such as dextrose or sucrose, and an inducer such as guar gum or locust bean gum. The recovery may be carried out using conventional techniques, e.g. separation of bio-mass and supernatant by 15 centrifugation or filtration, recovery of the supernatant or disruption of cells if the enzyme of interest is intracellular, perhaps followed by further purification as described in EP 0 406 314 or by crystallization as described in WO 97/15660. IMMUNOLOGICAL CROSS-REACTIVITY: 20 Polyclonal antibodies to be used in determining immunological cross-reactivity may be prepared by use of a purified mannanase enzyme. More specifically, antiserum against the mannanase of the invention may be raised by immunizing rabbits (or other rodents) according to the procedure described by N. Axelsen et al. in: A Manual of Quantitative Immunoelectrophoresis, Blackwell Scientific 25 Publications, 1973, Chapter 23, or A. Johnstone and R. Thorpe, Immunochemistry in Practice, Blackwell Scientific Publications, 1982 (more specifically p. 27-31). Purified immunoglobulins may be obtained from the antisera, for example by salt precipitation ((NH 4
)
2
SO
4 ), followed by dialysis and ion exchange chromatography, e.g. on DEAE-Sephadex. Immunochemical 30 characterization of proteins may be done either by Outcherlony double-diffusion analysis (0. Ouchterlony in: Handbook of Experimental Immunology (D.M. Weir, Ed.), Blackwell Scientific Publications, 1967, pp. 655-706), by crossed immunoelectrophoresis (N. Axelsen et al., supra, Chapters 3 and 4), or by rocket immunoelectrophoresis (N. Axelsen et al., Chapter 2). 35 WO 99/09129 PCT/US98/12015 22 Examples of useful bacteria producing the enzyme or the enzyme preparation of the invention are Gram positive bacteria, preferably from the Bacillus/Lactobacillus subdivision, preferably a strain from the genus Bacillus, more preferably a strain of Bacillus agaradherens, especially the strain Bacillus 5 agaradherens, NCIMB 40482. The present invention includes an isolated mannanase having the properties described above and which is free from homologous impurities, and is produced using conventional recombinant techniques. 10 DETERMINATION OF CATALYTIC ACTIVITY (ManU) OF MANNANASE Colorimetric Assay:Substrate: 0.2% AZCL-Galactomannan (Megazyme, Australia) from carob in 0.1 M Glycin buffer, pH1i0.0. The assay is carried out in an Eppendorf Micro tube 1.5 ml on a thermomixer with stirring and temperature control of 40 0 C. Incubation of 0.750 ml substrate with 0.05 ml enzyme for 20 min, 15 stop by centrifugation for 4 minutes at 15000 rpm. The color of the supernatant is measured at 600 nm in a 1 cm cuvette. One ManU (Mannanase units) gives 0.24 abs in 1 cm. OBTENTION OF THE BACILLUS AGARADHERENS MANNANASE NCIMB 20 40482 Strains Bacillus agaradherens NCIMB 40482 comprises the mannanase enzyme encoding DNA sequence. E. coli strain: Cells of E. coli SJ2 (Diderichsen, B., Wedsted, U., Hedegaard, L., 25 Jensen, B. R., Sjoholm, C. (1990) Cloning of aldB, which encodes alpha acetolactate decarboxylase, an exoenzyme from Bacillus brevis. J. Bacteriol., 172, 4315-4321), were prepared for and transformed by electroporation using a Gene PulserTM electroporator from BIO-RAD as described by the supplier. B.subtilis PL2306. This strain is the B.subtilis DN1885 with disrupted apr and npr 30 genes (Diderichsen, B., Wedsted, U., Hedegaard, L., Jensen, B. R., Sjoholm, C. (1990) Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis. J. Bacteriol., 172, 4315-4321) disrupted in the transcriptional unit of the known Bacillus subtilis cellulase gene, resulting in cellulase negative cells. The disruption was performed essentially as described in 35 ( Eds. A.L. Sonenshein, J.A. Hoch and Richard Losick (1993) Bacillus subtilis and other Gram-Positive Bacteria, American Society for microbiology, p.618).
WO 99/09129 PCT/US98/12015 23 Competent cells were prepared and transformed as described by Yasbin, R.E., Wilson, G.A. and Young, F.E. (1975) Transformation and transfection in lysogenic strains of Bacillus subtilis: evidence for selective induction of prophage in competent cells. J. Bacteriol, 121:296-304. 5 Plasmids pSJ1678 (as described in detail in WO 94/19454 which is hereby incorporated by reference in its entirety). pMOL944: This plasmid is a pUB110 derivative essentially containing elements 10 making the plasmid propagatable in Bacillus subtilis, kanamycin resistance gene and having a strong promoter and signal peptide cloned from the amyL gene of B.Iicheniformis ATCC14580. The signal peptide contains a SaclI site making it convenient to clone the DNA encoding the mature part of a protein in-fusion with the signal peptide. This results in the expression of a Pre-protein which is 15 directed towards the exterior of the cell. The plasmid was constructed by means of conventional genetic engineering techniques which are briefly described in the following. Construction of pMOL944: The pUB110 plasmid (McKenzie, T. et al., 1986, Plasmid 15:93-103) was 20 digested with the unique restriction enzyme Ncil. A PCR fragment amplified from the amyL promoter encoded on the plasmid pDN1981 (P.L. Jorgensen et al.,1990, Gene, 96, p37-41.) was digested with Ncil and inserted in the Ncil digested pUB110 to give the plasmid pSJ2624. The two PCR primers used have the following sequences: 25 # LWN5494 5' GTCGCCGGGGCGGCCGCTATCAATTGGTAACTGTATCTCAGC -3' # LWN5495 5' GTCGCCCGGGAGCTCTGATCAGGTACCAAGCTTGTCGACCTGCAGAA TGAGGCAGCAAGAAGAT -3' 30 The primer #LWN5494 inserts a Notl site in the plasmid. The plasmid pSJ2624 was then digested with Sacl and NotI and a new PCR fragment amplified on amyL promoter encoded on the pDN1981 was digested with Sacl and Notl and this DNA fragment was inserted in the SacI-Notl digested 35 pSJ2624 to give the plasmid pSJ2670.
WO 99/09129 PCT/US98/12015 24 This cloning replaces the first amyL promoter cloning with the same promoter but in the opposite direction. The two primers used for PCR amplification have the following sequences: 5 #LWN5938 5' GTCGGCGGCCGCTGATCACGTACCAAGCTTGTCGACCTGCAGAATG AGGCAGCAAGAAGAT -3' #LWN5939 5'-GTCGGAGCTCTATCAATTGGTAACTGTATCTCAGC -3' 10 The plasmid pSJ2670 was digested with the restriction enzymes Pstl and Bcll and a PCR fragment amplified from a cloned DNA sequence encoding the alkaline amylase SP722 (disclosed in the International Patent Application published as WO95/26397 which is hereby incorporated by reference in its entirety) was digested with Pstl and Bcll and inserted to give the plasmid 15 pMOL944. The two primers used for PCR amplification have the following sequence: #LWN7864 5' -AACAGCTGATCACGACTGATCTTTTAGCTTGGCAC-3' #LWN7901 5' -AACTGCAGCCGCGGCACATCATAATGGGACAAATGGG -3' The primer #LWN7901 inserts a SaclI site in the plasmid. 20 Cloning of the mannanase gene from Bacillus agaradherens Genomic DNA preparation: Strain Bacillus agaradherens NCIMB 40482 was propagated in liquid medium as described in WO94/01532. After 16 hours incubation at 300C and 300 rpm, the cells were harvested, and genomic DNA isolated by the method described by Pit 25 cher et al. (Pitcher, D. G., Saunders, N. A., Owen, R. J. (1989). Rapid extraction of bacterial genomic DNA with guanidium thiocyanate. Lett. Appl. Microbiol., 8, 151-156). Genomic library construction: Genomic DNA was partially digested with restriction enzyme Sau3A, and size 30 fractionated by electrophoresis on a 0.7 % agarose gel. Fragments between 2 and 7 kb in size was isolated by electrophoresis onto DEAE-cellulose paper (Dretzen, G., Bellard, M., Sassone-Corsi, P., Chambon, P. (1981) A reliable method for the recovery of DNA fragments from agarose and acrylamide gels. Anal. Biochem., 112, 295-298).
WO 99/09129 PCT/US98/12015 25 Isolated DNA fragments were ligated to BamHI digested pSJ1678 plasmid DNA, and the ligation mixture was used to transform E. coil SJ2. Identification of positive clones: A DNA library in E. col, constructed as described above, was screened on LB 5 agar plates containing 0.2% AZCL-galactomannan (Megazyme) and 9 pg/ml Chloramphenicol and incubated overnight at 370C. Clones expressing mannanase activity appeared with blue diffusion halos. Plasmid DNA from one of these clone was isolated by Qiagen plasmid spin preps on 1 ml of overnight culture broth (cells incubated at 370C in TY with 9 pg/ml Chloramphenicol and 10 shaking at 250 rpm). This clone (MB525) was further characterized by DNA sequencing of the cloned Sau3A DNA fragment. DNA sequencing was carried out by primerwalking, using the Taq deoxy-terminal cycle sequencing kit (Perkin-Elmer, USA), fluorescent labelled terminators and appropriate oligonucleotides as primers. 15 Analysis of the sequence data was performed according to Devereux et al. (1984) Nucleic Acids Res. 12, 387-395. The sequence encoding the mannanase is shown in SEQ ID No 1. The derived protein sequence is shown in SEQ ID No.2. Subcloning and expression of mannanase in B.subtilis: 20 The mannanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligo nucleotides: Mannanase.upper.Sacll 5'-CAT TCT GCA GCC GCG GCA GCA AGT ACA GGC TTT TAT GTT GAT GG 3' 25 Mannanase.lower.Notl 5'-GAC GAC GTA CAA GCG GCC GCG CTA TTT CCC TAA CAT GAT GAT ATT TTC G -3' Restriction sites Sacl and NotlI are underlined. Chromosomal DNA isolated from B.agaradherens NCIMB 40482 as described 30 above was used as template in a PCR reaction using Amplitaq DNA Polymerase (Perkin Elmer) according to manufacturers instructions. The PCR reaction was set up in PCR buffer (10 mM Tris-HCI, pH 8.3, 50 mM KCI, 1.5 mM MgCI 2 , 0.01 % (w/v) gelatin) containing 200 pM of each dNTP, 2.5 units of AmpliTaq polymerase (Perkin-Elmer, Cetus, USA) and 100 pmol of each primer. 35 The PCR reaction was performed using a DNA thermal cycler (Landgraf, Germany). One incubation at 94 0 C for 1 min followed by thirty cycles of PCR WO 99/09129 PCT/US98/12015 26 performed using a cycle profile of denaturation at 940C for 30 sec, annealing at 600C for 1 min, and extension at 720C for 2 min. Five-pl aliquots of the amplification product was analysed by electrophoresis in 0.7 % agarose gels (NuSieve, FMC). The appearance of a DNA fragment size 1.4 kb indicated 5 proper amplification of the gene segment. Subcloning of PCR fragment. Fortyfive-pl aliquots of the PCR products generated as described above were purified using QlAquick PCR purification kit (Qiagen, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 pl of 10mM Tris 10 HCI, pH 8.5. 5 pg of pMOL944 and twentyfive-pI of the purified PCR fragment was digested with Sacll and NotI, electrophoresed in 0.8% low gelling temperature agarose (SeaPlaque GTG, FMC) gels, the relevant fragments were excised from the gels, and purified using QIAquick Gel extraction Kit (Qiagen, USA) according to the 15 manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the SaclI-Notl digested and purified pMOL944. The ligation was performed overnight at 160C using 0.5pg of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boehringer Mannheim, Germany). The ligation mixture was used to transform competent B.subtilis PL2306. The 20 transformed cells were plated onto LBPG-10 pg/ml of Kanamycin plates. After 18 hours incubation at 370C colonies were seen on plates. Several clones were analysed by isolating plasmid DNA from overnight culture broth. One such positive clone was restreaked several times on agar plates as used above, this clone was called MB594. The clone MB594 was grown overnight in 25 TY-10 pg/ml kanamycin at 370C, and next day 1 ml of cells were used to isolate plasmid from the cells using the Qiaprep Spin Plasmid Miniprep Kit #27106 according to the manufacturers recommendations for B.subtilis plasmid preparations. This DNA was DNA sequenced and revealed the DNA sequence corresponding to the mature part of the mannanase, i.e. positions 94-1404 of the 30 appended SEQ ID NO:3. The derived mature protein is shown in SEQ ID NO:4. It will appear that the 3' end of the mannanse encoded by the sequence of SEQ ID NO:1 was changed to the one shown in SEQ ID NO:3 due to the design of the lower primer used in the PCR. The resulting amino acid sequence is shown in SEQ ID NO:4 and it is apparent that the C terminus of the SEQ ID NO:2 35 (SHHVREIGVQFSAADNSSGQTALYVDNVTLR) is changed to the C terminus of SEQ ID NO:4 (IIMLGK).
WO 99/09129 PCT/US98/12015 27 Media: TY (as described in Ausubel, F. M. et al. (eds.) "Current protocols in Molecular Biology". John Wiley and Sons, 1995). LB agar (as described in Ausubel, F. M. et al. (eds.) "Current protocols in 5 Molecular Biology". John Wiley and Sons, 1995). LBPG is LB agar (see above) supplemented with 0.5% Glucose and 0.05 M potassium phosphate, pH 7.0 BPX media is described in EP 0 506 780 (WO 91/09129). 10 Expression, purification and characterisation of mannanase from Bacillus agaradherens The clone MB 594 obtained as described above under Materials and Methods was grown in 25 x 200ml BPX media with 10 pg/ml of Kanamycin in 500ml two baffled shakeflasks for 5 days at 37oC at 300 rpm. 15 6500 ml of the shake flask culture fluid of the clone MB 594 (batch #9813) was collected and pH adjusted to 5.5. 146 ml of cationic agent (C521) and 292 ml of anionic agent (A130) was added during agitation for flocculation. The flocculated material was separated by centrifugation using a Sorval RC 3B centrifuge at 9000 rpm for 20 min at 60C. The supernatant was clarified using Whatman glass 20 filters GF/D and C and finally concentrated on a filtron with a cut off of 10 kDa. 750 ml of this concentrate was adjusted to pH 7.5 using sodium hydroxide. The clear solution was applied to anion-exchange chromatography using a 900 ml Q Sepharose column equilibrated with 50 mmol Tris pH 7.5. The mannanase activity bound was eluted using a sodium chloride gradient. 25 The pure enzyme gave a single band in SDS-PAGE with a molecular weight of 38 kDa. The amino acid sequence of the mannanase enzyme, i.e. the translated DNA sequence, is shown in SEQ ID No.2. Determination of kinetic constants: Substrate: Locust bean gum (carob) and reducing sugar analysis (PHBAH). 30 Locust bean gum from Sigma (G-0753). Kinetic determination using different concentrations of locust bean gum and incubation for 20 min at 400C at pH 10 gave Kcat: 467 per sec. Kin: 0.08 gram per I 35 MW: 38kDa pl (isoelectric point): 4.2 WO 99/09129 PCT/US98/12015 28 The temperature optimum of the mannanase was found to be 60 0 C. The pH activity profile showed maximum activity between pH 8 and 10. DSC differential scanning calometry gives 77oC as melting point at pH 7.5 in Tris buffer indicating that this enzyme is very thermostable. 5 Detergent compatibility using 0.2% AZCL-Galactomannan from carob as substrate and incubation as described above at 40oC shows excellent compatibility with conventional liquid detergents and good compatibility with conventional powder detergents. 10 OBTENTION OF THE BACILLUS SUBTILISIS MANNANASE 168 The Bacillus subtilisis p-mannanase was characterised and purified as follows : The Bacillus subtilis genome was searched for homology with a known Bacillus sp P3-Mannanase gene sequence (Mendoza et al., Biochemica et Biophysica Acta 1243:552-554, 1995). The coding region of ydhT, whose product was 15 unknown, showed a 58% similarity to the known Bacillus P-Mannanase. The following oligonucleotides were designed to amplify the sequences coding for the mature portion of the putative P-Mannanase: 5'-GCT CAA TTG GCG CAT ACT GTG TCG CCT GTG-3' and 5'-GAC GGA TCC CGG ATT CAC TCA ACG ATT GGC G-3'. Total genomic DNA from Bacillus subtilis strain 1A95 was used as a 20 template to amplify the ydhT mature region using the aforementioned primers. PCR is performed using the GENE-AMP PCR Kit with AMPLITAQ DNA Polymerase (Perkin Elmer, Applied Biosystems, Foster City, CA). An initial melting period at 95oC for 5 min was followed by 25 cycles of the following program: melting at 95oC for 1 min, annealing at 55oC for 2 min, and extension at 25 72 0 C for 2 min. After the last cycle, the reaction was held at 72°C for 10 min to complete extension. The PCR products were purified using QIAquick PCR purification kit (Qiagen, Chatsworth, CA). The ydhT mature region amplified from Bacillus subtilis strain 1A95 was inserted into the expression vector pPG1524 (previously described) as follows. The 30 amplified 1028bp fragment was digested with Mfe I and BamH I. The expression vector pPG1527 was digested with EcoR I and BamH I. The restriction products were purified using QIAquick PCR purification kit (Qiagen, Chatsworth, CA). The two fragments were ligated using T4 DNA ligase (13 hr, 16oC) and used to transform competent E. coli strain DH5-a. Ampicilin resistant colonies were 35 cultured for DNA preparations. The DNA was then characterized by restriction analysis. Plasmid pPG3200 contains the mature region of the ydhT gene.
WO 99/09129 PCT/US98/12015 29 Plasmid pPG3200 was then used to transform competent Bacillus subtilis strain PG 632 (Saunders et al., 1992). Seven kanamycin resistant Bacillus subtilis clones and one PG 632 control clone were picked and grown in 20ml of 20/20/5 media ( 20g/l tryptone, 20g/I yeast 5 extract, 5g/I NaCI ) supplemented with 1ml 25% maltrin, 120pl 10mM MnCI2, and 20pd of 50 mg/ml kanamycin. Clones were grown overnight in 250ml baffled flasks shaking at 250 rpm at 37 0 C for expression of the protein. Cells were spun out at 14,000rpm for 15 minutes. One [l of each supernatant was diluted in 99pl of 50mM sodium acetate (pH 6.0). One p1 of this dilution was assayed using the 10 endo-1,4-p3-Mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) according to the manufacturers instructions. Absorbance was read at 590 nm on a Beckman DU640 spectrophotometer. Clone 7 showed the highest Absorbance of 1.67. The PG632 control showed no Absorbance at 590nm. Supernatant was analyzed by SDS-PAGE on a 10-20% Tris-Glycine gel (Novex, 15 San Diego, Ca) to confirm expected protein size of 38kDa. Samples were prepared as follows. A 500p sample of ydhT clone 7 and PG 632 supernatants were precipitated with 55.5pl 100% Trichloroacetic acid (Sigma), washed with 100pl 5% Trichloroacetic, resuspended in 50p.l of Tris-glycine SDS sample buffer(Novex) and boiled for five minutes. One #l of each sample was 20 electrophoresed on the gel at 30 mA for 90minutes. A large band of protein was observed to run at 38kDa for ydhTclone 7. A 10 I fermentation of Bacillus subtilis ydhT clone 7 was performed in a B.Braun Biostat C fermentator. Fermentation conditions were as follows. Cells were grown for 18h in a rich media similar to 20/20/5 at 371C. At the end of the fermentation 25 run, the cells were removed and the supernatant concentrated to 1 liter using a tangential flow filtration system. The final yield of P3-Mannanase in the concentrated supernatant was determined to be 3 g/l. The purification of the p-Mannanase from the fermentation supernatant was performed as follows: 500ml of supernatant was centrifuged at 10,000 rpm for 10 30 min at 4 0 C. The centrifuged supernatant was then dialyzed overnight at 4 0 C in two 4 I changes of 10 mM potassium phosphate (pH 7.2) through Spectrapor 12,000-14,000 mol.wt. cutoff membrane (Spectrum). The dialyzed supernatant was centrifuged at 10,000 rpm for 10 min at 4 0 C. A 200 ml Q Sepharose fast flow (Pharmacia) anion exchange column was equilibrated with 1 liter of 10 mM 35 potassium phosphate (pH 7.2) at 20 0 C and 300ml of supernatant was loaded on column. Two flow through fractions of 210 ml (sample A) and 175 ml (sample B) WO 99/09129 PCT/US98/12015 30 were collected. The two fractions were assayed as before, except that the samples were diluted with 199 pl of 50 mM sodium acetate (pH 6.0), and they showed Absorbance of .38 and .52 respectively. Two p1 of each sample was added to 8pl of Tris-glycine SDS sample buffer (Novex, CA) and boiled for 5 min. 5 The resulting samples were electrophoresed on a 10-20% Tris-Glycine gel (Novex, Ca) at 30 mA for 90minutes. A major band corresponding to 38kDa was present in each sample and comprised greater than 95% of the total protein. A BCA protein assay (Pierce) was performed on both samples according to the manufacturers instructions, using bovine serum albumin as standard. Samples A 10 and B contained 1.3 mg/ml and 1.6 mg/ml of P3-Mannanase respectively. The identity of the protein was confirmed by ion spray mass spectrometry