FR2470976A1 - Antennes blindees a boucles equilibrees pour systemes electroniques de securite - Google Patents

Antennes blindees a boucles equilibrees pour systemes electroniques de securite

Info

Publication number
FR2470976A1
FR2470976A1 FR8024264A FR8024264A FR2470976A1 FR 2470976 A1 FR2470976 A1 FR 2470976A1 FR 8024264 A FR8024264 A FR 8024264A FR 8024264 A FR8024264 A FR 8024264A FR 2470976 A1 FR2470976 A1 FR 2470976A1
Authority
FR
France
Prior art keywords
loops
antenna
twist
antennas
armored
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
FR8024264A
Other languages
English (en)
French (fr)
Other versions
FR2470976B1 (cg-RX-API-DMAC10.html
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
LICHTBLAU GEORGE
Original Assignee
LICHTBLAU GEORGE
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by LICHTBLAU GEORGE filed Critical LICHTBLAU GEORGE
Publication of FR2470976A1 publication Critical patent/FR2470976A1/fr
Application granted granted Critical
Publication of FR2470976B1 publication Critical patent/FR2470976B1/fr
Granted legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2471Antenna signal processing by receiver or emitter
    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2474Antenna or antenna activator geometry, arrangement or layout
    • HELECTRICITY
    • H01ELECTRIC ELEMENTS
    • H01QANTENNAS, i.e. RADIO AERIALS
    • H01Q7/00Loop antennas with a substantially uniform current distribution around the loop and having a directional radiation pattern in a plane perpendicular to the plane of the loop
    • H01Q7/04Screened antennas

Landscapes

  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Signal Processing (AREA)
  • Automation & Control Theory (AREA)
  • Computer Security & Cryptography (AREA)
  • Electromagnetism (AREA)
  • General Physics & Mathematics (AREA)
  • Burglar Alarm Systems (AREA)
  • Variable-Direction Aerials And Aerial Arrays (AREA)
  • Details Of Aerials (AREA)
FR8024264A 1979-11-15 1980-11-14 Antennes blindees a boucles equilibrees pour systemes electroniques de securite Granted FR2470976A1 (fr)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US06/094,429 US4251808A (en) 1979-11-15 1979-11-15 Shielded balanced loop antennas for electronic security systems

Publications (2)

Publication Number Publication Date
FR2470976A1 true FR2470976A1 (fr) 1981-06-12
FR2470976B1 FR2470976B1 (cg-RX-API-DMAC10.html) 1984-11-23

Family

ID=22245143

Family Applications (1)

Application Number Title Priority Date Filing Date
FR8024264A Granted FR2470976A1 (fr) 1979-11-15 1980-11-14 Antennes blindees a boucles equilibrees pour systemes electroniques de securite

Country Status (13)

Country Link
US (1) US4251808A (cg-RX-API-DMAC10.html)
JP (1) JPS5683000A (cg-RX-API-DMAC10.html)
AU (1) AU530083B2 (cg-RX-API-DMAC10.html)
CA (1) CA1148630A (cg-RX-API-DMAC10.html)
DE (1) DE3043026A1 (cg-RX-API-DMAC10.html)
DK (1) DK158686C (cg-RX-API-DMAC10.html)
ES (2) ES8202958A1 (cg-RX-API-DMAC10.html)
FR (1) FR2470976A1 (cg-RX-API-DMAC10.html)
GB (1) GB2063569B (cg-RX-API-DMAC10.html)
IT (1) IT1129351B (cg-RX-API-DMAC10.html)
MX (1) MX148678A (cg-RX-API-DMAC10.html)
SE (1) SE445498B (cg-RX-API-DMAC10.html)
ZA (1) ZA806639B (cg-RX-API-DMAC10.html)

