GB9913458D0 - The therapeutic use of d-threo-methylphenidate - Google Patents
The therapeutic use of d-threo-methylphenidateInfo
- Publication number
- GB9913458D0 GB9913458D0 GBGB9913458.7A GB9913458A GB9913458D0 GB 9913458 D0 GB9913458 D0 GB 9913458D0 GB 9913458 A GB9913458 A GB 9913458A GB 9913458 D0 GB9913458 D0 GB 9913458D0
- Authority
- GB
- United Kingdom
- Prior art keywords
- methylphenidate
- threo
- therapeutic use
- treatment
- respond
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 229960001042 dexmethylphenidate Drugs 0.000 title 1
- DUGOZIWVEXMGBE-CHWSQXEVSA-N dexmethylphenidate Chemical compound C([C@@H]1[C@H](C(=O)OC)C=2C=CC=CC=2)CCCN1 DUGOZIWVEXMGBE-CHWSQXEVSA-N 0.000 title 1
- 230000001225 therapeutic effect Effects 0.000 title 1
- 229960001344 methylphenidate Drugs 0.000 abstract 2
- 208000006096 Attention Deficit Disorder with Hyperactivity Diseases 0.000 abstract 1
- 208000036864 Attention deficit/hyperactivity disease Diseases 0.000 abstract 1
- DUGOZIWVEXMGBE-UHFFFAOYSA-N Methylphenidate Chemical compound C=1C=CC=CC=1C(C(=O)OC)C1CCCCN1 DUGOZIWVEXMGBE-UHFFFAOYSA-N 0.000 abstract 1
- 208000015802 attention deficit-hyperactivity disease Diseases 0.000 abstract 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/445—Non condensed piperidines, e.g. piperocaine
- A61K31/4458—Non condensed piperidines, e.g. piperocaine only substituted in position 2, e.g. methylphenidate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Psychiatry (AREA)
- Hospice & Palliative Care (AREA)
- Epidemiology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Hydrogenated Pyridines (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9913458.7A GB9913458D0 (en) | 1999-06-09 | 1999-06-09 | The therapeutic use of d-threo-methylphenidate |
| JP2001501216A JP2003501387A (ja) | 1999-06-09 | 2000-06-08 | 注意欠損活動亢進障害の治療のためのd−トレオ−メチルフェニデートの治療的使用 |
| ES00940504T ES2243273T3 (es) | 1999-06-09 | 2000-06-08 | Utilizacion terapeutica de d-treo-metilfenidato para el tratamiento del trastorno de hperactividad y deficit de atencion. |
| DK00940504T DK1185268T3 (da) | 1999-06-09 | 2000-06-08 | Terapeutisk anvendelse af D-threo-methylphenidat til behandling af opmærksomhedsforstyrrelseshyperaktivitetstilstand |
| PCT/GB2000/002234 WO2000074680A1 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| EP00940504A EP1185268B1 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| AU55432/00A AU766748B2 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| AT00940504T ATE302006T1 (de) | 1999-06-09 | 2000-06-08 | Therapeutische verwendung von d-threo- methylphenidate zur behandlung von aufmerksamkeitsmangel-hyperaktivitätsstörungen |
| DE60022033T DE60022033T2 (de) | 1999-06-09 | 2000-06-08 | Therapeutische verwendung von d-threo-methylphenidate zur behandlung von aufmerksamkeitsmangel-hyperaktivitätsstörungen |
| CA002376215A CA2376215A1 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9913458.7A GB9913458D0 (en) | 1999-06-09 | 1999-06-09 | The therapeutic use of d-threo-methylphenidate |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| GB9913458D0 true GB9913458D0 (en) | 1999-08-11 |
Family
ID=10855048
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| GBGB9913458.7A Pending GB9913458D0 (en) | 1999-06-09 | 1999-06-09 | The therapeutic use of d-threo-methylphenidate |
Country Status (9)
| Country | Link |
|---|---|
| EP (1) | EP1185268B1 (enExample) |
| JP (1) | JP2003501387A (enExample) |
| AT (1) | ATE302006T1 (enExample) |
| AU (1) | AU766748B2 (enExample) |
| CA (1) | CA2376215A1 (enExample) |
| DE (1) | DE60022033T2 (enExample) |
| ES (1) | ES2243273T3 (enExample) |
| GB (1) | GB9913458D0 (enExample) |
| WO (1) | WO2000074680A1 (enExample) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6486177B2 (en) | 1995-12-04 | 2002-11-26 | Celgene Corporation | Methods for treatment of cognitive and menopausal disorders with D-threo methylphenidate |
| US5837284A (en) | 1995-12-04 | 1998-11-17 | Mehta; Atul M. | Delivery of multiple doses of medications |
| US6962997B1 (en) | 1997-05-22 | 2005-11-08 | Celgene Corporation | Process and intermediates for resolving piperidyl acetamide steroisomers |
| KR101318806B1 (ko) | 2005-01-20 | 2013-10-16 | 인스티튜트 포 몰리큘러 메디신, 인코포레이티드 | 메틸페니데이트 유도체 및 그 용도 |
| WO2009146320A1 (en) | 2008-05-27 | 2009-12-03 | Dmi Life Sciences, Inc. | Therapeutic methods and compounds |