and amino terminal amino acid sequence analysis. The purified 1-Mannanase samples were used to characterize the enzymes activity as follows. All assays used endo-1,4-1-Mannanase Beta-Mannazyme 15 Tabs (Megazyme, Ireland) as described earlier. Activity at pH range 3.0-9.0 were performed in 50 mM citrate phosphate buffer, for activity determination at pH 9.5, 50 mM CAPSO (Sigma), and for pH 10.0-11.0 range 50 mM CAPS buffer was employed. The optimum pH for the Bacillus subtilis P3-Mannanase was found to be pH 6.0-6.5. Temperature activity profiles were performed in 50mM citrate 20 phosphate buffer (pH 6.5). The enzyme showed optimum activity at 40-45oC. The Bacillus subtilis P-Mannanase retained significant activity at less than 15 0 C and greater than 800C. Specific activity against P3-1,4-Galactomannan was determined to be 160,000 pmol/min.mg P-Mannanase using endo-1,4-P3 Mannanase Beta-Mannazyme Tabs (Megazyme, Ireland) according to the 25 manufacturers directions. The nucleotide and amino acid sequences of the Bacillus subtilisis P-mannanase are shown in SEQ. ID. No. 5 and 6. The mannanase is incorporated into the compositions of the invention preferably at a level of from 0.0001% to 2%, more preferably from 0.0005% to 0.1%, most 30 preferred from 0.001% to 0.02% pure enzyme by weight of the composition. The enzyme of the invention, in addition to the enzyme core comprising the catalytically domain, also comprise a cellulose binding domain (CBD), the cellulose binding domain and enzyme core (the catalytically active domain) of the 35 enzyme being operably linked. The cellulose binding domain (CBD) may exist as an integral part of the encoded enzyme, or a CBD from another origin may be WO 99/09129 PCT/US98/12015 31 introduced into the enzyme thus creating an enzyme hybrid. In this context, the term "cellulose-binding domain" is intended to be understood as defined by Peter Tomme et al. "Cellulose-Binding Domains: Classification and Properties" in "Enzymatic Degradation of Insoluble Carbohydrates", John N. Saddler and 5 Michael H. Penner (Eds.), ACS Symposium Series, No. 618, 1996. This definition classifies more than 120 cellulose- binding domains into 10 families (I-X), and demonstrates that CBDs are found in various enzymes such as cellulases, xylanases, mannanases, arabinofuranosidases, acetyl esterases and chitinases. CBDs have also been found in algae, e.g. the red alga Porphyra purpurea as a 10 non-hydrolytic polysaccharide-binding protein, see Tomme et al., op.cit. However, most of the CBDs are from cellulases and xylanases, CBDs are found at the N and C termini of proteins or are internal. Enzyme hybrids are known in the art, see e.g. WO 90/00609 and WO 95/16782, and may be prepared by transforming into a host cell a DNA construct comprising at least a fragment of 15 DNA encoding the cellulose- binding domain ligated, with or without a linker, to a DNA sequence encoding the mannanase enzyme and growing the host cell to express the fused gene. Enzyme hybrids may be described by the following formula: CBD - MR - X 20 wherein CBD is the N-terminal or the C-terminal region of an amino acid sequence corresponding to at least the cellulose- binding domain; MR is the middle region (the linker), and may be a bond, or a short linking group preferably of from about 2 to about 100 carbon atoms, more preferably of from 2 to 40 carbon atoms; or is preferably from about 2 to to about 100 amino acids, more 25 preferably of from 2 to 40 amino acids; and X is an N-terminal or C-terminal region of the enzyme of the invention. The above-mentioned enzymes may be of any suitable origin, such as vegetable, animal, bacterial, fungal and yeast origin. Origin can further be mesophilic or 30 extremophilic (psychrophilic, psychrotrophic, thermophilic, barophilic, alkalophilic, acidophilic, halophilic, etc.). Purified or non-purified forms of these enzymes may be used. Nowadays, it is common practice to modify wild-type enzymes via protein / genetic engineering techniques in order to optimise their performance efficiency in the cleaning compositions of the invention. For example, the variants 35 may be designed such that the compatibility of the enzyme to commonly encountered ingredients of such compositions is increased. Alternatively, the WO 99/09129 PCT/US98/12015 32 variant may be designed such that the optimal pH, bleach or chelant stability, catalytic activity and the like, of the enzyme variant is tailored to suit the particular cleaning application. 5 In particular, attention should be focused on amino acids sensitive to oxidation in the case of bleach stability and on surface charges for the surfactant compatibility. The isoelectric point of such enzymes may be modified by the substitution of some charged amino acids, e.g. an increase in isoelectric point may help to improve compatibility with anionic surfactants. The stability of the 10 enzymes may be further enhanced by the creation of e.g. additional salt bridges and enforcing metal binding sites to increase chelant stability. The softening clay 15 A second essential component of the present laundry detergent and/or fabric care compositions is a softening clay. Any clay used in the art or mixtures thereof can be used in the present invention. Preferred examples have been disclosed in GB 1.400.898 or US 5.019.292. 20 Included among such clays are various heat-treated kaolins and various multi layer smectites or bentonites also called montmorillonite. As known from the art, preferred smectite clays exhibit a cation-exchange capacity of at least 50 meq per 100 grams of clay, which corresponds to a layer charge of 0.2 to 0.6. Further 25 preferred are clays which have a particle size in the 5-50 micrometer range. Additionally preferred smectite clays are hectorite clays of the general formula 30 [(Mg3-xLix) Si4-yMellyO 10(OH 2 -zFz)]-(x+y)(x+y)Mn+ n 30 n wherein y=0; or, if y = 0, Me i ll I is Al, Fe, or B; M n + is a monovalent (n=1) or divalent (n=2) metal ion, for example selected from Na, K, Mg, Ca, Sr. The value of (x+y) is the layer charge of the hectorite clay. The hectorite clays suitable for the detergent compositions of the present invention have a layer charge 35 distribution such that at least 50% is in the range of from 0.23 to 0.31.
WO 99/09129 PCT/US98/12015 33 Preferred are hectorite clays of natural origin having a layer charge distribution such that at least 65% is in the range of from 0.23 to 0.31. Specific non-limiting examples of fabric softening smectite clay minerals are: 5 - Sodium Montmorillonite : Borck (R), Volclay BC (R), Gelwhite GP (R), Thixo-Jel (R), Ben-A-Gel (R). - Sodium Hectorite : Veegum F (R) and Laponite SP (R) - Sodium Saponite : Barasym NAS 100 (R) - Calcium Montmorillonite: Soft Clark (R), Gelwhite L (R), Imvite K (R), CSM-Clay 10 (R) from Kimoulos - Lithium Hectorite : Barasym LIH 200 R The amount of softening clay useful in the present invention depends upon the form of the laundry detergent and/or fabric care composition. In general, it can 15 range from lower limits of 0.1%, 3% or 4% to upper limits of 50%, 25% or 15%. Detergent components 20 The laundry detergent and/or fabric care compositions of the invention must contain at least one additional detergent component. The precise nature of these additional component, and levels of incorporation thereof will depend on the physical form of the composition, and the nature of the cleaning operation for which it is to be used. 25 The laundry detergent and/or fabric care compositions of the present invention preferably further comprise a laundry detergent and/or fabric care ingredient selected from a cellulase, a builder selected from zeolite, sodium tripolyphosphate and/or layered silicate, a cationic surfactant and/or mixtures 30 thereof. The laundry detergent and/or fabric care compositions according to the invention can be liquid, paste, gels, bars, tablets, spray, foam, powder or granular. Granular compositions can also be in "compact" form and the liquid compositions 35 can also be in a "concentrated" form.
WO 99/09129 PCT/US98/12015 34 The compositions of the invention may for example, be formulated as hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the soaking and/or pretreatment of stained fabrics, rinse added fabric softener compositions. 5 When formulated as compositions suitable for use in a laundry machine washing method, the compositions of the invention preferably contain both a surfactant system that may contain anionic, cationic, nonionic, zwitterionic or mixture of surfactants and a builder system that may contain phosphate based builder, non 10 phosphate based inorganic zeolite, layered silicate, organic builder such as citrate and additionally one or more detergent components preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti redeposition agents and corrosion inhibitors. Laundry compositions can also 15 contain softening agents different from those inorganic clay claimed in this present invention, as additional detergent components. Such compositions containing a mannananase and a clay can provide fabric cleaning, stain removal, softening, color appearance when formulated as laundry detergent compositions. 20 The compositions of the invention can also be used as detergent additive products in solid or liquid form. Such additive products are intended to supplement or boost the performance of conventional detergent compositions and can be added at any stage of the cleaning process. 25 If needed the density of the laundry detergent compositions herein ranges from 400 to 1200 g/litre, preferably 500 to 950 g/litre of composition measured at 20 0 C. The "compact" form of the compositions herein is best reflected by density and, in terms of composition, by the amount of inorganic filler salt; inorganic filler salts 30 are conventional ingredients of detergent compositions in powder form; in conventional detergent compositions, the filler salts are present in substantial amounts, typically 17-35% by weight of the total composition. In the compact compositions, the filler salt is present in amounts not exceeding 15% of the total composition, preferably not exceeding 10%, most preferably not 35 exceeding 5% by weight of the composition. The inorganic filler salts, such as meant in the present compositions are selected from the alkali and alkaline- WO 99/09129 PCT/US98/12015 35 earth-metal salts of sulphates and chlorides. A preferred filler salt is sodium sulphate. Liquid detergent compositions according to the present invention can also be in a "concentrated form", in such case, the liquid detergent compositions according 5 the present invention will contain a lower amount of water, compared to conventional liquid detergents. Typically the water content of the concentrated liquid detergent is preferably less than 40%, more preferably less than 30%, most preferably less than 20% by weight of the detergent composition. 10 Suitable detergent compounds for use herein are selected from the group consisting of the below described compounds. Surfactant system 15 The laundry detergent and/or fabric care compositions according to the present invention can further comprise a surfactant system wherein the surfactant can be selected from nonionic and/or anionic cationic and/or and/or ampholytic and/or zwitterionic and/or semi-polar surfactants. The laundry detergent and/or fabric 20 care compositions of the present invention will preferably further comprise a cationic surfactant. It has been surprisingly found that said compositions further comprising a cationic surfactant, provide improved cleaning and softening performance. 25 The other surfactant is typically present at a level of from 0.1% to 60% by weight. More preferred levels of incorporation are 1% to 35% by weight, most preferably from 1% to 30% by weight of laundry detergent and/or fabric care compositions in accord with the invention. 30 The surfactant is preferably formulated to be compatible with enzyme components present in the composition. In liquid or gel compositions the surfactant is most preferably formulated such that it promotes, or at least does not degrade, the stability of any enzyme in these compositions. 35 Polyethylene, polypropylene, and polybutylene oxide condensates of alkyl phenols are suitable for use as the nonionic surfactant of the surfactant systems WO 99/09129 PCT/US98/12015 36 of the present invention, with the polyethylene oxide condensates being preferred. These compounds include the condensation products of alkyl phenols having an alkyl group containing from about 6 to about 14 carbon atoms, preferably from about 8 to about 14 carbon atoms, in either a straight-chain or 5 branched-chain configuration with the alkylene oxide. In a preferred embodiment, the ethylene oxide is present in an amount equal to from about 2 to about 25 moles, more preferably from about 3 to about 15 moles, of ethylene oxide per mole of alkyl phenol. Commercially available nonionic surfactants of this type include IgepalTM CO-630, marketed by the GAF Corporation; and TritonTM X o10 45, X-114, X-100 and X-102, all marketed by the Rohm & Haas Company. These surfactants are commonly referred to as alkylphenol alkoxylates (e.g., alkyl phenol ethoxylates). The condensation products of primary and secondary aliphatic alcohols with from 15 about 1 to about 25 moles of ethylene oxide are suitable for use as the nonionic surfactant of the nonionic surfactant systems of the present invention. The alkyl chain of the aliphatic alcohol can either be straight or branched, primary or secondary, and generally contains from about 8 to about 22 carbon atoms. Preferred are the condensation products of alcohols having an alkyl group 20 containing from about 8 to about 20 carbon atoms, more preferably from about 10 to about 18 carbon atoms, with from about 2 to about 10 moles of ethylene oxide per mole of alcohol. About 2 to about 7 moles of ethylene oxide and most preferably from 2 to 5 moles of ethylene oxide per mole of alcohol are present in said condensation products. Examples of commercially available nonionic 25 surfactants of this type include TergitolTM 15-S-9 (the condensation product of
C
1 1
-C
15 linear alcohol with 9 moles ethylene oxide), TergitolTM 24-L-6 NMW (the condensation product of C 12
-C
14 primary alcohol with 6 moles ethylene oxide with a narrow molecular weight distribution), both marketed by Union Carbide Corporation; NeodolTM 45-9 (the condensation product of C 14
-C
15 30 linear alcohol with 9 moles of ethylene oxide), NeodolTM 23-3 (the condensation product of C 12
-C
13 linear alcohol with 3.0 moles of ethylene oxide), NeodolTM 45-7 (the condensation product of C 14
-C
15 linear alcohol with 7 moles of ethylene oxide), NeodolTM 45-5 (the condensation product of C 14
-C
15 linear alcohol with 5 moles of ethylene oxide) marketed by Shell Chemical Company, 35 KyroTM EOB (the condensation product of C 13
-C
15 alcohol with 9 moles ethylene oxide), marketed by The Procter & Gamble Company, and Genapol LA WO 99/09129 PCT/US98/12015 37 030 or 050 (the condensation product of C 12
-C
14 alcohol with 3 or 5 moles of ethylene oxide) marketed by Hoechst. Preferred range of HLB in these products is from 8-11 and most preferred from 8-10. 5 Also useful as the nonionic surfactant of the surfactant systems of the present invention are the alkylpolysaccharides disclosed in U.S. Patent 4,565,647, Llenado, issued January 21, 1986, having a hydrophobic group containing from about 6 to about 30 carbon atoms, preferably from about 10 to about 16 carbon atoms and a polysaccharide, e.g. a polyglycoside, hydrophilic group containing 10 from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7 saccharide units. Any reducing saccharide containing 5 or 6 carbon atoms can be used, e.g., glucose, galactose and galactosyl moieties can be substituted for the glucosyl moieties (optionally the hydrophobic group is attached at the 2-, 3-, 4-, etc. positions thus giving a glucose or 15 galactose as opposed to a glucoside or galactoside). The intersaccharide bonds can be, e.g., between the one position of the additional saccharide units and the 2-, 3-, 4-, and/or 6- positions on the preceding saccharide units. The preferred alkylpolyglycosides have the formula 20 R 2 0(CnH2nO)t(glycosyl)x wherein R 2 is selected from the group consisting of alkyl, alkylphenyl, hydroxyalkyl, hydroxyalkylphenyl, and mixtures thereof in which the alkyl groups contain from about 10 to about 18, preferably from about 12 to about 14, carbon 25 atoms; n is 2 or 3, preferably 2; t is from 0 to about 10, preferably 0; and x is from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7. The glycosyl is preferably derived from glucose. To prepare these compounds, the alcohol or alkylpolyethoxy alcohol is formed first and then reacted with glucose, or a source of glucose, to form the glucoside 30 (attachment at the 1-position). The additional glycosyl units can then be attached between their 1-position and the preceding glycosyl units 2-, 3-, 4- and/or 6 position, preferably predominately the 2-position. The condensation products of ethylene oxide with a hydrophobic base formed by 35 the condensation of propylene oxide with propylene glycol are also suitable for use as the additional nonionic surfactant systems of the present invention. The WO 99/09129 PCT/US98/12015 38 hydrophobic portion of these compounds will preferably have a molecular weight of from about 1500 to about 1800 and will exhibit water insolubility. The addition of polyoxyethylene moieties to this hydrophobic portion tends to increase the water solubility of the molecule as a whole, and the liquid character of the 5 product is retained up to the point where the polyoxyethylene content is about 50% of the total weight of the condensation product, which corresponds to condensation with up to about 40 moles of ethylene oxide. Examples of compounds of this type include certain of the commercially-available PlurafacTM LF404 and PluronicTM surfactants, marketed by BASF. 10 Also suitable for use as the nonionic surfactant of the nonionic surfactant system of the present invention, are the condensation products of ethylene oxide with the product resulting from the reaction of propylene oxide and ethylenediamine. The hydrophobic moiety of these products consists of the reaction product of 15 ethylenediamine and excess propylene oxide, and generally has a molecular weight of from about 2500 to about 3000. This hydrophobic moiety is condensed with ethylene oxide to the extent that the condensation product contains from about 40% to about 80% by weight of polyoxyethylene and has a molecular weight of from about 5,000 to about 11,000. Examples of this type of nonionic 20 surfactant include certain of the commercially available TetronicTM compounds, marketed by BASF. Preferred for use as the nonionic surfactant of the surfactant systems of the present invention are polyethylene oxide condensates of alkyl phenols, 25 condensation products of primary and secondary aliphatic alcohols with from about 1 to about 25 moles of ethylene oxide, alkylpolysaccharides, and mixtures thereof. Most preferred are C 8
-C
14 alkyl phenol ethoxylates having from 3 to 15 ethoxy groups and C 8
-C
18 alcohol ethoxylates (preferably C 10 avg.) having from 2 to 10 ethoxy groups, and mixtures thereof. 30 Highly preferred nonionic surfactants are polyhydroxy fatty acid amide surfactants of the formula.
R
2 -C-N-Z, 35 II I O R 1 WO 99/09129 PCT/US98/12015 39 wherein R 1 is H, or R 1 is C14 hydrocarbyl, 2-hydroxy ethyl, 2-hydroxy propyl or a mixture thereof, R 2 is C 5
-
3 1 hydrocarbyl, and Z is a polyhydroxyhydrocarbyl having a linear hydrocarbyl chain with at least 3 hydroxyls directly connected to 5 the chain, or an alkoxylated derivative thereof. Preferably, R 1 is methyl, R 2 is a straight C 1 1
-
15 alkyl or C16- 18 alkyl or alkenyl chain such as coconut alkyl or mixtures thereof, and Z is derived from a reducing sugar such as glucose, fructose, maltose, lactose, in a reductive amination reaction. 10 Suitable anionic surfactants to be used are linear alkyl benzene sulfonate, alkyl ester sulfonate surfactants including linear esters of C 8
-C