Families Citing this family (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1138955A (en) * 1979-09-14 1983-01-04 Edward R. Fearon Anti-shoplifting system
US4373163A (en) * 1980-07-14 1983-02-08 I.D. Engineering, Inc. Loop antenna for security systems
US4384281A (en) * 1980-10-31 1983-05-17 Knogo Corporation Theft detection apparatus using saturable magnetic targets
US4342999A (en) * 1980-11-25 1982-08-03 Rca Corporation Loop antenna arrangements for inclusion in a television receiver
USRE32627E (en) * 1981-09-10 1988-03-22 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
US4394645A (en) * 1981-09-10 1983-07-19 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
AU1152083A (en) * 1983-01-03 1984-08-02 Shin, M. Anti-shoplifting system
US4509039A (en) * 1983-07-05 1985-04-02 Minnesota Mining And Manufacturing Company Shielded, closely spaced transmit-receiver antennas for electronic article surveillance system
US4531117A (en) * 1983-07-05 1985-07-23 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4609911A (en) * 1983-07-05 1986-09-02 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4642613A (en) * 1984-03-16 1987-02-10 Knogo Corporation Electronic theft detection apparatus with responder elements on protected articles
US4751516A (en) * 1985-01-10 1988-06-14 Lichtblau G J Antenna system for magnetic and resonant circuit detection
AU633247B2 (en) * 1985-01-10 1993-01-28 Checkpoint Systems, Inc. Antenna system for magnetic and resonant circuit detection
US4647910A (en) * 1985-09-17 1987-03-03 Allied Corporation Selector for AC magnetic inductive field receiver coils
US4728938A (en) * 1986-01-10 1988-03-01 Checkpoint Systems, Inc. Security tag deactivation system
US4769631A (en) * 1986-06-30 1988-09-06 Sensormatic Electronics Corporation Method, system and apparatus for magnetic surveillance of articles
JPS63236401A (ja) * 1987-03-25 1988-10-03 Kokusai Electric Co Ltd 誘導無線装置用ループアンテナ
US4779077A (en) * 1987-04-13 1988-10-18 Lichtblau G J Continuously armed high reliability pulse train processor
US4972198A (en) * 1987-08-31 1990-11-20 Monarch Marking Systems, Inc. Multiple loop antenna
US4872018A (en) * 1987-08-31 1989-10-03 Monarch Marking Systems, Inc. Multiple loop antenna
US5121103A (en) * 1988-07-29 1992-06-09 Knogo Corporation Load isolated article surveillance system and antenna assembly
US5103235A (en) * 1988-12-30 1992-04-07 Checkpoint Systems, Inc. Antenna structure for an electronic article surveillance system
US4999641A (en) * 1989-09-01 1991-03-12 Monarch Marking Systems, Inc. Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance
GB9004431D0 (en) * 1990-02-28 1990-04-25 Scient Generics Ltd Detection system for security systems
US5051726A (en) * 1990-08-14 1991-09-24 Sensormatic Electronics Corporation Electronic article surveillance system with antenna array for enhanced field falloff
NL9100397A (nl) * 1991-03-06 1992-10-01 Nedap Nv Asymmetrische antenne voor winkeldiefstaldetectiesystemen.
US5142292A (en) * 1991-08-05 1992-08-25 Checkpoint Systems, Inc. Coplanar multiple loop antenna for electronic article surveillance systems
US5442334A (en) * 1992-07-20 1995-08-15 Stoplift Corporation Security system having deactivatable security tag
US5404147A (en) * 1992-10-28 1995-04-04 Sensormatic Electronics Corporation EAS system loop antenna having three loops of different area
US5373301A (en) * 1993-01-04 1994-12-13 Checkpoint Systems, Inc. Transmit and receive antenna having angled crossover elements
DE59406653D1 (de) * 1993-07-13 1998-09-17 Actron Entwicklungs Ag Antennenvorrichtung
US5694139A (en) * 1994-06-28 1997-12-02 Sony Corporation Short-distance communication antenna and methods of manufacturing and using the short-distance communication antenna
EP0703637A1 (de) 1994-09-23 1996-03-27 Actron Entwicklungs AG Antenne für ein elektronisches Sicherungssystem