| CN108348775B (zh) | 2015-09-15 | 2021-07-02 | 普瑞西斯生物学研究有限责任公司 | 芬坎法明的前药 |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9514451D0 (en) * | 1995-07-14 | 1995-09-13 | Chiroscience Ltd | Sustained-release formulation |
| US5908850A (en) * | 1995-12-04 | 1999-06-01 | Celgene Corporation | Method of treating attention deficit disorders with d-threo methylphenidate |
| US5837284A (en) * | 1995-12-04 | 1998-11-17 | Mehta; Atul M. | Delivery of multiple doses of medications |
| US5922736A (en) * | 1995-12-04 | 1999-07-13 | Celegene Corporation | Chronic, bolus administration of D-threo methylphenidate |
| MX9805870A (enExample) * | 1996-01-22 | 1999-01-31 | ||
| US6210705B1 (en) * | 1997-12-15 | 2001-04-03 | Noven Pharmaceuticals, Nc. | Compositions and methods for treatment of attention deficit disorder and attention deficit/hyperactivity disorder with methylphenidate |
| US6025502A (en) * | 1999-03-19 | 2000-02-15 | The Trustees Of The University Of Pennsylvania | Enantopselective synthesis of methyl phenidate |
-
1999
- 1999-06-09 GB GBGB9913458.7A patent/GB9913458D0/en active Pending
-
2000
- 2000-06-08 WO PCT/GB2000/002234 patent/WO2000074680A1/en not_active Ceased
- 2000-06-08 AU AU55432/00A patent/AU766748B2/en not_active Ceased
- 2000-06-08 CA CA002376215A patent/CA2376215A1/en not_active Abandoned
- 2000-06-08 JP JP2001501216A patent/JP2003501387A/ja active Pending
- 2000-06-08 AT AT00940504T patent/ATE302006T1/de not_active IP Right Cessation
- 2000-06-08 DE DE60022033T patent/DE60022033T2/de not_active Expired - Fee Related
- 2000-06-08 EP EP00940504A patent/EP1185268B1/en not_active Expired - Lifetime
- 2000-06-08 ES ES00940504T patent/ES2243273T3/es not_active Expired - Lifetime
Also Published As
| Publication number | Publication date |
|---|---|
| ES2243273T3 (es) | 2005-12-01 |
| WO2000074680A1 (en) | 2000-12-14 |
| EP1185268A1 (en) | 2002-03-13 |
| CA2376215A1 (en) | 2000-12-14 |
| AU766748B2 (en) | 2003-10-23 |
| ATE302006T1 (de) | 2005-09-15 |
| DE60022033D1 (de) | 2005-09-22 |
| AU5543200A (en) | 2000-12-28 |
| DE60022033T2 (de) | 2006-03-30 |
| EP1185268B1 (en) | 2005-08-17 |
| JP2003501387A (ja) | 2003-01-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| IL151164A0 (en) | Azacyclic compounds for use in the treatment of serotonin related diseases | |
| SG158731A1 (en) | Novel medicament compositions, based on anticholinergically effective compounds and beta-mimetics | |
| GEP20094759B (en) | Combination therapy using 1-aminocyclohexane derivatives and acetylcholinesterase inhibitors | |
| ATE240744T1 (de) | Verwendung von csf-1-inhibitoren | |
| MXPA02011304A (es) | Derivados de piperidina farmaceuticamente activos, en partiular como moduladores de la actividad del receptor de la quimocina. | |
| HUP0000873A2 (hu) | A levobupivakain arcsebészeti alkalmazása | |
| MXPA04004503A (es) | Derivados de piperina y su uso como moduladores de actividad receptora de quimiocina (especialmente ccr5). | |
| DK1000029T3 (da) | Norcisaprid nyttig med hensyn til 5-HT3- og 5-HT4- medierede lidelser | |
| ZA987140B (en) | Treatment of attention deficit disorders | |
| GB9913458D0 (en) | The therapeutic use of d-threo-methylphenidate | |
| PL1697005T3 (pl) | Kombinacja flupirtyny i tramadolu | |
| MY103210A (en) | Arylpiperazinyl-alkylene-phenyl-heterocyclic compounds. | |
| PT783495E (pt) | Derivados de quinoxalina uteis em terapia | |
| AP2000002017A0 (en) | Salts of paroxetine. | |
| EP1152762B8 (de) | Verwendung von desoxypeganin zur behandlung von alzheimerischer demenz | |
| NZ536111A (en) | Statin therapy for enhancing cognitive maintenance | |
| BG105984A (bg) | Използване на озанетант за приготвяне на лекарствени средства полезни за лечение на разстройства на настроението | |
| MXPA03010136A (es) | Tratamiento del adhd. | |
| NO20010984L (no) | Anvendelse av R(+)-<alfa>-(2,3-dimetoksyfenyl)-1-[2-(4-fluorfenyl)etyl]-4-piperidinmetanol for behandling av sovnforstyrrelser | |
| AU2002226004A1 (en) | Use of factor xiii for treating hemophilia b | |
| NO20055998L (no) | Diarylmetylidenpiperidinderivater, preparater derav og anvendelse derav | |
| YU62101A (sh) | Terapeutski agensi za tretiranje povremenog hramanja | |
| UA28400A (uk) | Спосіб лікування мікробної екземи | |
| UA43619A (uk) | Бетатирон - пролонгований антигіпертензивний засіб нової генерації | |
| MX9801680A (es) | Derivado de fenil pirimidina opticamente activo como agente analgesico. |