2 0 carboxylic acids (i.e., fatty acids) which are sulfonated with gaseous SO 3 according to "The Journal of the American Oil Chemists Society", 52 (1975), pp. 323-329. Suitable starting materials would include natural fatty substances as derived from tallow, 15 palm oil, etc. The preferred alkyl ester sulfonate surfactant, especially for laundry applications, comprise alkyl ester sulfonate surfactants of the structural formula: O II 20 R 3 - CH - C - OR 4 I
SO
3 M wherein R 3 is a C 8
-C
20 hydrocarbyl, preferably an alkyl, or combination thereof,
R
4 is a C 1
-C
6 hydrocarbyl, preferably an alkyl, or combination thereof, and M is 25 a cation which forms a water soluble salt with the alkyl ester sulfonate. Suitable salt-forming cations include metals such as sodium, potassium, and lithium, and substituted or unsubstituted ammonium cations, such as monoethanolamine, diethanolamine, and triethanolamine. Preferably, R 3 is C1 0
-C
16 alkyl, and R 4 is methyl, ethyl or isopropyl. Especially preferred are the methyl ester sulfonates 30 wherein R 3 is C 10
-C
16 alkyl. Other suitable anionic surfactants include the alkyl sulfate surfactants which are water soluble salts or acids of the formula ROSO 3 M wherein R preferably is a
C
10
-C
24 hydrocarbyl, preferably an alkyl or hydroxyalkyl having a C 10
-C
2 0 alkyl 35 component, more preferably a C12-C18 alkyl or hydroxyalkyl, and M is H or a cation, e.g., an alkali metal cation (e.g. sodium, potassium, lithium), or WO 99/09129 PCT/US98/12015 40 ammonium or substituted ammonium (e.g. methyl-, dimethyl-, and trimethyl ammonium cations and quaternary ammonium cations such as tetramethyl ammonium and dimethyl piperdinium cations and quaternary ammonium cations derived from alkylamines such as ethylamine, diethylamine, triethylamine, and 5 mixtures thereof, and the like). Typically, alkyl chains of C 12
-C
16 are preferred for lower wash temperatures (e.g. below about 500C) and C 16
-
18 alkyl chains are preferred for higher wash temperatures (e.g. above about 500C). Other anionic surfactants useful for detersive purposes can also be included in 10 the cleaning compositions of the present invention. These can include salts (including, for example, sodium, potassium, ammonium, and substituted ammonium salts such as mono-, di- and triethanolamine salts) of soap, C8-C22 primary of secondary alkanesulfonates, C8-C24 olefinsulfonates, sulfonated polycarboxylic acids prepared by sulfonation of the pyrolyzed product of alkaline 15 earth metal citrates, e.g., as described in British patent specification No. 1,082,179, C8-C24 alkylpolyglycolethersulfates (containing up to 10 moles of ethylene oxide); alkyl glycerol sulfonates, fatty acyl glycerol sulfonates, fatty oleyl glycerol sulfates, alkyl phenol ethylene oxide ether sulfates, paraffin sulfonates, alkyl phosphates, isethionates such as the acyl isethionates, N-acyl taurates, 20 alkyl succinamates and sulfosuccinates, monoesters of sulfosuccinates (especially saturated and unsaturated C12-C18 monoesters) and diesters of sulfosuccinates (especially saturated and unsaturated C6-C12 diesters), acyl sarcosinates, sulfates of alkylpolysaccharides such as the sulfates of alkylpolyglucoside (the nonionic nonsulfated compounds being described below), 25 branched primary alkyl sulfates, and alkyl polyethoxy carboxylates such as those of the formula RO(CH2CH20)k-CH2COO-M+ wherein R is a C8-C22 alkyl, k is an integer from 1 to 10, and M is a soluble salt-forming cation. Resin acids and hydrogenated resin acids are also suitable, such as rosin, hydrogenated rosin, and resin acids and hydrogenated resin acids present in or derived from tall oil. 30 Further examples are described in "Surface Active Agents and Detergents" (Vol. I and II by Schwartz, Perry and Berch). A variety of such surfactants are also generally disclosed in U.S. Patent 3,929,678, issued December 30, 1975 to Laughlin, et al. at Column 23, line 58 through Column 29, line 23 (herein 35 incorporated by reference).
WO 99/09129 PCT/US98/12015 41 When included therein, the laundry laundry detergent and/or fabric care compositions of the present invention typically comprise from about 1% to about 40%, preferably from about 3% to about 20% by weight of such anionic surfactants. 5 Highly preferred anionic surfactants include alkyl alkoxylated sulfate surfactants hereof are water soluble salts or acids of the formula RO(A)mSO3M wherein R is an unsubstituted C10-C24 alkyl or hydroxyalkyl group having a C10-C24 alkyl component, preferably a C12-C20 alkyl or hydroxyalkyl, more preferably C 12 10 C18 alkyl or hydroxyalkyl, A is an ethoxy or propoxy unit, m is greater than zero, typically between about 0.5 and about 6, more preferably between about 0.5 and about 3, and M is H or a cation which can be, for example, a metal cation (e.g., sodium, potassium, lithium, calcium, magnesium, etc.), ammonium or substituted-ammonium cation. Alkyl ethoxylated sulfates as well as alkyl 15 propoxylated sulfates are contemplated herein. Specific examples of substituted ammonium cations include methyl-, dimethyl, trimethyl-ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and those derived from alkylamines such as ethylamine, diethylamine, triethylamine, mixtures thereof, and the like. Exemplary surfactants 20 are C12-C18 alkyl polyethoxylate (1.0) sulfate (C 12
-C
18 E(1.0)M), C12-C18 alkyl polyethoxylate (2.25) sulfate (C 1 2-C1 8 E(2.25)M), C12-C18 alkyl polyethoxylate (3.0) sulfate (C 12
-C
18 E(3.0)M), and C 12
-C
18 alkyl polyethoxylate (4.0) sulfate
(C
12
-C
18 E(4.0)M), wherein M is conveniently selected from sodium and potassium. 25 The laundry detergent and/or fabric care compositions of the present invention may also contain ampholytic, zwitterionic, and semi-polar surfactants, as well as the nonionic and/or anionic surfactants other than those already described herein. 30 Ampholytic surfactants are also suitable for use in the laundry detergent and/or fabric care compositions of the present invention. These surfactants can be broadly described as aliphatic derivatives of secondary or tertiary amines, or aliphatic derivatives of heterocyclic secondary and tertiary amines in which the 35 aliphatic radical can be straight- or branched-chain. One of the aliphatic substituents contains at least about 8 carbon atoms, typically from about 8 to WO 99/09129 PCT/US98/12015 42 about 18 carbon atoms, and at least one contains an anionic water-solubilizing group, e.g. carboxy, sulfonate, sulfate. See U.S. Patent No. 3,929,678 to Laughlin et al., issued December 30, 1975 at column 19, lines 18-35, for examples of ampholytic surfactants. 5 When included therein, the laundry detergent and/or fabric care compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such ampholytic surfactants. Zwitterionic surfactants are also suitable for use in laundry detergent and/or 10 fabric care compositions. These surfactants can be broadly described as derivatives of secondary and tertiary amines, derivatives of heterocyclic secondary and tertiary amines, or derivatives of quaternary ammonium, quaternary phosphonium or tertiary sulfonium compounds. See U.S. Patent No. 3,929,678 to Laughlin et al., issued December 30, 1975 at column 19, line 38 15 through column 22, line 48, for examples of zwitterionic surfactants. When included therein, the laundry detergent and/or fabric care compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such zwitterionic surfactants. 20 Semi-polar nonionic surfactants are a special category of nonionic surfactants which include water-soluble amine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; water-soluble phosphine oxides containing one alkyl 25 moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; and water-soluble sulfoxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and a moiety selected from the group consisting of alkyl and hydroxyalkyl moieties of from about 1 to 30 about 3 carbon atoms. Semi-polar nonionic detergent surfactants include the amine oxide surfactants having the formula 0 35 R 3
(OR
4 )xN(R5)2 WO 99/09129 PCT/US98/12015 43 wherein R 3 is an alkyl, hydroxyalkyl, or alkyl phenyl group or mixtures therof containing from about 8 to about 22 carbon atoms; R 4 is an alkylene or hydroxyalkylene group containing from about 2 to about 3 carbon atoms or mixtures thereof; x is from 0 to about 3; and each R 5 is an alkyl or hydroxyalkyl 5 group containing from about 1 to about 3 carbon atoms or a polyethylene oxide group containing from about 1 to about 3 ethylene oxide groups. The R 5 groups can be attached to each other, e.g., through an oxygen or nitrogen atom, to form a ring structure. These amine oxide surfactants in particular include C10-C18 alkyl dimethyl 10 amine oxides and C8-C12 alkoxy ethyl dihydroxy ethyl amine oxides. When included therein, the cleaning compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such semi-polar nonionic surfactants. 15 The laundry detergent and/or fabric care composition of the present invention may further comprise a co-surfactant selected from the group of primary or tertiary amines. Suitable primary amines for use herein include amines according to the formula
R
1
NH
2 wherein R 1 is a C6-C12, preferably C6-C10 alkyl chain or R4X(CH2)n, X 20 is -O-,-C(O)NH- or -NH-, R 4 is a C6-C12 alkyl chain n is between 1 to 5, preferably 3. R 1 alkyl chains may be straight or branched and may be interrupted with up to 12, preferably less than 5 ethylene oxide moieties. Preferred amines according to the formula herein above are n-alkyl amines. Suitable amines for use herein may be selected from 1-hexylamine, 1 25 octylamine, 1-decylamine and laurylamine. Other preferred primary amines include C8-C10 oxypropylamine, octyloxypropylamine, 2-ethylhexyl oxypropylamine, lauryl amido propylamine and amido propylamine. Suitable tertiary amines for use herein include tertiary amines having the formula 30 R 1
R
2
R
3 N wherein R1 and R2 are C1-C8 alkylchains or
R
5
-(CH
2 -CH-O H
R
3 is either a C6-C12, preferably C6-C10 alkyl chain, or R 3 is R4X(CH2)n, whereby X is -0-, -C(O)NH- or -NH-,R 4 is a C4-C12, n is between 1 to 5, preferably 2-3. R 5 is H or C1-C2 alkyl and x is between 1 to 6.
WO 99/09129 PCT/US98/12015 44
R
3 and R 4 may be linear or branched ; R 3 alkyl chains may be interrupted with up to 12, preferably less than 5, ethylene oxide moieties. Preferred tertiary amines are R 1
R
2
R
3 N where R1 is a C6-C12 alkyl chain, R2 5 and R3 are C1-C3 alkyl or R5
-(CH
2 -- CH-O xH where R5 is H or CH3 and x = 1-2. 10 Also preferred are the amidoamines of the formula: O R, -C-NH-(CH 2 )-N-( R 2 ) n 2 wherein R 1 is C6-C12 alkyl; n is 2-4, preferably n is 3; R 2 and R 3 is C1-C 4 15 Most preferred amines of the present invention include 1-octylamine, 1 hexylamine, 1-decylamine, 1-dodecylamine,C8-10oxypropylamine, N coco 1 3diaminopropane, coconutalkyldimethylamine, lauryldimethylamine, lauryl bis(hydroxyethyl)amine, coco bis(hydroxyehtyl)amine, lauryl amine 2 moles propoxylated, octyl amine 2 moles propoxylated, lauryl amidopropyl 20 dimethylamine, C8-10 amidopropyldimethylamine and C10 amidopropyldi methylamine. The most preferred amines for use in the compositions herein are 1-hexylamine, 1-octylamine, 1-decylamine, 1-dodecylamine. Especially desirable are n dodecyldimethylamine and bishydroxyethylcoconutalkylamine and oleylamine 7 25 times ethoxylated, lauryl amido propylamine and cocoamido propylamine. Bleaching agent 30 The laundry detergent and/or fabric care compositions of the present invention can further comprise a bleaching agent such as hydrogen peroxide, PB1, PB4 and percarbonate with a particle size of 400-800 microns. These bleaching agent components can include one or more oxygen bleaching agents and, WO 99/09129 PCT/US98/12015 45 depending upon the bleaching agent chosen, one or more bleach activators. When present oxygen bleaching compounds will typically be present at levels of from about 1% to about 25%. 5 The bleaching agent component for use herein can be any of the bleaching agents useful for laundry detergent and/or fabric care compositions including oxygen bleaches as well as others known in the art. The bleaching agent suitable for the present invention can be an activated or non-activated bleaching agent. 10 One category of oxygen bleaching agent that can be used encompasses percarboxylic acid bleaching agents and salts thereof. Suitable examples of this class of agents include magnesium monoperoxyphthalate hexahydrate, the magnesium salt of meta-chloro perbenzoic acid, 4-nonylamino-4 oxoperoxybutyric acid and diperoxydodecanedioic acid. Such bleaching agents 15 are disclosed in U.S. Patent 4,483,781, U.S. Patent Application 740,446, European Patent Application 0,133,354 and U.S. Patent 4,412,934. Highly preferred bleaching agents also include 6-nonylamino-6-oxoperoxycaproic acid as described in U.S. Patent 4,634,551. Another category of bleaching agents that can be used encompasses the 20 halogen bleaching agents. Examples of hypohalite bleaching agents, for example, include trichloro isocyanuric acid and the sodium and potassium dichloroisocyanurates and N-chloro and N-bromo alkane sulphonamides. Such materials are normally added at 0.5-10% by weight of the finished product, preferably 1-5% by weight. 25 The hydrogen peroxide releasing agents can be used in combination with bleach activators such as tetraacetylethylenediamine (TAED), nonanoyloxybenzene sulfonate (NOBS, described in US 4,412,934), 3,5, trimethylhexanoloxybenzenesulfonate (ISONOBS, described in EP 120,591) or 30 pentaacetylglucose (PAG)or Phenolsulfonate ester of N-nonanoyl-6 aminocaproic acid (NACA-OBS, described in WO94/28106), which are perhydrolyzed to form a peracid as the active bleaching species, leading to improved bleaching effect. Also suitable activators are acylated citrate esters such as disclosed in co-pending European Patent Application No. 91870207.7 35 and unsymetrical acyclic imide bleach activator of the following formula as WO 99/09129 PCT/US98/12015 46 disclosed in the Procter & Gamble co-pending patent applications US serial No. 60/022,786 (filed July 30, 1996) and No. 60/028,122 (filed October 15, 1996): OO RI N
R
3 I R2 5 wherein R 1 is a C7-C13 linear or branched chain saturated or unsaturated alkyl group, R 2 is a 01-C8, linear or branched chain saturated or unsaturated alkyl group and R 3 is a Cl-C4 linear or branched chain saturated or unsaturated alkyl group. 10 Useful bleaching agents, including peroxyacids and bleaching systems comprising bleach activators and peroxygen bleaching compounds for use in laundry detergent and/or fabric care compositions according to the invention are described in our co-pending applications USSN 08/136,626, PCT/US95/07823, W095/27772, W095/27773, W095/27774 and W095/27775. 15 The hydrogen peroxide may also be present by adding an enzymatic system (i.e. an enzyme and a substrate therefore) which is capable of generating hydrogen peroxide at the beginning or during the washing and/or rinsing process. Such enzymatic systems are disclosed in EP Patent Application 91202655.6 filed 20 October 9, 1991. Metal-containing catalysts for use in bleach compositions, include cobalt containing catalysts such as Pentaamine acetate cobalt(Ill) salts and manganese-containing catalysts such as those described in EPA 549 271; EPA 25 549 272; EPA 458 397; US 5,246,621; EPA 458 398; US 5,194,416 and US 5,114,611. Bleaching composition comprising a peroxy compound, a manganese-containing bleach catalyst and a chelating agent is described in the patent application No 94870206.3. 30 Bleaching agents other than oxygen bleaching agents are also known in the art and can be utilized herein. One type of non-oxygen bleaching agent of particular interest includes photoactivated bleaching agents such as the sulfonated zinc and/or aluminum phthalocyanines. These materials can be deposited upon the WO 99/09129 PCT/US98/12015 47 substrate during the washing process. Upon irradiation with light, in the presence of oxygen, such as by hanging clothes out to dry in the daylight, the sulfonated zinc phthalocyanine is activated and, consequently, the substrate is bleached. Preferred zinc phthalocyanine and a photoactivated bleaching process 5 are described in U.S. Patent 4,033,718. Typically, laundry detergent and/or fabric care compositions will contain about 0.025% to about 1.25%, by weight, of sulfonated zinc phthalocyanine. 10 Builder system The laundry detergent and/or fabric care compositions of the present invention can further comprise a builder. The laundry detergent and/or fabric care compositions of the present invention will preferably further comprise a builder 15 selected from zeolite, sodium tripolyphosphate and/or layered silicate. It has been surprisingly found that said compositions further comprising a builder selected from zeolite, sodium tripolyphosphate and/or layered silicate, provide improved cleaning and softening performance. 20 Any conventional builder system is suitable for use herein including aluminosilicate materials, silicates, polycarboxylates, alkyl- or alkenyl-succinic acid and fatty acids, materials such as ethylenediamine tetraacetate, diethylene triamine pentamethyleneacetate, metal ion sequestrants such as aminopolyphosphonates, particularly ethylenediamine tetramethylene 25 phosphonic acid and diethylene triamine pentamethylenephosphonic acid. Phosphate builders can also be used herein. Suitable builders can be an inorganic ion exchange material, commonly an inorganic hydrated aluminosilicate material, more particularly a hydrated 30 synthetic zeolite such as hydrated zeolite A, X, B, HS or MAP. Another suitable inorganic builder material is layered silicate, e.g. SKS-6 (Hoechst). SKS-6 is a crystalline layered silicate consisting of sodium silicate (Na2Si205). Suitable polycarboxylates containing one carboxy group include lactic acid, 35 glycolic acid and ether derivatives thereof as disclosed in Belgian Patent Nos. 831,368, 821,369 and 821,370. Polycarboxylates containing two carboxy groups WO 99/09129 PCT/US98/12015 48 include the water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, maleic acid, diglycollic acid, tartaric acid, tartronic acid and fumaric acid, as well as the ether carboxylates described in German Offenlegenschrift 2,446,686, and 2,446,687 and U.S. Patent No. 3,935,257 and the sulfinyl 5 carboxylates described in Belgian Patent No. 840,623. Polycarboxylates containing three carboxy groups include, in particular, water-soluble citrates, aconitrates and citraconates as well as succinate derivatives such as the carboxymethyloxysuccinates described in British Patent No. 1,379,241, lactoxysuccinates described in Netherlands Application 7205873, and the 10 oxypolycarboxylate materials such as 2-oxa-1,1,3-propane tricarboxylates described in British Patent No. 1,387,447. Polycarboxylates containing four carboxy groups include oxydisuccinates disclosed in British Patent No. 1,261,829, 1,1,2,2-ethane tetracarboxylates, 15 1,1,3,3-propane tetracarboxylates and 1,1,2,3-propane tetracarboxylates. Polycarboxylates containing sulfo substituents include the sulfosuccinate derivatives disclosed in British Patent Nos. 1,398,421 and 1,398,422 and in U.S. Patent No. 3,936,448, and the sulfonated pyrolysed citrates described in British Patent No. 1,082,179, while polycarboxylates containing phosphone substituents 20 are disclosed in British Patent No. 1,439,000. Alicyclic and heterocyclic polycarboxylates include cyclopentane-cis,cis,cis tetracarboxylates, cyclopentadienide pentacarboxylates, 2,3,4,5-tetrahydro-furan - cis, cis, cis-tetracarboxylates, 2,5-tetrahydro-furan -cis - dicarboxylates, 2,2,5,5 25 tetrahydrofuran - tetracarboxylates, 1,2,3,4,5,6-hexane -hexacar-boxylates and and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol. Aromatic poly-carboxylates include mellitic acid, pyromellitic acid and the phthalic acid derivatives disclosed in British Patent No. 1,425,343. Of the above, the preferred polycarboxylates are hydroxycarboxylates containing 30 up to three carboxy groups per molecule, more particularly citrates. Preferred builder systems for use in the present compositions include a mixture of a water-insoluble aluminosilicate builder such as zeolite A or of a layered silicate (SKS-6), and a water-soluble carboxylate chelating agent such as citric 35 acid. Other preferred builder systems include a mixture of a water-insoluble aluminosilicate builder such as zeolite A, and a watersoluble carboxylate WO 99/09129 PCT/US98/12015 49 chelating agent such as citric acid. Preferred builder systems for use in liquid laundry detergent and/or fabric care compositions of the present invention are soaps and polycarboxylates. 