ES2284172T3 (es) * 1995-05-30 2007-11-01 Sensormatic Electronics Corporation Configuracion de antenas para un sistema electronico de vigilancia de articulos con distribucion del campo de interrogacion mejorada.
US5602556A (en) * 1995-06-07 1997-02-11 Check Point Systems, Inc. Transmit and receive loop antenna
US5825335A (en) * 1995-10-23 1998-10-20 Kubota Corporation Sheet antenna apparatus
US5653192A (en) * 1996-03-06 1997-08-05 Alfa Laval Agri Inc. Livestock identification apparatus
CA2251326C (en) * 1996-04-10 2003-06-17 Sentry Technology Corporation Electronic article surveillance system
US5914692A (en) * 1997-01-14 1999-06-22 Checkpoint Systems, Inc. Multiple loop antenna with crossover element having a pair of spaced, parallel conductors for electrically connecting the multiple loops
DE19732254A1 (de) * 1997-07-26 1999-02-11 Kaba Benzing Gmbh Vorrichtung zur Übermittlung magnetischer Signale mittels einer Leiterplatte
JP3389464B2 (ja) 1997-08-07 2003-03-24 三洋電機株式会社 盗難防止ゲート
US6611783B2 (en) 2000-01-07 2003-08-26 Nocwatch, Inc. Attitude indicator and activity monitoring device
EP1158601A1 (de) * 2000-05-15 2001-11-28 Häni Prolectron Ag Trägerelement für eine Antenne mit geringer Handempfindlichkeit
US7030750B2 (en) 2002-07-16 2006-04-18 Bert Taeho Lee Detachable entrance and exit gate with a combined commodity burglarproofing and small arms detecting system
US6900727B2 (en) 2002-07-16 2005-05-31 Bert Taeho Lee Weapon detector system
KR200298223Y1 (ko) * 2002-09-11 2002-12-16 태호 리 버트 총기류 탐지 겸용 상품도난 방지장치의 출입게이트 구조
US20040102870A1 (en) * 2002-11-26 2004-05-27 Andersen Scott Paul RFID enabled paper rolls and system and method for tracking inventory
DE602005006532D1 (de) 2004-02-19 2008-06-19 Koninkl Philips Electronics Nv Verfahren und vorrichtung zum übermitteln des vorliegens einer notsituation, ohne die quelle der übermittlung eindeutig zu identifizieren
US7591415B2 (en) * 2004-09-28 2009-09-22 3M Innovative Properties Company Passport reader for processing a passport having an RFID element
US20070252001A1 (en) * 2006-04-25 2007-11-01 Kail Kevin J Access control system with RFID and biometric facial recognition
EP2327230B1 (en) 2008-09-04 2013-03-27 Allflex Usa, Inc. Combination full-duplex and half-duplex electronic identification tag
WO2011044585A1 (en) * 2009-10-09 2011-04-14 Allflex Usa, Inc. Hdx demodulator
CA2780323C (en) * 2009-10-09 2018-06-12 Aleis Pty Ltd Radio frequency identification reader antenna having a dynamically adjustable q-factor
CA2783571C (en) * 2009-11-04 2018-01-09 Allflex Usa, Inc. Signal cancelling transmit/receive multi-loop antenna for a radio frequency identification reader
US20120139730A1 (en) * 2010-12-03 2012-06-07 Metrologic Instruments, Inc. Electronic article surveillance system
WO2012149025A1 (en) * 2011-04-25 2012-11-01 Conocophillips Company In situ radio frequency catalytic upgrading
WO2013013680A1 (de) * 2011-07-22 2013-01-31 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Antenne und antennenanordnung für magnetresonanz-anwendungen
MX346099B (es) * 2011-10-11 2017-03-07 Senseonics Inc Sistema para activar la fuerza de un campo electrodinámico.
US9577349B2 (en) 2015-06-29 2017-02-21 Near Field Magnetics, Inc. Near-field magnetic communication antenna
DE102017105649A1 (de) * 2017-03-16 2018-09-20 Bundesdruckerei Gmbh RFID-Lesegerät und Verfahren zu seiner Herstellung
US11282638B2 (en) 2017-05-26 2022-03-22 Nucurrent, Inc. Inductor coil structures to influence wireless transmission performance
US11283303B2 (en) 2020-07-24 2022-03-22 Nucurrent, Inc. Area-apportioned wireless power antenna for maximized charging volume
US11695302B2 (en) 2021-02-01 2023-07-04 Nucurrent, Inc. Segmented shielding for wide area wireless power transmitter