5 Other builder materials that can form part of the builder system for use in granular compositions include inorganic materials such as alkali metal carbonates, bicarbonates, silicates, and organic materials such as the organic phosphonates, amino polyalkylene phosphonates and amino polycarboxylates. Other suitable water-soluble organic salts are the homo- or co-polymeric acids or 10 their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms. Polymers of this type are disclosed in GB-A-1,596,756. Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with maleic anhydride, such copolymers having a molecular weight of from 20,000 to 70,000, especially 15 about 40,000. Detergency builder salts are normally included in amounts of from 5% to 80% by weight of the composition preferably from 10% to 70% and most usually from 30% to 60% by weight. 20 Conventional detergent enzymes The laundry detergent and/or fabric care compositions can in addition to the 25 mannanase enzyme further comprise one or more enzymes which provide cleaning performance, fabric care and/or sanitisation benefits. The laundry detergent and/or fabric care compositions of the present invention will preferably further comprise a cellulase. It has been surprisingly found that said compositions further comprising a cellulase, provide improved cleaning and 30 softening performance. Said enzymes include enzymes selected from cellulases, hemicellulases, peroxidases, proteases, gluco-amylases, amylases, xylanases, lipases, phospholipases, esterases, cutinases, pectinases, keratanases, reductases, 35 oxidases, phenoloxidases, lipoxygenases, ligninases, pullulanases, tannases, WO 99/09129 PCT/US98/12015 50 pentosanases, malanases, R-glucanases, arabinosidases, hyaluronidase, chondroitinase, laccase or mixtures thereof. A preferred combination is a laundry detergent and/or fabric care composition 5 having cocktail of conventional applicable enzymes like protease, amylase, lipase, cutinase and/or cellulase in conjunction with one or more plant cell wall degrading enzymes. Suitable proteases are the subtilisins which are obtained from particular strains of 10 B. subtilis and B. licheniformis (subtilisin BPN and BPN'). One suitable protease is obtained from a strain of Bacillus, having maximum activity throughout the pH range of 8-12, developed and sold as ESPERASE® by Novo Industries A/S of Denmark, hereinafter "Novo". The preparation of this enzyme and analogous enzymes is described in GB 1,243,784 to Novo. Other suitable proteases 15 include ALCALASE®, DURAZYM® and SAVINASE® from Novo and MAXATASE®, MAXACAL®, PROPERASE® and MAXAPEM® (protein engineered Maxacal) from Gist-Brocades. Proteolytic enzymes also encompass modified bacterial serine proteases, such as those described in European Patent Application Serial Number 87 303761.8, filed April 28, 1987 (particularly pages 20 17, 24 and 98), and which is called herein "Protease B", and in European Patent Application 199,404, Venegas, published October 29, 1986, which refers to a modified bacterial serine protealytic enzyme which is called "Protease A" herein. Suitable is the protease called herein "Protease C", which is a variant of an alkaline serine protease from Bacillus in which lysine replaced arginine at 25 position 27, tyrosine replaced valine at position 104, serine replaced asparagine at position 123, and alanine replaced threonine at position 274. Protease C is described in EP 90915958:4, corresponding to WO 91/06637, Published May 16, 1991. Genetically modified variants, particularly of Protease C, are also included herein. 30 A preferred protease referred to as "Protease D" is a carbonyl hydrolase variant having an amino acid sequence not found in nature, which is derived from a precursor carbonyl hydrolase by substituting a different amino acid for a plurality of amino acid residues at a position in said carbonyl hydrolase equivalent to position +76, preferably also in combination with one or more amino acid residue 35 positions equivalent to those selected from the group consisting of +99, +101, +103, +104, +107, +123, +27, +105, +109, +126, +128, +135, +156, +166, +195, WO 99/09129 PCT/US98/12015 51 +197, +204, +206, +210, +216, +217, +218, +222, +260, +265, and/or +274 according to the numbering of Bacillus amyloliquefaciens subtilisin, as described in WO95/10591 and in the patent application of C. Ghosh, et al, "Bleaching Compositions Comprising Protease Enzymes" having US Serial No. 08/322,677, 5 filed October 13, 1994. Also suitable is a carbonyl hydrolase variant of the protease described in WO95/10591, having an amino acid sequence derived by replacement of a plurality of amino acid residues replaced in the precursor enzyme corresponding to position +210 in combination with one or more of the following residues: +33, +62, +67, +76, +100, +101, +103, +104, +107, +128, 10 +129, +130, +132, +135, +156, +158, +164, +166, +167, +170, +209, +215, +217, +218, and +222, where the numbered position corresponds to naturally occurring subtilisin from Bacillus amyloliquefaciens or to equivalent amino acid residues in other carbonyl hydrolases or subtilisins, such as Bacillus lentus subtilisin (co-pending patent application US Serial No. 60/048,550, filed June 04, 15 1997). Also suitable for the present invention are proteases described in patent applications EP 251 446 and WO 91/06637, protease BLAP® described in WO91/02792 and their variants described in WO 95/23221. See also a high pH protease from Bacillus sp. NCIMB 40338 described in WO 20 93/18140 A to Novo. Enzymatic detergents comprising protease, one or more other enzymes, and a reversible protease inhibitor are described in WO 92/03529 A to Novo. When desired, a protease having decreased adsorption and increased hydrolysis is available as described in WO 95/07791 to Procter & Gamble. A recombinant trypsin-like protease for detergents suitable herein is 25 described in WO 94/25583 to Novo. Other suitable proteases are described in EP 516 200 by Unilever. The proteolytic enzymes are incorporated in the laundry detergent and/or fabric care compositions of the present invention a level of from 0.0001% to 2%, preferably from 0.001% to 0.2%, more preferably from 0.005% to 0.1% pure 30 enzyme by weight of the composition. The cellulases usable in the present invention include both bacterial or fungal cellulases. Preferably, they will have a pH optimum of between 5 and 12 and a specific activity above 50 CEVU/mg (Cellulose Viscosity Unit). Suitable cellulases 35 are disclosed in U.S. Patent 4,435,307, Barbesgoard et al, J61078384 and WO96/02653 which discloses fungal cellulase produced respectively from WO 99/09129 PCT/US98/12015 52 Humicola insolens, Trichoderma, Thielavia and Sporotrichum. EP 739 982 describes cellulases isolated from novel Bacillus species. Suitable cellulases are also disclosed in GB-A-2.075.028; GB-A-2.095.275; DE-OS-2.247.832 and WO95/26398. 5 Examples of such cellulases are cellulases produced by a strain of Humicola insolens (Humicola grisea var. thermoidea), particularly the Humicola strain DSM 1800. Other suitable cellulases are cellulases originated from Humicola insolens having a molecular weight of about 50KDa, an isoelectric point of 5.5 and containing 415 10 amino acids; and a -43kD endoglucanase derived from Humicola insolens, DSM 1800, exhibiting cellulase activity; a preferred endoglucanase component has the amino acid sequence disclosed in PCT Patent Application No. WO 91/17243. Also suitable cellulases are the EGIII cellulases from Trichoderma longibrachiatum described in WO94/21801, Genencor, published September 29, 15 1994. Especially suitable cellulases are the cellulases having color care benefits. Examples of such cellulases are cellulases described in European patent application No. 91202879.2, filed November 6, 1991 (Novo). Carezyme and Celluzyme (Novo Nordisk A/S) are especially useful. See also WO91/17244 and WO91/21801. Other suitable cellulases for fabric care and/or cleaning properties 20 are described in WO96/34092, WO96/17994 and WO95/24471. Said cellulases are normally incorporated in the laundry detergent and/or fabric care composition at levels from 0.0001% to 2% of pure enzyme by weight of the laundry detergent and/or fabric care composition. 25 Peroxidase enzymes are used in combination with oxygen sources, e.g. percarbonate, perborate, persulfate, hydrogen peroxide, etc and with a phenolic substrate as bleach enhancing molecule. They are used for "solution bleaching", i.e. to prevent transfer of dyes or pigments removed from substrates during wash operations to other substrates in the wash solution. Peroxidase enzymes are 30 known in the art, and include, for example, horseradish peroxidase, ligninase and haloperoxidase such as chloro- and bromo-peroxidase. Peroxidase-containing laundry detergent and/or fabric care compositions are disclosed, for example, in PCT International Application WO 89/099813, WO89/09813 and in European Patent application EP No. 91202882.6, filed on November 6, 1991 and EP No. 35 96870013.8, filed February 20, 1996. Also suitable is the laccase enzyme.
WO 99/09129 PCT/US98/12015 53 Enhancers are generally comprised at a level of from 0.1% to 5% by weight of total composition. Preferred enhancers are substitued phenthiazine and phenoxasine 10-Phenothiazinepropionicacid (PPT), 10-ethylphenothiazine-4 carboxylic acid (EPC), 10-phenoxazinepropionic acid (POP) and 10 5 methylphenoxazine (described in WO 94/12621) and substitued syringates (C3 C5 substitued alkyl syringates) and phenols. Sodium percarbonate or perborate are preferred sources of hydrogen peroxide. Said peroxidases are normally incorporated in the laundry detergent and/or fabric care composition at levels from 0.0001% to 2% of pure enzyme by weight of the 10 laundry detergent and/or fabric care composition. Other preferred enzymes that can be included in the laundry detergent and/or fabric care compositions of the present invention include lipases. Suitable lipase enzymes for detergent usage include those produced by microorganisms of the 15 Pseudomonas group, such as Pseudomonas stutzeri ATCC 19.154, as disclosed in British Patent 1,372,034. Suitable lipases include those which show a positive immunological cross-reaction with the antibody of the lipase, produced by the microorganism Pseudomonas fluorescent IAM 1057. This lipase is available from Amano Pharmaceutical Co. Ltd., Nagoya, Japan, under the trade name Lipase P 20 "Amano," hereinafter referred to as "Amano-P". Other suitable commercial lipases include Amano-CES, lipases ex Chromobacter viscosum, e.g. Chromobacter viscosum var. lipolyticum NRRLB 3673 from Toyo Jozo Co., Tagata, Japan; Chromobacter viscosum lipases from U.S. Biochemical Corp., U.S.A. and Disoynth Co., The Netherlands, and lipases ex Pseudomonas 25 gladioli. Especially suitable lipases are lipases such as M1 LipaseR and LipomaxR (Gist-Brocades) and LipolaseR and Lipolase UltraR(Novo) which have found to be very effective when used in combination with the compositions of the present invention. Also suitables are the lipolytic enzymes described in EP 258 068, WO 92/05249 and WO 95/22615 by Novo Nordisk and in WO 94/03578, 30 WO 95/35381 and WO 96/00292 by Unilever. Also suitable are cutinases [EC 3.1.1.50] which can be considered as a special kind of lipase, namely lipases which do not require interfacial activation. Addition of cutinases to detergent compositions have been described in e.g. WO-A 88/09367 (Genencor); WO 90/09446 (Plant Genetic System) and WO 94/14963 35 and WO 94/14964 (Unilever).
WO 99/09129 PCT/US98/12015 54 The lipases and/or cutinases are normally incorporated in the laundry detergent and/or fabric care composition at levels from 0.0001% to 2% of pure enzyme by weight of the laundry detergent and/or fabric care composition. 5 Amylases (a and/or II) can be included for removal of carbohydrate-based stains. WO94/02597, Novo Nordisk A/S published February 03, 1994, describes detergent compositions which incorporate mutant amylases. See also WO95/10603, Novo Nordisk A/S, published April 20, 1995. Other amylases known for use in detergent compositions include both a- and p-amylases. a 10 Amylases are known in the art and include those disclosed in US Pat. no. 5,003,257; EP 252,666; WO/91/00353; FR 2,676,456; EP 285,123; EP 525,610; EP 368,341; and British Patent specification no. 1,296,839 (Novo). Other suitable amylases are stability-enhanced amylases described in WO94/18314, published August 18, 1994 and WO96/05295, Genencor, published February 22, 1996 and 15 amylase variants having additional modification in the immediate parent available from Novo Nordisk A/S, disclosed in WO 95/10603, published April 95. Also suitable are amylases described in EP 277 216, WO95/26397 and WO96/23873 (all by Novo Nordisk). Examples of commercial a-amylases products are Purafect Ox Am® from 20 Genencor and Termamyl®, Ban® ,Fungamyl® and Duramyl®, all available from Novo Nordisk A/S Denmark. WO95/26397 describes other suitable amylases : a amylases characterised by having a specific activity at least 25% higher than the specific activity of Termamyl® at a temperature range of 250C to 550C and at a pH value in the range of 8 to 10, measured by the Phadebas® a-amylase activity 25 assay. Suitable are variants of the above enzymes, described in WO96/23873 (Novo Nordisk). Other amylolytic enzymes with improved properties with respect to the activity level and the combination of thermostability and a higher activity level are described in WO95/35382. The amylolytic enzymes are incorporated in the laundry detergent and/or fabric 30 care compositions of the present invention a level of from 0.0001% to 2%, preferably from 0.00018% to 0.06%, more preferably from 0.00024% to 0.048% pure enzyme by weight of the composition. The above-mentioned enzymes may be of any suitable origin, such as vegetable, 35 animal, bacterial, fungal and yeast origin. Origin can further be mesophilic or extremophilic (psychrophilic, psychrotrophic, thermophilic, barophilic, alkalophilic, WO 99/09129 PCT/US98/12015 55 acidophilic, halophilic, etc.). Purified or non-purified forms of these enzymes may be used. Nowadays, it is common practice to modify wild-type enzymes via protein / genetic engineering techniques in order to optimise their performance efficiency in the detergent compositions of the invention. For example, the 5 variants may be designed such that the compatibility of the enzyme to commonly encountered ingredients of such compositions is increased. Alternatively, the variant may be designed such that the optimal pH, bleach or chelant stability, catalytic activity and the like, of the enzyme variant is tailored to suit the particular cleaning application. 10 In particular, attention should be focused on amino acids sensitive to oxidation in the case of bleach stability and on surface charges for the surfactant compatibility. The isoelectric point of such enzymes may be modified by the substitution of some charged amino acids, e.g. an increase in isoelectric point 15 may help to improve compatibility with anionic surfactants. The stability of the enzymes may be further enhanced by the creation of e.g. additional salt bridges and enforcing calcium binding sites to increase chelant stability. Special attention must be paid to the cellulases as most of the cellulases have separate binding domains (CBD). Properties of such enzymes can be altered by modifications in 20 these domains. Said enzymes are normally incorporated in the laundry detergent and/or fabric care composition at levels from 0.0001% to 2% of pure enzyme by weight of the laundry detergent and/or fabric care composition. The enzymes can be added as 25 separate single ingredients (prills, granulates, stabilized liquids, etc. containing one enzyme) or as mixtures of two or more enzymes (e.g. cogranulates). Other suitable detergent ingredients that can be added are enzyme oxidation scavengers which are described in co-pending European Patent application 30 92870018.6 filed on January 31, 1992. Examples of such enzyme oxidation scavengers are ethoxylated tetraethylene polyamines. A range of enzyme materials and means for their incorporation into synthetic detergent compositions is also disclosed in WO 9307263 A and WO 9307260 A 35 to Genencor International, WO 8908694 A to Novo, and U.S. 3,553,139, January 5, 1971 to McCarty et al. Enzymes are further disclosed in U.S. 4,101,457, Place WO 99/09129 PCT/US98/12015 56 et al, July 18, 1978, and in U.S. 4,507,219, Hughes, March 26, 1985. Enzyme materials useful for liquid detergent formulations, and their incorporation into such formulations, are disclosed in U.S. 4,261,868, Hora et al, April 14, 1981. Enzymes for use in detergents can be stabilised by various techniques. Enzyme 5 stabilisation techniques are disclosed and exemplified in U.S. 3,600,319, August 17, 1971, Gedge et al, EP 199,405 and EP 200,586, October 29, 1986, Venegas. Enzyme stabilisation systems are also described, for example, in U.S. 3,519,570. A useful Bacillus, sp. AC13 giving proteases, xylanases and cellulases, is described in WO 9401532 A to Novo. 10 Color care and fabric care benefits 15 Technologies which provide a type of color care benefit can also be included. Examples of these technologies are metallo catalysts for color maintenance. Such metallo catalysts are described in co-pending European Patent Application No. 92870181.2. Dye fixing agents, polyolefin dispersion for anti-wrinkles and 20 improved water absorbancy, perfume and amino-functional polymer (PCT/US97/16546) for color care treatment and perfume substantivity are further examples of color care / fabric care technologies and are described in the co pending Patent Application No. 96870140.9, filed November 07, 1996. 25 Fabric softening agents can also be incorporated into laundry detergent and/or fabric care compositions in accordance with the present invention. These agents may be inorganic or organic in type. Organic fabric softening agents include the water insoluble tertiary amines as disclosed in GB-A1 514 276 and EP-B0 011 340 and their combination with mono C12-C14 quaternary ammonium salts are 30 disclosed in EP-B-0 026 527 and EP-B-0 026 528 and di-long-chain amides as disclosed in EP-B-0 242 919. Other useful organic ingredients of fabric softening systems include high molecular weight polyethylene oxide materials as disclosed in EP-A-0 299 575 and 0 313 146. 35 Organic fabric softening agents such as the water-insoluble tertiary amines or dilong chain amide materials are incorporated at levels of from 0.5% to 5% by WO 99/09129 PCT/US98/12015 57 weight, normally from 1% to 3% by weight whilst the high molecular weight polyethylene oxide materials and the water soluble cationic materials are added at levels of from 0.1% to 2%, normally from 0.15% to 1.5% by weight. These materials are normally added to the spray dried portion of the composition, 5 although in some instances it may be more convenient to add them as a dry mixed particulate, or spray them as molten liquid on to other solid components of the composition. 10 Chelating Agents The laundry detergent and/or fabric care compositions herein may also optionally contain one or more iron and/or manganese chelating agents. Such chelating 15 agents can be selected from the group consisting of amino carboxylates, amino phosphonates, polyfunctionally-substituted aromatic chelating agents and mixtures therein, all as hereinafter defined. Without intending to be bound by theory, it is believed that the benefit of these materials is due in part to their exceptional ability to remove iron and manganese ions from washing solutions by 20 formation of soluble chelates. Amino carboxylates useful as optional chelating agents include ethylenediaminetetracetates, N-hydroxyethylethylenediaminetriacetates, nitrilo triacetates, ethylenediamine tetraproprionates, triethylenetetraamine 25 hexacetates, diethylenetriaminepentaacetates, and ethanoldiglycines, alkali metal, ammonium, and substituted ammonium salts therein and mixtures therein. Amino phosphonates are also suitable for use as chelating agents in the compositions of the invention when at lease low levels of total phosphorus are permitted in detergent compositions, and include ethylenediaminetetrakis 30 (methylenephosphonates) as DEQUEST. Preferably, these amino phosphonates do not contain alkyl or alkenyl groups with more than about 6 carbon atoms. Polyfunctionally-substituted aromatic chelating agents are also useful in the compositions herein. See U.S. Patent 3,812,044, issued May 21, 1974, to Connor et al. Preferred compounds of this type in acid form are 35 dihydroxydisulfobenzenes such as 1,2-dihydroxy-3,5-disulfobenzene.
WO 99/09129 PCT/US98/12015 58 A preferred biodegradable chelator for use herein is ethylenediamine disuccinate ("EDDS"), especially the [S,S] isomer as described in U.S. Patent 4,704,233, November 3, 1987, to Hartman and Perkins. 5 The compositions herein may also contain water-soluble methyl glycine diacetic acid (MGDA) salts (or acid form) as a chelant or co-builder useful with, for example, insoluble builders such as zeolites, layered silicates and the like. If utilized, these chelating agents will generally comprise from about 0.1% to 10 about 15% by weight of the laundry detergent and/or fabric care compositions herein. More preferably, if utilized, the chelating agents will comprise from about 0.1% to about 3.0% by weight of such compositions. Suds suppressor 15 Another optional ingredient is a suds suppressor, exemplified by silicones, and silica-silicone mixtures. Silicones can be generally represented by alkylated polysiloxane materials while silica is normally used in finely divided forms exemplified by silica aerogels and xerogels and hydrophobic silicas of various 20 types. These materials can be incorporated as particulates in which the suds suppressor is advantageously releasably incorporated in a water-soluble or water-dispersible, substantially non-surface-active detergent impermeable carrier. Alternatively the suds suppressor can be dissolved or dispersed in a liquid carrier and applied by spraying on to one or more of the other components. 25 A preferred silicone suds controlling agent is disclosed in Bartollota et al. U.S. Patent 3 933 672. Other particularly useful suds suppressors are the self emulsifying silicone suds suppressors, described in German Patent Application DTOS 2 646 126 published April 28, 1977. An example of such a compound is DC-544, commercially available from Dow Corning, which is a siloxane-glycol 30 copolymer. Especially preferred suds controlling agent are the suds suppressor system comprising a mixture of silicone oils and 2-alkyl-alcanols. Suitable 2-alkyl alkanols are 2-butyl-octanol which are commercially available under the trade name Isofol 12 R. Such suds suppressor system are described in co-pending European Patent 35 application N 92870174.7 filed 10 November, 1992.
WO 99/09129 PCT/US98/12015 59 Especially preferred silicone suds controlling agents are described in co-pending European Patent application No92201649.8. Said compositions can comprise a silicone/silica mixture in combination with fumed nonporous silica such as AerosilR. 5 The suds suppressors described above are normally employed at levels of from 0.001% to 2% by weight of the composition, preferably from 0.01% to 1% by weight. 10 Others Other components used in laundry detergent and/or fabric care compositions may be employed, such as soil-suspending agents, soil-release agents, optical brighteners, abrasives, bactericides, tarnish inhibitors, coloring agents, and/or 15 encapsulated or non-encapsulated perfumes. Especially suitable encapsulating materials are water soluble capsules which consist of a matrix of polysaccharide and polyhydroxy compounds such as described in GB 1,464,616. Other suitable water soluble encapsulating materials 20 comprise dextrins derived from ungelatinized starch acid-esters of substituted dicarboxylic acids such as described in US 3,455,838. These acid-ester dextrins are,preferably, prepared from such starches as waxy maize, waxy sorghum, sago, tapioca and potato. Suitable examples of said encapsulating materials include N-Lok manufactured by National Starch. The N-Lok encapsulating 25 material consists of a modified maize starch and glucose. The starch is modified by adding monofunctional substituted groups such as octenyl succinic acid anhydride. Antiredeposition and soil suspension agents suitable herein include cellulose 30 derivatives such as methylcellulose, carboxymethylcellulose and hydroxyethyl cellulose, and homo- or co-polymeric polycarboxylic acids or their salts. Polymers of this type include the polyacrylates and maleic anhydride-acrylic acid copolymers previously mentioned as builders, as well as copolymers of maleic anhydride with ethylene, methylvinyl ether or methacrylic acid, the maleic 35 anhydride constituting at least 20 mole percent of the copolymer. These materials are normally used at levels of from 0.5% to 10% by weight, more WO 99/09129 PCT/US98/12015 60 preferably from 0.75% to 8%, most preferably from 1% to 6% by weight of the composition. Preferred optical brighteners are anionic in character, examples of which are 5 disodium 4,4'-bis-(2-diethanolamino-4-anilino -s- triazin-6-ylamino)stilbene-2:2' disulphonate, disodium 4, - 4'-bis-(2-morpholino-4-anilino-s-triazin-6-ylamino stilbene-2:2' - disulphonate, disodium 4,4' - bis-(2,4-dianilino-s-triazin-6 ylamino)stilbene-2:2' - disulphonate, monosodium 4',4" -bis-(2,4-dianilino-s-tri azin-6 ylamino)stilbene-2-sulphonate, disodium 4,4' -bis-(2-anilino-4-(N-methyl-N 10 2-hydroxyethylamino)-s-triazin-6-ylamino)stilbene-2,2' - disulphonate, di-sodium 4,4' -bis-(4-phenyl-2,1,3-triazol-2-yl)-stilbene-2,2' disulphonate, di-so-dium 4,4'bis(2-anilino-4-(1-methyl-2-hydroxyethylamino)-s-triazin-6- ylami-no)stilbene 2,2'disulphonate, sodium 2(stilbyl-4"-(naphtho-1l',2':4,5)-1,2,3 - triazole-2" sulphonate and 4,4'-bis(2-sulphostyryl)biphenyl. Highly preferred brighteners are 15 the specific brighteners disclosed in EP 753 567. Other useful polymeric materials are the polyethylene glycols, particularly those of molecular weight 1000-10000, more particularly 2000 to 8000 and most preferably about 4000. These are used at levels of from 0.20% to 5% more 20 preferably from 0.25% to 2.5% by weight. These polymers and the previously mentioned homo- or co-polymeric polycarboxylate salts are valuable for improving whiteness maintenance, fabric ash deposition, and cleaning performance on clay, proteinaceous and oxidizable soils in the presence of transition metal impurities. 25 Soil release agents useful in compositions of the present invention are conventionally copolymers or terpolymers of terephthalic acid with ethylene glycol and/or propylene glycol units in various arrangements. Examples of such polymers are disclosed in the commonly assigned US Patent Nos. 4116885 and 30 4711730 and European Published Patent Application No. 0 272 033. A particular preferred polymer in accordance with EP-A-0 272 033 has the formula
(CH
3
(PEG)
4 3
)
0
.
75
(POH)
0
.
2 5
[T-PO)
2
.
8
(T-PEG)
0
.
4
]T(PO
H)0.2 5
((PEG)
4 3
CH
3
)
0
.
7 5 35 where PEG is -(OC 2
H
4 )O-,PO is (OC 3
H
6 0) and T is (pcOC 6
H
4
CO).
WO 99/09129 PCT/US98/12015 61 Also very useful are modified polyesters as random copolymers of dimethyl terephthalate, dimethyl sulfoisophthalate, ethylene glycol and 1-2 propane diol, the end groups consisting primarily of sulphobenzoate and secondarily of mono 5 esters of ethylene glycol and/or propane-diol. The target is to obtain a polymer capped at both end by sulphobenzoate groups, "primarily", in the present context most of said copolymers herein will be end-capped by sulphobenzoate groups. However, some copolymers will be less than fully capped, and therefore their end groups may consist of monoester of ethylene glycol and/or propane 1-2 diol, 10 thereof consist "secondarily" of such species. The selected polyesters herein contain about 46% by weight of dimethyl terephthalic acid, about 16% by weight of propane -1.2 diol, about 10% by weight ethylene glycol about 13% by weight of dimethyl sulfobenzoic acid and about 15% by weight of sulfoisophthalic acid, and have a molecular weight of about 15 3.000. The polyesters and their method of preparation are described in detail in EPA 311 342. It is well-known in the art that free chlorine in tap water rapidly deactivates the enzymes comprised in detergent compositions. Therefore, using chlorine 20 scavenger such as perborate, ammonium sulfate, sodium sulphite or polyethyleneimine at a level above 0.1% by weight of total composition, in the formulas will provide improved through the wash stability of the detergent enzymes. Compositions comprising chlorine scavenger are described in the European patent application 92870018.6 filed January 31, 1992. 25 Alkoxylated polycarboxylates such as those prepared from polyacrylates are useful herein to provide additional grease removal performance. Such materials are described in WO 91/08281 and PCT 90/01815 at p. 4 et seq., incorporated herein by reference. Chemically, these materials comprise polyacrylates having 30 one ethoxy side-chain per every 7-8 acrylate units. The side-chains are of the formula -(CH2CH20)m(CH2)nCH3 wherein m is 2-3 and n is 6-12. The side chains are ester-linked to the polyacrylate "backbone" to provide a "comb" polymer type structure. The molecular weight can vary, but is typically in the range of about 2000 to about 50,000. Such alkoxylated polycarboxylates can 35 comprise from about 0.05% to about 10%, by weight, of the compositions herein.
WO 99/09129 PCT/US98/12015 62 Dispersants The laundry detergent and/or fabric care composition of the present invention can also contain dispersants : Suitable water-soluble organic salts are the homo 5 or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms. Polymers of this type are disclosed in GB-A-1,596,756. Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with maleic anhydride, such copolymers having a molecular weight of from 1,000 to 10 100,000. Especially, copolymer of acrylate and methylacrylate such as the 480N having a molecular weight of 4000, at a level from 0.5-20% by weight of composition can be added in the laundry detergent and/or fabric care compositions of the present invention. 15 The compositions of the invention may contain a lime soap peptiser compound, which has preferably a lime soap dispersing power (LSDP), as defined hereinafter of no more than 8, preferably no more than 7, most preferably no more than 6. The lime soap peptiser compound is preferably present at a level 20 from 0% to 20% by weight. A numerical measure of the effectiveness of a lime soap peptiser is given by the lime soap dispersant power (LSDP) which is determined using the lime soap dispersant test as described in an article by H.C. Borghetty and C.A. Bergman, J. 25 Am. Oil. Chem. Soc., volume 27, pages 88-90, (1950). This lime soap dispersion test method is widely used by practitioners in this art field being referred to, for example, in the following review articles; W.N. Linfield, Surfactant science Series, Volume 7, page 3; W.N. Linfield, Tenside surf. det., volume 27, pages 159-163, (1990); and M.K. Nagarajan, W.F. Masler, Cosmetics and Toiletries, volume 104, 30 pages 71-73, (1989). The LSDP is the % weight ratio of dispersing agent to sodium oleate required to disperse the lime soap deposits formed by 0.025g of sodium oleate in 30ml of water of 333ppm CaCo3 (Ca:Mg=3:2) equivalent hardness. 35 Surfactants having good lime soap peptiser capability will include certain amine oxides, betaines, sulfobetaines, alkyl ethoxysulfates and ethoxylated alcohols.
WO 99/09129 PCT/US98/12015 63 Exemplary surfactants having a LSDP of no more than 8 for use in accord with the present invention include C 16
-C
18 dimethyl amine oxide, C1 2 -C1 8 alkyl ethoxysulfates with an average degree of ethoxylation of from 1-5, particularly 5 C 12
-C
15 alkyl ethoxysulfate surfactant with a degree of ethoxylation of amount 3 (LSDP=4), and the C 14
-C
15 ethoxylated alcohols with an average degree of ethoxylation of either 12 (LSDP=6) or 30, sold under the tradenames Lutensol A012 and Lutensol A030 respectively, by BASF GmbH. 10 Polymeric lime soap peptisers suitable for use herein are described in the article by M.K. Nagarajan, W.F. Masler, to be found in Cosmetics and Toiletries, volume 104, pages 71-73, (1989). Hydrophobic bleaches such as 4-[N-octanoyl-6-aminohexanoyl]benzene 15 sulfonate, 4-[N-nonanoyl-6-aminohexanoyl]benzene sulfonate, 4-[N-decanoyl-6 aminohexanoyl]benzene sulfonate and mixtures thereof; and nonanoyloxy benzene sulfonate together with hydrophilic / hydrophobic bleach formulations can also be used as lime soap peptisers compounds. 20 Dye transfer inhibition The laundry detergent and/or fabric care compositions of the present invention can also include compounds for inhibiting dye transfer from one fabric to another of solubilized and suspended dyes encountered during fabric laundering 25 operations involving colored fabrics. Polymeric dye transfer inhibiting agents The laundry detergent and/or fabric care compositions according to the present 30 invention also comprise from 0.001% to 10 %, preferably from 0.01% to 2%, more preferably from 0.05% to 1% by weight of polymeric dye transfer inhibiting agents. Said polymeric dye transfer inhibiting agents are normally incorporated into laundry detergent and/or fabric care compositions in order to inhibit the transfer of dyes from colored fabrics onto fabrics washed therewith. These 35 polymers have the ability to complex or adsorb the fugitive dyes washed out of WO 99/09129 PCT/US98/12015 64 dyed fabrics before the dyes have the opportunity to become attached to other articles in the wash. Especially suitable polymeric dye transfer inhibiting agents are polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, 5 polyvinylpyrrolidone polymers, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof. Addition of such polymers also enhances the performance of the enzymes according the invention. 10 a) Polyamine N-oxide polymers The polyamine N-oxide polymers suitable for use contain units having the following structure formula : 15 P 1 20 (I) Ax I R wherein P is a polymerisable unit, whereto the R-N-O group can be attached to or wherein the R-N-O group forms part of the polymerisable unit or a combination of 25 both. OO O II II II A is NC, CO, C, -O-,-S-, -N-; x is O or 1; 30 R are aliphatic, ethoxylated aliphatics, aromatic, heterocyclic or alicyclic groups or any combination thereof whereto the nitrogen of the N-O group can be attached or wherein the nitrogen of the N-O group is part of these groups. The N-O group can be represented by the following general structures: 35 O O WO 99/09129 PCT/US98/12015 65 I I (R1)x -N- (R2)y =N- (R1)x I (R3)z 5 wherein R1, R2, and R3 are aliphatic groups, aromatic, heterocyclic or alicyclic groups or combinations thereof, x or/and y or/and z is 0 or 1 and wherein the nitrogen of the N-O group can be attached or wherein the nitrogen of the N-O group forms part of these groups. 10 The N-O group can be part of the polymerisable unit (P) or can be attached to the polymeric backbone or a combination of both. Suitable polyamine N-oxides wherein the N-O group forms part of the polymerisable unit comprise polyamine N-oxides wherein R is selected from 15 aliphatic, aromatic, alicyclic or heterocyclic groups. One class of said polyamine N-oxides comprises the group of polyamine N oxides wherein the nitrogen of the N-O group forms part of the R-group. Preferred polyamine N-oxides are those wherein R is a heterocyclic group such as pyrridine, pyrrole, imidazole, pyrrolidine, piperidine, quinoline, acridine and 20 derivatives thereof. Another class of said polyamine N-oxides comprises the group of polyamine N oxides wherein the nitrogen of the N-O group is attached to the R-group. Other suitable polyamine N-oxides are the polyamine oxides whereto the N-O 25 group is attached to the polymerisable unit. Preferred class of these polyamine N-oxides are the polyamine N-oxides having the general formula (I) wherein R is an aromatic, heterocyclic or alicyclic groups wherein the nitrogen of the N-0 functional group is part of said R group. Examples of these classes are polyamine oxides wherein R is a heterocyclic 30 compound such as pyrridine, pyrrole, imidazole and derivatives thereof. Another preferred class of polyamine N-oxides are the polyamine oxides having the general formula (I) wherein R are aromatic, heterocyclic or alicyclic groups wherein the nitrogen of the N-0 functional group is attached to said R groups. Examples of these classes are polyamine oxides wherein R groups can be 35 aromatic such as phenyl.
WO 99/09129 PCT/US98/12015 66 Any polymer backbone can be used as long as the amine oxide polymer formed is water-soluble and has dye transfer inhibiting properties. Examples of suitable polymeric backbones are polyvinyls, polyalkylenes, polyesters, polyethers, polyamide, polyimides, polyacrylates and mixtures thereof. 5 The amine N-oxide polymers of the present invention typically have a ratio of amine to the amine N-oxide of 10:1 to 1:1000000. However the amount of amine oxide groups present in the polyamine oxide polymer can be varied by appropriate copolymerization or by appropriate degree of N-oxidation. Preferably, 10 the ratio of amine to amine N-oxide is from 2:3 to 1:1000000. More preferably from 1:4 to 1:1000000, most preferably from 1:7 to 1:1000000. The polymers of the present invention actually encompass random or block copolymers where one monomer type is an amine N-oxide and the other monomer type is either an amine N-oxide or not. The amine oxide unit of the polyamine N-oxides has a PKa 15 < 10, preferably PKa < 7, more preferred PKa < 6. The polyamine oxides can be obtained in almost any degree of polymerisation. The degree of polymerisation is not critical provided the material has the desired water-solubility and dye-suspending power. Typically, the average molecular weight is within the range of 500 to 1000,000; 20 preferably from 1,000 to 50,000, more preferably from 2,000 to 30,000, most preferably from 3,000 to 20,000. b) Copolymers of N-vinylpyrrolidone and N-vinylimidazole The N-vinylimidazole N-vinylpyrrolidone polymers used in the present invention 25 have an average molecular weight range from 5,000-1,000,000, preferably from 5,000-200,000. Highly preferred polymers for use in detergent compositions according to the present invention comprise a polymer selected from N-vinylimidazole N vinylpyrrolidone copolymers wherein said polymer has an average molecular 30 weight range from 5,000 to 50,000 more preferably from 8,000 to 30,000, most preferably from 10,000 to 20,000. The average molecular weight range was determined by light scattering as described in Barth H.G. and Mays J.W. Chemical Analysis Vol 113,"Modern Methods of Polymer Characterization".