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB419783A (en) * 1933-02-02 1934-11-19 Marconi Wireless Telegraph Co Improvements in and relating to wireless receiving apparatus
GB586085A (en) * 1943-11-15 1947-03-06 Standard Telephones Cables Ltd Shielded loop antenna
GB2014796A (en) * 1978-02-17 1979-08-30 Lichtblau G J Antenna system for electronic security installation

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS4327094Y1 (cg-RX-API-DMAC10.html) * 1964-02-25 1968-11-09
US3810147A (en) * 1971-12-30 1974-05-07 G Lichtblau Electronic security system
US3863244A (en) * 1972-06-14 1975-01-28 Lichtblau G J Electronic security system having improved noise discrimination
US3967161A (en) * 1972-06-14 1976-06-29 Lichtblau G J A multi-frequency resonant tag circuit for use with an electronic security system having improved noise discrimination
US3973263A (en) * 1973-04-20 1976-08-03 The United States Of America As Represented By The Secretary Of The Navy Sensitivity improvement of spaced-loop antenna by capacitive gap loading
JPS5046062A (cg-RX-API-DMAC10.html) * 1973-08-28 1975-04-24
JPS5226879A (en) * 1975-08-26 1977-02-28 Nippon Telegr & Teleph Corp <Ntt> Method of measuring phase constants in waveguides
US4260990A (en) * 1979-11-08 1981-04-07 Lichtblau G J Asymmetrical antennas for use in electronic security systems

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB419783A (en) * 1933-02-02 1934-11-19 Marconi Wireless Telegraph Co Improvements in and relating to wireless receiving apparatus
GB586085A (en) * 1943-11-15 1947-03-06 Standard Telephones Cables Ltd Shielded loop antenna
GB2014796A (en) * 1978-02-17 1979-08-30 Lichtblau G J Antenna system for electronic security installation

Also Published As

Publication number Publication date
FR2470976B1 (cg-RX-API-DMAC10.html) 1984-11-23
SE445498B (sv) 1986-06-23
DE3043026A1 (de) 1981-05-21
ES507188A0 (es) 1982-12-16
ZA806639B (en) 1981-11-25
IT8068658A0 (it) 1980-10-30
CA1148630A (en) 1983-06-21
JPH0230553B2 (cg-RX-API-DMAC10.html) 1990-07-06
DK158686C (da) 1991-02-25
DE3043026C2 (cg-RX-API-DMAC10.html) 1990-02-22
JPS5683000A (en) 1981-07-07
AU6298980A (en) 1981-06-04
ES8302369A1 (es) 1982-12-16
ES496218A0 (es) 1982-02-16
ES8202958A1 (es) 1982-02-16
IT1129351B (it) 1986-06-04
SE8007986L (sv) 1981-05-16
GB2063569B (en) 1983-06-22
US4251808A (en) 1981-02-17
GB2063569A (en) 1981-06-03
DK489380A (da) 1981-05-16
MX148678A (es) 1983-05-27
DK158686B (da) 1990-07-02
AU530083B2 (en) 1983-06-30

Similar Documents

Publication Publication Date Title
FR2470976A1 (fr) Antennes blindees a boucles equilibrees pour systemes electroniques de securite
FR2427697A1 (fr) Antenne pour installation de detection de vol de marchandises
US2419480A (en) Loop antenna shield
GB1145507A (en) Dipole aerial
Nabighian Quasi-static transient response of a conducting permeable sphere in a dipolar field
FR2404977A1 (fr) Circuit de traitement d&#39;un signal de television
GB419783A (en) Improvements in and relating to wireless receiving apparatus
DE727938C (de) Rahmenantenne
US2078246A (en) Short wave shield
US2005779A (en) Directive aerial system
JPS5496389A (en) Radar device
GB1035592A (en) An improved printed circuit panel and a method of making same
ES168320U (es) Antena multidireccional.
US2204406A (en) Directional antenna
US1938624A (en) Direction finder
ALABIN et al. The use of space and aerial imagery in metallogeny/with the Altai-Sayan fold belt considered as an example
Rao et al. Model results for a dipole? dipole transient electromagnetic technique
Cox et al. HB 1021, Appropriation to Assess Effects of Electromagnetic Radiation at Lualualei-Statement for House Committee on Health Public Hearing, 24 February 1983
SU2846A1 (ru) Приемна радиосеть
GB556324A (en) Improvements in or relating to antenna systems
JPS57135532A (en) Diversity receiver
Levie Challenge of Public and Private Sector Cooperation: A Summary
AT28644B (de) Empfänger für Wellentelegraphie.
DE1756033C1 (de) Unterwasserkampfmittel,insbesondere Seemine,mit aeusserlich angebrachten elektrischen Spulenwicklungen zum drahtlosen Empfang von Stromliniensignalen
DE429480C (de) Einrichtung zur Beseitigung von Stoerungen bei drahtloser Nachrichtenuebermittlung

Legal Events

Date Code Title Description
ST Notification of lapse