WO 99/09129 PCT/US98/12015 67 Highly preferred N-vinylimidazole N-vinylpyrrolidone copolymers have an average molecular weight range from 5,000 to 50,000; more preferably from 8,000 to 30,000; most preferably from 10,000 to 20,000. 5 The N-vinylimidazole N-vinylpyrrolidone copolymers characterized by having said average molecular weight range provide excellent dye transfer inhibiting properties while not adversely affecting the cleaning performance of detergent compositions formulated therewith. The N-vinylimidazole N-vinylpyrrolidone copolymer of the present invention has a 10 molar ratio of N-vinylimidazole to N-vinylpyrrolidone from 1 to 0.2, more preferably from 0.8 to 0.3, most preferably from 0.6 to 0.4. c) Polyvinylpyrrolidone The laundry detergent and/or fabric care compositions of the present invention 15 may also utilize polyvinylpyrrolidone ("PVP") having an average molecular weight of from about 2,500 to about 400,000, preferably from about 5,000 to about 200,000, more preferably from about 5,000 to about 50,000, and most preferably from about 5,000 to about 15,000. Suitable polyvinylpyrrolidones are commercially available from ISP Corporation, New York, NY and Montreal, 20 Canada under the product names PVP K-15 (viscosity molecular weight of 10,000), PVP K-30 (average molecular weight of 40,000), PVP K-60 (average molecular weight of 160,000), and PVP K-90 (average molecular weight of 360,000). Other suitable polyvinylpyrrolidones which are commercially available from BASF Cooperation include Sokalan HP 165 and Sokalan HP 12; 25 polyvinylpyrrolidones known to persons skilled in the detergent field (see for example EP-A-262,897 and EP-A-256,696). d) Polyvinyloxazolidone: The laundry detergent and/or fabric care compositions of the present invention 30 may also utilize polyvinyloxazolidone as a polymeric dye transfer inhibiting agent. Said polyvinyloxazolidones have an average molecular weight of from about 2,500 to about 400,000, preferably from about 5,000 to about 200,000, more preferably from about 5,000 to about 50,000, and most preferably from about 5,000 to about 15,000. 35 e) Polyvinylimidazole: WO 99/09129 PCT/US98/12015 68 The laundry detergent and/or fabric care compositions of the present invention may also utilize polyvinylimidazole as polymeric dye transfer inhibiting agent. Said polyvinylimidazoles have an average about 2,500 to about 400,000, preferably from about 5,000 to about 200,000, more preferably from about 5,000 5 to about 50,000, and most preferably from about 5,000 to about 15,000. f) Cross-linked polymers: Cross-linked polymers are polymers whose backbone are interconnected to a certain degree; these links can be of chemical or physical nature, possibly with 10 active groups n the backbone or on branches; cross-linked polymers have been described in the Journal of Polymer Science, volume 22, pages 1035-1039. In one embodiment, the cross-linked polymers are made in such a way that they form a three-dimensional rigid structure, which can entrap dyes in the pores formed by the three-dimensional structure. In another embodiment, the cross 15 linked polymers entrap the dyes by swelling. Such cross-linked polymers are described in the co-pending patent application 94870213.9 20 Method of washing The compositions of the invention may be used in essentially any washing or cleaning methods, including soaking methods, pretreatment methods and methods with rinsing steps for which a separate rinse aid composition may be 25 added. The process described herein comprises contacting fabrics with a laundering solution in the usual manner and exemplified hereunder. The process of the invention is conveniently carried out in the course of the laundering process. The 30 method of cleaning is preferably carried out at 50C to 950C, especially between 10C and 600C. The pH of the treatment solution is preferably from 7 to 12. The following examples are meant to exemplify compositions of the present invention, but are not necessarily meant to limit or otherwise define the scope of 35 the invention. In the laundry detergent and/or fabric care compositions, the enzymes levels are expressed by pure enzyme by weight of the total composition WO 99/09129 PCTIUS98/12015 69 and unless otherwise specified, the detergent ingredients are expressed by weight of the total compositions. The abbreviated component identifications therein have the following meanings: LAS : Sodium linear C1 1- 13 alkyl benzene sulphonate. TAS : Sodium tallow alkyl sulphate. CxyAS : Sodium C1x - Cly alkyl sulfate. CxySAS : Sodium Clx - Cly secondary (2,3) alkyl sulfate. CxyEz : C1x - Cly predominantly linear primary alcohol condensed with an average of z moles of ethylene oxide. CxyEzS : C1x - Cly sodium alkyl sulfate condensed with an average of z moles of ethylene oxide. QAS : R 2
.N+(CH
3
)
2
(C
2
H
4 OH) with R 2 = C12-C14. QAS 1 : R 2
.N+(CH
3
)
2
(C
2
H
4 OH) with R 2 = C 8
-C
1 1 . APA : C 8 -1 0 amido propyl dimethyl amine. Soap : Sodium linear alkyl carboxylate derived from a 80/20 mixture of tallow and coconut fatty acids. Nonionic : C13-C15 mixed ethoxylated/propoxylated fatty alcohol with an average degree of ethoxylation of 3.8 and an average degree of propoxylation of 4.5. Neodol 45-13 : C14-C15 linear primary alcohol ethoxylate, sold by Shell Chemical CO. STS : Sodium toluene sulphonate. CFAA : C12-C14 alkyl N-methyl glucamide. TFAA : C 16
-C
18 alkyl N-methyl glucamide. TPKFA : C12-C14 topped whole cut fatty acids. Silicate : Amorphous Sodium Silicate (SiO2:Na20 ratio = 1.6-3.2). Metasilicate : Sodium metasilicate (SiO2:Na20 ratio = 1.0). Zeolite A : Hydrated Sodium Aluminosilicate of formula Nal 2 (A1O2SiO 2
)
1 2 . 27H 2 0 having a primary particle size in the range from 0.1 to 10 micrometers (Weight expressed on an anhydrous basis). Na-SKS-6 : Crystalline layered silicate of formula 6-Na 2 Si 2 0 5 . Citrate : Tri-sodium citrate dihydrate of activity 86.4% with a particle size distribution between 425 and 850 micrometres.
WO 99/09129 PCT/US98/12015 70 Citric Anhydrous citric acid. Borate Sodium borate Carbonate : Anhydrous sodium carbonate with a particle size between 200 and 900 micrometres. Bicarbonate Anhydrous sodium hydrogen carbonate with a particle size distribution between 400 and 1200 micrometres. Sulphate Anhydrous sodium sulphate. Mg Sulphate Anhydrous magnesium sulfate. STPP Sodium tripolyphosphate. TSPP Tetrasodium pyrophosphate. MA/AA Random copolymer of 4:1 acrylate/maleate, average molecular weight about 70,000-80,000. MA/AA 1 : Random copolymer of 6:4 acrylate/maleate, average molecular weight about 10,000. AA : Sodium polyacrylate polymer of average molecular weight 4,500. PA30 : Polyacrylic acid of average molecular weight of between about 4,500 - 8,000. 480N : Random copolymer of 7:3 acrylate/methacrylate, average molecular weight about 3,500. Polygel/carbopol : High molecular weight crosslinked polyacrylates. PB1 : Anhydrous sodium perborate monohydrate of nominal formula NaBO 2
.H
2 0 2 . PB4 : Sodium perborate tetrahydrate of nominal formula NaBO 2 .3H 2 0.H 2 0 2 . Percarbonate : Anhydrous sodium percarbonate of nominal formula 2Na 2
CO
3 .3H 2 0 2 . NaDCC : Sodium dichloroisocyanurate. TAED : Tetraacetylethylenediamine. NOBS : Nonanoyloxybenzene sulfonate in the form of the sodium salt. NACA-OBS : (6-nonamidocaproyl) oxybenzene sulfonate. DTPA : Diethylene triamine pentaacetic acid. HEDP : 1,1-hydroxyethane diphosphonic acid.
WO 99/09129 PCT/US98/12015 71 DETPMP Diethyltriamine penta (methylene) phosphonate, marketed by Monsanto under the Trade name Dequest 2060. EDDS Ethylenediamine-N,N'-disuccinic acid, (S,S) isomer in the form of its sodium salt MnTACN Manganese 1,4,7-trimethyl-1,4,7-triazacyclononane. Photoactivated Sulfonated zinc phtalocyanine encapsulated in dextrin Bleach soluble polymer. Photoactivated Sulfonated alumino phtalocyanine encapsulated in Bleach 1 dextrin soluble polymer. PAAC Pentaamine acetate cobalt(lll) salt. Paraffin Paraffin oil sold under the tradename Winog 70 by Wintershall. NaBz Sodium benzoate. BzP Benzoyl Peroxide. Mannanase Mannanase from Bacillus agaradherens, NCIMB 40482 Protease Proteolytic enzyme sold under the tradename Savinase, Alcalase, Durazym by Novo Nordisk A/S, Maxacal, Maxapem sold by Gist-Brocades and proteases described in patents WO91/06637 and/or WO95/10591 and/or EP 251 446. Amylase Amylolytic enzyme sold under the tradename Purafact Ox AmR described in WO 94/18314, WO96/05295 sold by Genencor; Termamyl®, Fungamyl® and Duramyl®, all available from Novo Nordisk A/S and those described in WO95/26397. Lipase Lipolytic enzyme sold under the tradename Lipolase, Lipolase Ultra by Novo Nordisk A/S and Lipomax by Gist-Brocades. Cellulase Cellulytic enzyme sold under the tradename Carezyme, Celluzyme and/or Endolase by Novo Nordisk A/S. Clay Smectite clay or bentonite clay. CMC Sodium carboxymethyl cellulose. PVP Polyvinyl polymer, with an average molecular weight of 60,000.
WO 99/09129 PCT/US98/12015 72 PVNO Polyvinylpyridine-N-Oxide, with an average molecular weight of 50,000. PVPVI Copolymer of vinylimidazole and vinylpyrrolidone, with an average molecular weight of 20,000. Brightener 1 Disodium 4,4'-bis(2-sulphostyryl)biphenyl. Brightener 2 Disodium 4,4'-bis(4-anilino-6-morpholino-1.3.5-triazin-2 yl) stilbene-2:2'-disulfonate. Silicone antifoam Polydimethylsiloxane foam controller with siloxane oxyalkylene copolymer as dispersing agent with a ratio of said foam controller to said dispersing agent of 10:1 to 100:1. Suds Suppressor : 12% Silicone/silica, 18% stearyl alcohol,70% starch in granular form. Opacifier Water based monostyrene latex mixture, sold by BASF Aktiengesellschaft under the tradename Lytron 621. SRP 1 : Anionically end capped poly esters. SRP 2 : Diethoxylated poly (1,2 propylene terephthalate) short block polymer. QEA : bis((C2H50)(C2H 4 0)n)(CH3) -N+-C 6 H 12
-N-(CH
3 ) bis((C2H50)-(C2H40))n, wherein n = from 20 to 30. PEI : Polyethyleneimine with an average molecular weight of 1800 and an average ethoxylation degree of 7 ethyleneoxy residues per nitrogen. SCS : Sodium cumene sulphonate. HMWPEO : High molecular weight polyethylene oxide. PEGx : Polyethylene glycol, of a molecular weight of x. PEO : Polyethylene oxide, with an average molecular weight of 5,000. TEPAE : Tetreaethylenepentaamine ethoxylate. Example 1 The following detergent compositions were prepared according to the present 5 invention: I II III WO 99/09129 PCT/US98/12015 73 I II III Blown Powder Zeolite A 13.0 13.0 15.0 Sulfate - 3.0 LAS 3.0 3.0 3.0 QAS - 1.5 1.5 DETPMP 0.4 0.2 0.4 EDDS - 0.4 0.2 CMC 0.4 0.4 0.4 MA/AA 4.0 2.0 2.0 Agglomerate LAS 5.0 5.0 5.0 TAS 2.0 1.0 1.0 Silicate 3.0 2.0 4.0 Zeolite A 8.0 8.0 8.0 Carbonate 7.0 4.0 4.0 Spray On Perfume 0.3 0.3 0.3 C45E7 2.0 2.0 2.0 C25E3 2.0 Dry Additives Citrate 3.0 - 2.0 Bicarbonate - 3.0 Carbonate 8.0 15.0 10.0 TAED 6.0 2.0 5.0 PB1 9.0 7.0 10.0 PEO - - 0.2 Bentonite clay 10.0 10.0 10.0 Mannanase 0.001 0.001 0.02 Protease 0.03 0.03 0.03 Lipase 0.008 0.008 0.008 Cellulase 0.001 0.001 0.001 Amylase 0.01 0.01 0.01 Silicone antifoam 5.0 5.0 5.0 Sulfate - 3.0 Density (g/litre) 850 850 850 WO 99/09129 PCT/US98/12015 74 Miscellaneous and minors Up to 100% Example 2 5 The following liquid detergent compositions were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme): I II III IV LAS 25.0 - - C25AS - 13.0 16.0 13.0 C25E3S - 2.0 2.0 4.0 C25E7 - - 4.0 4.0 TFAA - 6.0 6.0 6.0 APA 3.0 1.0 2.0 TPKFA - 14.0 11.0 11.0 Citric 1.0 1.0 1.0 1.0 Dodecenyl / tetradecenyl succinic 15.0 - - acid Rapeseed fatty acid 1.0 - 3.5 Ethanol 7.0 2.0 3.0 2.0 1,2 Propanediol 6.0 8.0 10.0 13.0 Monoethanolamine - - 9.0 9.0 TEPAE - - 0.4 0.3 DETPMP 2.0 1.2 1.0 Mannanase 0.001 0.002 0.02 0.001 Protease 0.08 0.02 0.01 0.02 Lipase - - 0.003 0.003 Amylase 0.004 0.01 0.01 0.01 Cellulase - - 0.004 0.003 SRP 2 - - 0.2 0.1 Boric acid 1.0 1.5 2.5 2.5 Bentonite clay 4.0 5.0 4.0 4.0 Brightener 1 0.1 0.2 0.3 Suds suppressor 0.4 - Opacifier 0.8 0.7 - - WO 99/09129 PCT/US98/12015 75 I II III IV NaOH up to pH 8.0 7.5 8.0 8.2 Miscellaneous and water Example 3 5 The following granular fabric detergent compositions which provide "softening through the wash" capability were prepared according to the present invention : I II C45AS - 10.0 LAS 7.6 C68AS 1.3 C45E7 4.0 C25E3 - 5.0 Coco-alkyl-dimethyl hydroxy- 1.4 1.0 ethyl ammonium chloride Citrate 5.0 3.0 Na-SKS-6 - 11.0 Zeolite A 15.0 15.0 MA/AA 4.0 4.0 DETPMP 0.4 0.4 PB1 15.0 Percarbonate - 15.0 TAED 5.0 5.0 Smectite clay 10.0 10.0 HMWPEO - 0.1 Mannanase 0.001 0.02 Protease 0.02 0.01 Lipase 0.02 0.01 Amylase 0.03 0.005 Cellulase 0.001 Silicate 3.0 5.0 Carbonate 10.0 10.0 Suds suppressor 1.0 4.0 CMC 0.2 0.1 WO 99/09129 PCT/US98/12015 76 Miscellaneous and minors Up to 100% Example 4 5 The following laundry bar detergent compositions were prepared according to the present invention (Levels are given in parts per weight, enzyme are expressed in pure enzyme) : I II III VI V III VI V LAS - - 19.0 15.0 21.0 6.75 8.8 C28AS 26.0 13.5 - - - 15.75 11.2 22.5 Na Laurate 2.5 9.0 - - - - - Zeolite A 2.0 1.25 - - - 1.25 1.25 1.25 Carbonate 20.0 3.0 13.0 8.0 10.0 15.0 13.0 8.0 Ca Carbonate 27.5 39.0 31.0 - - 36.0 - 36.0 Sulfate 5.0 5.0 3.0 5.0 3.0 - - 5.0 TSPP 5.0 - - - - 5.0 2.5 STPP 5.0 15.0 10.0 - - 7.0 8.0 10.0 Bentonite clay 4.0 10.0 4.0 4.0 5.0 4.0 4.0 4.0 DETPMP - 0.7 0.6 - 0.6 0.7 0.7 0.7 CMC - 1.0 1.0 1.0 1.0 - - 1.0 Talc - - 10.0 11.0 10.0 - - Silicate - - 4.0 5.0 3.0 - - PVNO 0.02 0.03 - 0.01 - 0.02 - MA/AA 0.4 1.0 - - 0.2 0.4 0.5 0.4 SRP 1 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 Mannanase 0.001 0.001 0.02 0.001 0.02 0.03 0.01 0.001 Amylase - - 0.01 - - - 0.002 Protease - 0.004 - 0.003 0.003 - - 0.003 Lipase - 0.002 - 0.002 - - - Cellulase - .0003 - - .0003 .0002 - PEO - 0.2 - 0.2 0.3 - - 0.3 Perfume 1.0 0.5 0.3 0.2 0.4 - - 0.4 Mg sulfate - - 3.0 3.0 3.0 - - Brightener 0.15 0.1 0.15 - - - - 0.1 WO 99/09129 PCT/US98/12015 77 I II III VI V III VI V Photoactivated - 15.0 15.0 15.0 15.0 - - 15.0 bleach (ppm) WO 99/09129 PCT/US98/12015 78 SEQUENCE LISTING (1) GENERAL INFORMATION: APPLICANT: 5 NAME: The Procter & Gamble Company STREET: One Procter & Gamble Plaza CITY: Cincinnati, OHIO COUNTRY: USA POSTAL CODE: 45202 10 TITLE OF INVENTION: Detergent compositions comprising a mannanase and a clay NUMBER OF SEQUENCES: 6 15 COMPUTER READABLE FORM: MEDIUM TYPE: Diskette COMPUTER: IBM PC compatible OPERATING SYSTEM: PC-DOS/MS-DOS 20 SOFTWARE: Patentln Release # 1.0 Version 1.25 (EPO) SEQ ID NO:1 SEQUENCE CHARACTERISITICS: 25 LENGTH: 1407 base pairs TYPE: nucleic acid STRANDEDNESS: single TOPOLOGY: linear 30 MOLECULE TYPE: genomic DNA ORIGINAL SOURCE FEATURE: NAME/KEY: CDS 35 LOCATION: 1-1482 SEQUENCE DESCRIPTION: SEQ ID NO: 1 WO 99/09129 PCT/US98/12015 79 ATGAAAAAAAAGTTATCACAGATTTATCATTTAATTATTTGCACACTTATAATA AGTGTGGGAATAATGGGGATTACAACGTCCCCATCAGCAGCAAGTACAGGC TTTTATGTTGATGGCAATACGTTATATGACGCAAATGGGCAGCCATTTGTCAT 5 GAGAGGTATTAACCATGGACATGCTTGGTATAAAGACACCGCTTCAACAGCT ATTCCTGCCATTGCAGAGCAAGGCGCCAACACGATTCGTATTGTTTTATCAG ATGGCGGTCAATGGGAAAAAGACGACATTGACACCATTCGTGAAGTCATTG AGCTTGCGGAGCAAAATAAAATGGTGGCTGTCGTTGAAGTTCATGATGCCA CGGGTCGCGATTCGCGCAGTGATTTAAATCGAGCCGTTGATTATTGGATAG 10o AAATGAAAGATGCGCTTATCGGTAAAGAAGATACGGTTATTATTAACATTGCA AACGAGTGGTATGGGAGTTGGGATGGCTCAGCTTGGGCCGATGGCTATATT GATGTCATTCCGAAGCTTCGCGATGCCGGCTTAACACACACCTTAATGGTTG ATGCAGCAGGATGGGGGCAATATCCGCAATCTATTCATGATTACGGACAAG ATGTGTTTAATGCAGATCCGTTAAAAAATACGATGTTCTCCATCCATATGTAT 15 GAGTATGCTGGTGGTGATGCTAACACTGTTAGATCAAATATTGATAGAGTCA TAGATCAAGACCTTGCTCTCGTAATAGGTGAATTCGGTCATAGACATACTGA TGGTGATGTTGATGAAGATACAATCCTTAGTTATTCTGAAGAAACTGGCACA GGGTGGCTCGCTTGGTCTTGGAAAGGCAACAGTACCGAATGGGACTATTTA GACCTTTCAGAAGACTGGGCTGGTCAACATTTAACTGATTGGGGGAATAGAA 20 TTGTCCACGGGGCCGATGGCTTACAGGAAACCTCCAAACCATCCACCGTAT TTACAGATGATAACGGTGGTCACCCTGAACCGCCAACTGCTACTACCTTGTA TGACTTTGAAGGAAGCACACAAGGGTGGCATGGAAGCAACGTGACCGGTG GCCCTTGGTCCGTAACAGAATGGGGTGCTTCAGGTAACTACTCTTTAAAAGC CGATGTAAATTTAACCTCAAATTCTTCACATGAACTGTATAGTGAACAAAGTC 25 GTAATCTACACGGATACTCTCAGCTCAACGCAACCGTTCGCCATGCCAATTG GGGAAATCCCGGTAATGGCATGAATGCAAGACTTTACGTGAAAACGGGCTC TGATTATACATGGCATAGCGGTCCTTTTACACGTATCAATAGCTCCAACTCA GGAACAACGTTATCTTTTGATTTAAACAACATCGAAAATAGTCATCATGTTAG GGAAATAGGCGTGCAATTTTCAGCGGCAGATAATAGCAGTGGTCAAACTGC 30 TCTATACGTTGATAACGTTACTTTAAGATAG SEQ ID NO:2 35 SEQUENCE CHARACTERISITICS: LENGTH: 493 amino acids WO 99/09129 PCT/US98/12015 80 TYPE: amino acid TOPOLOGY: linear MOLECULE TYPE: protein 5 SEQUENCE DESCRIPTION: SEQ ID NO: 2 MKKKLSQIYHLIICTLIISVGIMGITTSPSAASTGFYVDGNTLYDANGQPFVMRGIN HGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKM VAWVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIll N IANEWYGSWDGS 10 AWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSlHDYGQDVFNADPLKNTM FSlHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEE TGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKP STVFTDDNGGHPEPPTATTLYDFEGSTQGWHGSNVTGGPWSVTEWGASGNY SLKADVNLTSNSSHELYSEQSRNLHGYSQLNATVRHANWGNPGNGMNARLYV 15 KTGSDYTWHSGPFTRINSSNSGTTLSFDLNNIENSHHVREIGVQFSAADNSSGQ TALYVDNVTLR SEQ ID NO:3 20 SEQUENCE CHARACTERISITICS: LENGTH: 1407 base pairs TYPE: nucleic acid STRANDEDNESS: single 25 TOPOLOGY: linear MOLECULE TYPE: genomic DNA SEQUENCE DESCRIPTION: SEQ ID NO: 3 30 ATGAAAAAAAAGTTATCACAGATTTATCATTTAATTATTTGCACACTTATAATA AGTGTGGGAATAATGGGGATTACAACGTCCCCATCAGCAGCAAGTACAGGC TTTTATGTTGATGGCAATACGTTATATGACGCAAATGGGCAGCCATTTGTCAT GAGAGGTATTAACCATGGACATGCTTGGTATAAAGACACCGCTTCAACAGCT 35 ATTCCTGCCATTGCAGAGCAAGGCGCCAACACGATTCGTATTGTTTTATCAG
ATGGCGGTCAATGGGAAAAAGACGACATTGACACCATTCGTGAAGTCATTG
WO 99/09129 PCT/US98/12015 81 AGCTTGCGGAGCAAAATAAAATGGTGGCTGTCGTTGAAGTTCATGATGCCA CGGGTCGCGATTCGCGCAGTGATTTAAATCGAGCCGTTGATTATTGGATAG AAATGAAAGATGCGCTTATCGGTAAAGAAGATACGGTTATTATTAACATTGCA AACGAGTGGTATGGGAGTTGGGATGGCTCAGCTTGGGCCGATGGCTATATT 5 GATGTCATTCCGAAGCTTCGCGATGCCGGCTTAACACACACCTTAATGGTTG ATGCAGCAGGATGGGGGCAATATCCGCAATCTATTCATGATTACGGACAAG ATGTGTTTAATGCAGATCCGTTAAAAAATACGATGTTCTCCATCCATATGTAT GAGTATGCTGGTGGTGATGCTAACACTGTTAGATCAAATATTGATAGAGTCA TAGATCAAGACCTTGCTCTCGTAATAGGTGAATTCGGTCATAGACATACTGA o10 TGGTGATGTTGATGAAGATACAATCCTTAGTTATTCTGAAGAAACTGGCACA GGGTGGCTCGCTTGGTCTTGGAAAGGCAACAGTACCGAATGGGACTATTTA GACCTTTCAGAAGACTGGGCTGGTCAACATTTAACTGATTGGGGGAATAGAA TTGTCCACGGGGCCGATGGCTTACAGGAAACCTCCAAACCATCCACCGTAT TTACAGATGATAACGGTGGTCACCCTGAACCGCCAACTGCTACTACCTTGTA 15 TGACTTTGAAGGAAGCACACAAGGGTGGCATGGAAGCAACGTGACCGGTG GCCCTTGGTCCGTAACAGAATGGGGTGCTTCAGGTAACTACTCTTTAAAAGC CGATGTAAATTTAACCTCAAATTCTTCACATGAACTGTATAGTGAACAAAGTC GTAATCTACACGGATACTCTCAGCTCAACGCAACCGTTCGCCATGCCAATTG GGGAAATCCCGGTAATGGCATGAATGCAAGACTTTACGTGAAAACGGGCTC 20 TGATTATACATGGCATAGCGGTCCTTTTACACGTATCAATAGCTCCAACTCA GGAACAACGTTATCTTTTGATTTAAACAACATCGAAAATATCATCATGTTAGG GAAATAG 25 SEQ ID NO:4 SEQUENCE CHARACTERISITICS: LENGTH: 468 amino acids TYPE: amino acid 30 TOPOLOGY: linear MOLECULE TYPE: protein SEQUENCE DESCRIPTION: SEQ ID NO: 4 35 MKKKLSQIYHLIICTLIISVGIMGITTSPSAASTGFYVDGNTLYDANGQPFVMRGIN
HGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKM
WO 99/09129 PCT/US98/12015 82 VAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGS AWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTM FSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEE TGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKP 5 STVFTDDNGGHPEPPTATTLYDFEGSTQGWHGSNVTGGPWSVTEWGASGNY SLKADVNLTSNSSHELYSEQSRNLHGYSQLNATVRHANWGNPGNGMNARLYV KTGSDYTWHSGPFTRINSSNSGTTLSFDLNNIENIIMLGK 10 SEQ ID NO:5 SEQUENCE CHARACTERISITICS: LENGTH: 1029 base pairs TYPE: nucleic acid 15 STRANDEDNESS: single TOPOLOGY: linear MOLECULE TYPE: genomic DNA 20 SEQUENCE DESCRIPTION SEQ ID No:5 5' AAT TGG CGC ATA CTG TGT CGC CTG TGA ATC CTA ATG CCC AGC AGA CAA CAA AAA CAG TGA TGA ACT GGC TTG CGC ACC TGC CGA ACC GAA CGG AA ACA GAG TCC TTT CCG GAG CGT TCG GAG GTT ACA GCC 25 ATG ACA CAT TTT CTA TGG CTG AGG CTG ATA GAA TCC GAA GCG CCA CCG GGC AAT CGC CTG CTA TTT ATG GCT GCG ATT ATG CCA GAG GAT GGC TTG AAA CAG CAA ATA TTG AAG ATT CAA TAG ATG TAA GCT GCA ACG GCG ATT TAA TGT CGT ATT GGA AAA ATG GCG GAA TTC CGC AAA TCA GTT TGC ACC TGG CGA ACC CTG CTT TTC AGT CAG GGC ATT TTA 30 AAA CAC CGA TTA CAA ATG ATC AGT ATA AAA ACA TAT TAG ATT CAG CAA CAG CGG AAG GGA AGC GGC TAA ATG CCA TGC TCA GCA AAA TTG CTG ACG GAC TTC AAG AGT TGG AGA ACC AAG GTG TGC CTG TTC TGT TCA GGC CGC TGC ATG AAA TGA ACG GCG AAT GGT TTT GGT GGG GAC TCA CAT CAT ATA ACC AAA AGG ATA ATG AAA GAA TCT CTC TAT ATA 35 AAC AGC TCT ACA AGA AAA TCT ATC ATT ATA TGA CCG ACA CAA GAG GAC TTG ATC ATT TGA TTT GGG TTT ACT CTC CCG ACG CCA ACC GAG WO 99/09129 PCT/US98/12015 83 ATT TTA AAA CTG ATT TTT ACC CGG GCG CGT CTT ACG TGG ATA TTG TCG GAT TAG ATG CGT ATT TTC AAG ATG CCT ACT CGA TCA ATG GAT ACG ATC AGC TAA CAG CGC TTA ATA AAC CAT TTG CTT TTA CAG AAG TCG GCC CGC AAA CAG CAA ACG GCA GCT TCG ATT ACA GCC TGT TCA 5 TCA ATG CAA TAA AAC AAA AAT ATC CTA AAA CCA TTT ACT TTC TGG CAT GGA ATG ATG AAT GGA GCG CAG CAG TAA ACA AGG GTG CTT CAG CTT TAT ATC ATG ACA GCT GGA CAC TCA ACA AGG GAG AAA TAT GGA ATG GTG ATT CTT TAA CGC CAA TCG TTG AGT GAA TCC GGG ATC 3' 10 SEQ ID NO:6 SEQUENCE CHARACTERISITICS: LENGTH: 363 amino acids 15 TYPE: amino acid TOPOLOGY: linear MOLECULE TYPE: protein 20 SEQUENCE DESCRIPTION: SEQ ID NO: 6 ydhT 1 LFKKHTISLLII FLLASAVLAKPIEAHTVSPVNPNAQQTTKTVMNWLAHL 50 ydhT 51 25 PNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLE 100 ydhT 101 TANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQ 150 ydhT 151 YKNILDSATAEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFW 200 30 ydhT 201 WGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFK 250 ydhT 251 TDFYPGASYVDIVGLDAYFQDAYSI NGYDQLTALN KPFAFTEVGPQTANG 300 ydhT 301 35 SFDYSLFI NAIKQKYPKTIYFLAWN DEWSAAVN KGASALYH DSWTLN KG E 350 ydhT 351 WO 99/09129 PCT/US98/12015 84 IWNGDSLTPIVE*. 363

Claims (8)

1. A laundry detergent and/or fabric care composition comprising a laundry detergent and/or fabric care ingredient, a mannanase enzyme and a clay. 5
2. A laundry detergent and/or fabric care composition according to claim 1 wherein said mannanase is present at a level of from 0.0001% to 2%, preferably from 0.0005% to 0.5%, more preferably from 0.001% to 0.02% pure enzyme by weight of total composition. 10
3. A laundry detergent and/or fabric care composition according to claims 1-2 wherein the clay is comprised at a level of from 0.1 to 50%, preferably from 3% to 25%, more preferably from 4% to 15% by weight of the total composition. 15
4. A laundry detergent and/or fabric care composition according to claims 1-3 wherein the clay is a smectite clay, preferably a montmorillonite or hectorite clay, with a cation exchange capacity of at least 50 meq/100g. 20
5. A laundry detergent and/or fabric care composition according to claims 1-4 further comprising a builder selected from zeolite, sodium tripolyphosphate, layered silicate and/or mixtures thereof.
6. A laundry detergent and/or fabric care composition according to any of the 25 preceding claims further comprising a cellulase.
7. A laundry detergent and/or fabric care composition according to any of the preceding claims further comprising a cationic surfactant, preferably a surfactant comprising two long alkyl chain lengths. 30
8. A method of cleaning a fabric with a laundry detergent and/or fabric care composition according to any of the preceding claims.
AU80651/98A 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a clay Abandoned AU8065198A (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP97870120 1997-08-14
EP97870120A EP0896998A1 (en) 1997-08-14 1997-08-14 Laundry detergent compositions comprising a saccharide gum degrading enzyme
PCT/US1998/012015 WO1999009129A1 (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a clay

Publications (1)

Publication Number Publication Date
AU8065198A true AU8065198A (en) 1999-03-08

Family

ID=8231031

Family Applications (8)

Application Number Title Priority Date Filing Date
AU80642/98A Abandoned AU8064298A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a protease
AU80651/98A Abandoned AU8065198A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a clay
AU78333/98A Abandoned AU7833398A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and percarbonate
AU78327/98A Abandoned AU7832798A (en) 1997-08-14 1998-06-10 Enzymatic cleaning compositions
AU78334/98A Abandoned AU7833498A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a hydrophobic bleach activator
AU80653/98A Abandoned AU8065398A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a cationic surfactant
AU80641/98A Abandoned AU8064198A (en) 1997-08-14 1998-06-10 Laundry detergent compositions comprising a saccharide gum degrading enzyme
AU79581/98A Abandoned AU7958198A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a soil release polymer

Family Applications Before (1)

Application Number Title Priority Date Filing Date
AU80642/98A Abandoned AU8064298A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a protease

Family Applications After (6)

Application Number Title Priority Date Filing Date
AU78333/98A Abandoned AU7833398A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and percarbonate
AU78327/98A Abandoned AU7832798A (en) 1997-08-14 1998-06-10 Enzymatic cleaning compositions
AU78334/98A Abandoned AU7833498A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a hydrophobic bleach activator
AU80653/98A Abandoned AU8065398A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a cationic surfactant
AU80641/98A Abandoned AU8064198A (en) 1997-08-14 1998-06-10 Laundry detergent compositions comprising a saccharide gum degrading enzyme
AU79581/98A Abandoned AU7958198A (en) 1997-08-14 1998-06-10 Detergent compositions comprising a mannanase and a soil release polymer

Country Status (18)

Country Link
EP (4) EP0896998A1 (en)
JP (8) JP2001515131A (en)
KR (2) KR20010022893A (en)
CN (8) CN1336953A (en)
AT (4) ATE363527T1 (en)
AU (8) AU8064298A (en)
BR (8) BR9811192A (en)
CA (8) CA2301156A1 (en)
CZ (2) CZ2000502A3 (en)
DE (4) DE69826294T2 (en)
DK (1) DK1009795T3 (en)
ES (3) ES2227845T3 (en)
HU (1) HUP0003670A3 (en)
ID (1) ID23442A (en)
MX (7) MXPA00001567A (en)
PT (1) PT1009795E (en)
TR (2) TR200000339T2 (en)
WO (8) WO1999009131A1 (en)

Families Citing this family (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6376445B1 (en) * 1997-08-14 2002-04-23 Procter & Gamble Company Detergent compositions comprising a mannanase and a protease
DE19752844A1 (en) * 1997-11-28 1999-06-02 Henkel Kgaa Increasing the cleaning performance of detergents
JP4047545B2 (en) * 1998-06-10 2008-02-13 ノボザイムス アクティーゼルスカブ New mannanase
AU5744199A (en) 1998-09-16 2000-04-03 Unilever Plc Fabric care composition
GB2348434A (en) * 1999-04-01 2000-10-04 Procter & Gamble Detergent compositions
FI109921B (en) * 1999-09-29 2002-10-31 Valtion Teknillinen Method and enzyme preparation for process industry
CN1377401A (en) * 1999-10-05 2002-10-30 西巴特殊化学品控股有限公司 Fabric softener compositions
US6949503B2 (en) * 1999-10-05 2005-09-27 Ciba Specialty Chemicals Corporation Fabric softener compositions
KR20020040836A (en) * 1999-10-05 2002-05-30 에프. 아. 프라저, 에른스트 알테르 (에. 알테르), 한스 페터 비틀린 (하. 페. 비틀린), 피. 랍 보프, 브이. 스펜글러, 페. 아에글러 Fabric softener compositions
AU7907500A (en) * 1999-10-05 2001-05-10 Ciba Specialty Chemicals Holding Inc. Fabric softener compositions
GB0030669D0 (en) 2000-12-15 2001-01-31 Unilever Plc Detergent compositions
GB0222501D0 (en) 2002-09-27 2002-11-06 Unilever Plc Composition and method for bleaching a substrate
JP2004211080A (en) * 2002-12-19 2004-07-29 Kao Corp Bleaching detergent composition
CN108486086A (en) * 2003-07-02 2018-09-04 维莱尼姆公司 Dextranase, encode they nucleic acid and preparation and use their method
WO2007026331A1 (en) 2005-09-02 2007-03-08 The Procter & Gamble Company Laundry scent customization
DE102006038448A1 (en) 2005-12-28 2008-02-21 Henkel Kgaa Enzyme-containing cleaning agent
EP1867707B1 (en) * 2006-06-16 2011-09-07 The Procter & Gamble Company Detergent compositions
EP1882731A1 (en) * 2006-06-16 2008-01-30 The Procter and Gamble Company Detergent compositions
EP1867708B1 (en) * 2006-06-16 2017-05-03 The Procter and Gamble Company Detergent compositions
DE602006020853D1 (en) * 2006-07-07 2011-05-05 Procter & Gamble detergent compositions
AU2008219739A1 (en) * 2007-02-28 2008-09-04 Danisco Us Inc. Cleaning compositions comprising alpha-galactosidase
US20080229514A1 (en) * 2007-03-22 2008-09-25 Poulose Ayrookaran J Cleaning compositions comprising transglucosidase
US20090048136A1 (en) * 2007-08-15 2009-02-19 Mcdonald Hugh C Kappa-carrageenase and kappa-carrageenase-containing compositions
JP5485171B2 (en) * 2008-01-04 2014-05-07 ザ プロクター アンド ギャンブル カンパニー Laundry detergent composition comprising glycosyl hydrolase and benefit agent-containing delivery particles
ES2568784T5 (en) 2008-01-04 2023-09-13 Procter & Gamble A laundry detergent composition comprising glycosyl hydrolase
WO2011005913A1 (en) 2009-07-09 2011-01-13 The Procter & Gamble Company A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte
EP2451915A1 (en) 2009-07-09 2012-05-16 The Procter & Gamble Company A catalytic laundry detergent composition comprising relatively low levels of water-soluble electrolyte
HUE029942T2 (en) 2009-08-13 2017-04-28 Procter & Gamble Method of laundering fabrics at low temperature
CA2798902C (en) * 2010-05-14 2017-03-21 The Sun Products Corporation Polymer-containing cleaning compositions and methods of production and use thereof
DE102010041351A1 (en) 2010-09-24 2012-03-29 Krones Aktiengesellschaft filling
JP2012111810A (en) * 2010-11-22 2012-06-14 Kao Corp Powder detergent composition for use in automatic washer
WO2012087966A2 (en) * 2010-12-20 2012-06-28 E. I. Du Pont De Nemours And Company Targeted perhydrolases
DE102012200333A1 (en) 2012-01-11 2013-07-11 Henkel Ag & Co. Kgaa Acylhydrazones as bleach-enhancing agents
US10087401B2 (en) * 2012-03-16 2018-10-02 Monosol, Llc Water soluble compositions incorporating enzymes, and method of making same
AR090971A1 (en) 2012-05-07 2014-12-17 Novozymes As POLYPEPTIDES THAT HAVE XANTANE DEGRADATION ACTIVITY AND POLYCINOCYLODES THAT CODE THEM
US9567551B2 (en) 2012-06-22 2017-02-14 Ecolab Usa Inc. Solid rinse aid composition and method of making same
US9011610B2 (en) 2012-06-22 2015-04-21 Ecolab Usa Inc. Solid fast draining/drying rinse aid for high total dissolved solid water conditions
EP2914707A2 (en) * 2012-11-05 2015-09-09 Novozymes A/S Enzyme compositions enabling re-use of water in laundry
WO2014088940A1 (en) * 2012-12-07 2014-06-12 Danisco Us Inc. Compositions and methods of use
CN105073966B (en) * 2013-03-28 2018-03-23 宝洁公司 Cleasing compositions comprising polyetheramine
DE102013103463A1 (en) 2013-04-08 2014-10-09 Ludwig Hettich & Co. Kg Tool, screw and system for transmitting a drive torque
JP6235120B2 (en) * 2013-04-23 2017-11-22 ビーエーエスエフ ソシエタス・ヨーロピアBasf Se Formulations, their use as dishwashing detergents, or their use for the production of dishwashing detergents, and their production
US20160152925A1 (en) * 2013-07-04 2016-06-02 Novozymes A/S Polypeptides Having Anti-Redeposition Effect and Polynucleotides Encoding Same
CN103695394B (en) * 2013-12-18 2015-07-29 青岛根源生物技术集团有限公司 Acid resistance mannase MAN26gy of a kind of optimization and its preparation method and application
JP6184024B2 (en) * 2014-06-30 2017-08-23 ライオン株式会社 Granular detergent
JP6192231B2 (en) * 2014-07-02 2017-09-06 ライオン株式会社 Liquid detergent for dishwashing
CN104843844A (en) * 2015-05-07 2015-08-19 苏州能华节能环保科技有限公司 Environmental protection treating agent for metal processing waste water and preparation method thereof
EP3292191B1 (en) 2015-05-07 2019-06-05 Unilever N.V. Alkaline dishwash composition
WO2016198263A1 (en) * 2015-06-11 2016-12-15 Unilever Plc Laundry detergent composition
US10941372B2 (en) 2015-06-11 2021-03-09 Conopco, Inc. Laundry detergent composition
CA2991114A1 (en) * 2015-09-17 2017-03-23 Novozymes A/S Polypeptides having xanthan degrading activity and polynucleotides encoding same
JP6591277B2 (en) * 2015-12-15 2019-10-16 花王株式会社 Liquid detergent composition for tableware
EP3390607B1 (en) * 2015-12-18 2020-02-26 Henkel AG & Co. KGaA Penta-built liquid detergent composition
US20190185791A1 (en) * 2016-05-26 2019-06-20 Novozymes A/S Use of enzymes, cleaning composition and method for washing
JP6749199B2 (en) * 2016-09-30 2020-09-02 ライオン株式会社 Glitter generation inhibitor for textile products, treatment liquid for gloss product suppression for textile products, and method for suppressing gloss growth of textile products
JP6981871B2 (en) * 2016-12-27 2021-12-17 花王株式会社 Powder detergent composition for textile products
JP6862035B2 (en) * 2017-01-20 2021-04-21 株式会社Adeka Neutral cleaning agent composition
JP7273126B2 (en) * 2017-04-12 2023-05-12 花王株式会社 LIQUID CLEANER COMPOSITION FOR HARD SURFACES
JP6976704B2 (en) * 2017-04-12 2021-12-08 花王株式会社 Liquid detergent composition for hard surfaces
EP3409767B1 (en) * 2017-05-30 2020-10-21 AB Enzymes Oy Mannanase variants
EP3409768B1 (en) * 2017-05-30 2020-03-11 AB Enzymes Oy Mannanase variants
CN107490253A (en) * 2017-07-31 2017-12-19 兰溪市捷喜食品加工技术有限公司 The industrial drying machine of high temperature, thermal balance
EP3759203B1 (en) 2018-03-02 2022-02-09 Unilever IP Holdings B.V. Laundry method
CN111868222A (en) * 2018-03-02 2020-10-30 荷兰联合利华有限公司 Laundry compositions
WO2020264077A1 (en) * 2019-06-28 2020-12-30 The Procter & Gamble Company Cleaning composition
JP7568839B2 (en) * 2020-10-29 2024-10-16 ザ プロクター アンド ギャンブル カンパニー Cleaning Compositions Containing Arginase Enzyme
GB202020463D0 (en) * 2020-12-23 2021-02-03 Reckitt Benckiser Vanish Bv Mono-phase laundry composition
CN115613044B (en) * 2022-09-28 2024-05-03 湖南金裕环保科技有限公司 Cold-rolled steel plate oil-removing ash-removing phosphorus-free degreasing agent, preparation method and application
CN116334043A (en) * 2023-04-25 2023-06-27 云南师范大学 Beta-mannase mutant V337E with improved acid resistance and preparation and application thereof

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4597898A (en) * 1982-12-23 1986-07-01 The Proctor & Gamble Company Detergent compositions containing ethoxylated amines having clay soil removal/anti-redeposition properties
US4548744A (en) * 1983-07-22 1985-10-22 Connor Daniel S Ethoxylated amine oxides having clay soil removal/anti-redeposition properties useful in detergent compositions
PL143146B1 (en) * 1984-12-18 1988-01-30 Ts Osrodek Badawczo Rozwo Method of purifying fabrics from plant and other cellulosic impurities
JPS62913A (en) * 1985-06-26 1987-01-06 Lion Corp Cleaner for contact lens
GB8905439D0 (en) * 1989-03-09 1989-04-19 Unilever Plc Enzymatic dishwashing compositions
EP0495257B1 (en) * 1991-01-16 2002-06-12 The Procter & Gamble Company Compact detergent compositions with high activity cellulase
CN1134726A (en) * 1993-10-04 1996-10-30 诺沃挪第克公司 An enzyme preparation comprising a modified enzyme
CA2176697C (en) * 1993-12-21 2000-01-11 Michael Alan John Moss Detergent compositions containing percarbonate and amylase
PE6995A1 (en) * 1994-05-25 1995-03-20 Procter & Gamble COMPOSITION INCLUDING A PROPOXYLATED POLYKYLENE OAMINE POLYKYLENE OAMINE POLYMER AS DIRT SEPARATION AGENT
WO1995035362A1 (en) * 1994-06-17 1995-12-28 Genencor International Inc. Cleaning compositions containing plant cell wall degrading enzymes and their use in cleaning methods
EP0709452A1 (en) * 1994-10-27 1996-05-01 The Procter & Gamble Company Cleaning compositions comprising xylanases
ES2144649T3 (en) * 1994-11-18 2000-06-16 Procter & Gamble DETERGENT COMPOSITIONS CONTAINING LIPASE AND PROTEASE.
TW474900B (en) * 1995-05-19 2002-02-01 Betzdearborn Inc Use of mannanases as slime control agents
EP0756001A1 (en) * 1995-07-24 1997-01-29 The Procter & Gamble Company Detergent compositions comprising specific amylase and a specific surfactant system
ATE242802T1 (en) * 1995-09-20 2003-06-15 Genencor Int MANNASE OF BACILLUS AMYLOLIQUEFACIENS AND METHOD FOR THEIR PREPARATION
BR9611602A (en) * 1995-11-17 2000-03-28 Procter & Gamble Laundry detergent composition containing selected lipolytic enzyme and quaternary ammonium compounds
CA2242767C (en) * 1996-01-11 2006-05-30 Recombinant Biocatalysis, Inc. Glycosidase enzymes
ES2230594T3 (en) * 1996-01-29 2005-05-01 Novozymes A/S PROCESS FOR ELIMINATION OR DECOLORATION OF DIRT OR CELLULOSE FABRICS.
US5968893A (en) * 1996-05-03 1999-10-19 The Procter & Gamble Company Laundry detergent compositions and methods for providing soil release to cotton fabric

Also Published As

Publication number Publication date
BR9811191A (en) 2000-07-18
BR9811187A (en) 2000-07-25
DE69837850T2 (en) 2008-01-24
WO1999009130A1 (en) 1999-02-25
ATE230013T1 (en) 2003-01-15
BR9811196A (en) 2000-07-25
JP2001515126A (en) 2001-09-18
JP2001515131A (en) 2001-09-18
BR9811195A (en) 2000-07-25
ATE276344T1 (en) 2004-10-15
MXPA00001614A (en) 2001-06-01
CA2301404A1 (en) 1999-02-25
BR9811190A (en) 2000-07-18
AU7833398A (en) 1999-03-08
JP2001515133A (en) 2001-09-18
WO1999009127A1 (en) 1999-02-25
DE69826294D1 (en) 2004-10-21
JP4090688B2 (en) 2008-05-28
EP1009794A1 (en) 2000-06-21
CA2301156A1 (en) 1999-02-25
CN1276825A (en) 2000-12-13
CN1469919A (en) 2004-01-21
ATE363527T1 (en) 2007-06-15
JP2001515128A (en) 2001-09-18
CN1276005A (en) 2000-12-06
EP1036151A1 (en) 2000-09-20
KR20010022908A (en) 2001-03-26
CN1306566A (en) 2001-08-01
EP0896998A1 (en) 1999-02-17
CA2301167A1 (en) 1999-02-25
CA2300696A1 (en) 1999-02-25
AU8064198A (en) 1999-03-08
JP4090689B2 (en) 2008-05-28
CN1276824A (en) 2000-12-13
AU8064298A (en) 1999-03-08
JP2001515129A (en) 2001-09-18
DE69826294T2 (en) 2005-11-17
HUP0003670A3 (en) 2001-06-28
MXPA00001618A (en) 2001-06-01
CZ2000506A3 (en) 2001-03-14
BR9811186A (en) 2000-07-25
MXPA00001616A (en) 2001-06-01
BR9811192A (en) 2000-07-18
PT1009795E (en) 2005-02-28
JP4090690B2 (en) 2008-05-28
AU7958198A (en) 1999-03-08
WO1999009131A1 (en) 1999-02-25
DE69810309D1 (en) 2003-01-30
ATE332958T1 (en) 2006-08-15
CN1276826A (en) 2000-12-13
DE69810309T2 (en) 2003-10-16
JP2001515130A (en) 2001-09-18
ID23442A (en) 2000-04-20
JP2001515127A (en) 2001-09-18
AU7832798A (en) 1999-03-08
DE69837850D1 (en) 2007-07-12
AU8065398A (en) 1999-03-08
DK1009795T3 (en) 2005-01-24
WO1999009128A1 (en) 1999-02-25
ES2227845T3 (en) 2005-04-01
DE69835214D1 (en) 2006-08-24
DE69835214T2 (en) 2007-06-21
WO1999009129A1 (en) 1999-02-25
CA2301205A1 (en) 1999-02-25
MXPA00001613A (en) 2001-06-01
WO1999009133A1 (en) 1999-02-25
KR20010022893A (en) 2001-03-26
WO1999009126A1 (en) 1999-02-25
BR9811189A (en) 2000-07-25
CA2301200A1 (en) 1999-02-25
MXPA00001567A (en) 2001-06-01
JP2001515132A (en) 2001-09-18
ES2185172T3 (en) 2003-04-16
AU7833498A (en) 1999-03-08
MXPA00001617A (en) 2001-06-01
TR200000340T2 (en) 2000-11-21
CA2299410A1 (en) 1999-02-25
EP1009796A1 (en) 2000-06-21
CZ2000502A3 (en) 2001-03-14
HUP0003670A2 (en) 2001-05-28
TR200000339T2 (en) 2000-07-21
MXPA00001610A (en) 2001-06-01
WO1999009132A1 (en) 1999-02-25
CA2301168A1 (en) 1999-02-25
CN1336953A (en) 2002-02-20
ES2268780T3 (en) 2007-03-16
CN1301294A (en) 2001-06-27

Similar Documents

Publication Publication Date Title
US6376445B1 (en) Detergent compositions comprising a mannanase and a protease
AU8065198A (en) Detergent compositions comprising a mannanase and a clay
US6440911B1 (en) Enzymatic cleaning compositions
US6964943B1 (en) Detergent compositions comprising a mannanase and a soil release polymer
US6486112B1 (en) Laundry detergent compositions comprising a saccharide gum degrading enzyme
US6420331B1 (en) Detergent compositions comprising a mannanase and a bleach system
EP1009793B1 (en) Enzymatic cleaning compositions
EP1007617B1 (en) Detergent compositions comprising a mannanase and percarbonate
EP1009797B1 (en) Detergent compositions comprising a mannanase and a soil release polymer
EP1009795B1 (en) Detergent compositions comprising a mannanase and a protease
WO1999064552A1 (en) Detergent compositions comprising a mannanase and a mid-branched anionic surfactant

Legal Events

Date Code Title Description
MK5 Application lapsed section 142(2)(e) - patent request and compl. specification not accepted