EP4013774A1 - Engineered interleukin-2 receptor beta agonists - Google Patents

Engineered interleukin-2 receptor beta agonists

Info

Publication number
EP4013774A1
EP4013774A1 EP20761980.0A EP20761980A EP4013774A1 EP 4013774 A1 EP4013774 A1 EP 4013774A1 EP 20761980 A EP20761980 A EP 20761980A EP 4013774 A1 EP4013774 A1 EP 4013774A1
Authority
EP
European Patent Office
Prior art keywords
engineered
polypeptide
seq
substitution
residue
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP20761980.0A
Other languages
German (de)
English (en)
French (fr)
Inventor
Yan Chen
Kehao Zhao
Christina SWANSON
Jenna NGUYEN
Nathan KALLEN
Samuel Clement HASSAN
Ning Jiang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Elpis Biopharmaceuticals Corp
Original Assignee
Elpis Biopharmaceuticals Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Elpis Biopharmaceuticals Corp filed Critical Elpis Biopharmaceuticals Corp
Publication of EP4013774A1 publication Critical patent/EP4013774A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • Interleukin-2 is a cytokine that modulates lymphocyte proliferation and activation. It has a length of 133 amino acids and the structure includes four antiparallel, amphipathic C-helices. IL2 mediates its action by binding to IL2 receptors (IL2R), which includes up to three individual subunits. Association of all three subunits, the interleukin-2 receptor alpha chain (IL2Ra, or CD25), interleukin-2 receptor beta chain (IL2Rb, or CD122), and interluekin-2 receptor gamma chain (IL2Rg, or CD132), results in a trimeric IL2Rabg, which is a high-affinity receptor for IL2.
  • IL2Ra interleukin-2 receptor alpha chain
  • IL2Rb interleukin-2 receptor beta chain
  • IL2Rg interluekin-2 receptor gamma chain
  • IL2Rb and IL2Rg subunits results in the dimeric receptor IL2Rbg, and is termed an intermediate affinity IL2R.
  • the IL2Ra subunit forms a monomeric low affinity IL2 receptor.
  • Expression of IL2Ra is involved in the expansion of immunosuppressive regulatory T cells (Tregs); whereas dimeric IL2Rbg can result in cytolytic CD8 + T cell and NK cell proliferation and killing in the absence of IL2Ra.
  • Regs immunosuppressive regulatory T cells
  • dimeric IL2Rbg can result in cytolytic CD8 + T cell and NK cell proliferation and killing in the absence of IL2Ra.
  • BRIEF SUMMARY The present disclosure provides engineered IL2 polypeptides having improved binding to IL2Rb as compared to wild-type IL2 and/or reduced binding to IL2Ra as compared to wild-type IL2.
  • the present disclosure provides an engineered interleukin- 2 (IL2) polypeptide comprising an engineered IL2 receptor b (IL2Rb) binding region 2 comprising: X 1 - X 2 - X 3 -D-X 4 -X -5 -X 6 -N-X 7 - X 8 -X 9 - X 10 - X 11 -X 12 -X 13 (SEQ ID NO: 1), wherein X 1 , X 3 , X 6, X 8 , X 12 , and X 13 each comprise any residue, wherein X 2 , X 4 , and X 10 are uncharged residues, wherein X 5 , X 7 , X 9 , and X 11 each comprise uncharged, nonpolar residues, and wherein the engineered IL2 polypeptide binds to IL2Rb at a K D at least 10-fold greater than a wild-type IL2.
  • IL2Rb engineered IL2 receptor
  • X 1 is an uncharged polar residue, an uncharged nonpolar residue, a basic residue, or an acidic residue; X 1 is selected from C, T, G, W, I, S, E, and K; or X 1 is selected from G, K, E, C, and T.
  • X 2 is an uncharged polar residue or an uncharged nonpolar residue; X 2 is selected from Y, P, V, W, L, A, and G; or X 2 is selected from V, P, W, and A.
  • X 3 is an uncharged polar residue, an uncharged nonpolar residue, a basic residue, or an acidic residue; X 3 is selected from S, T, Q, G, M, E, R, and K; or X 3 is selected from T, G, S, R, and E.
  • X 4 is not L; X 4 is an uncharged nonpolar residue or an uncharged polar residue; or X 4 is selected from A, V, S, and T.
  • X 5 is selected from I, L,T, and V; or X 5 is selected from I and V.
  • X 6 is an uncharged polar residue, a basic residue, or an acidic residue; X 6 is selected from S, T, E, D, and R; or X 6 is selected from S, D, E, and T.
  • X 7 is selected from I, A, M, and V; or X 7 is selected from I, A, and M.
  • X 8 is an uncharged polar residue, an uncharged nonpolar residue, a basic residue, or an acidic residue; X 8 is selected from S, T, N, Q, I, G, E, K, and R; or X 8 is selected from I, R, N, and T.
  • X 9 is selected from V, L, and I; or X 9 is V.
  • X 10 is an uncharged polar residue or an uncharged nonpolar residue; X 10 is selected from N, T, I, and L; or X 10 is selected from I and L.
  • X 11 is a uncharged nonpolar residue; or X 11 is selected from V, A, and I.
  • X 12 is an uncharged polar residue, an uncharged nonpolar residue, or an acidic residue; X 12 is selected from Q, L, G, K, and R; or X 12 is selected from R, G, Q, and K.
  • X 13 is an uncharged nonpolar residue or a basic residue; X 13 is selected from A, D, and E; or X 13 is selected from E and A.
  • the present disclosure provides an engineered IL2 polypeptide comprising a substitution to at least one residue selected from: R81, P82, R83, L85, I86, S87, I89, N90, I92, V93, and L94.
  • the R81 substitution is selected from R81G, R81K, R81E, R81C, and R81T; the R83 substitution is selected from R83T, R83G, R83S, and R83E; the L85 substitution is selected from L85S, L85A, L85V, and L85T; the I92 substitution is I92L; and the L94 substitution is selected from L94R, L94G, L94Q, and L94K.
  • the engineered IL2 polypeptide comprises substitutions to R81 and L83.
  • the engineered IL2 polypeptide comprises substitutions to R81, L83, S87, N90, and N94; substitutions to R81, L83, S87, N90, and V93; substitutions to R81, L83, P82, and V93; or substitutions to R81, L83, and N90.
  • the present disclosure provides an engineered interleukin- 2 (IL2) polypeptide comprising an engineered IL2 receptor a (IL2Ra) binding region 1 motif.
  • IL2Ra engineered IL2 receptor a
  • the present disclosure provides an engineered IL2 polypeptide including an engineered IL2 receptor b (IL2Rb) binding region 2 as previously described and an engineered IL2 receptor a (IL2Ra) binding region 1 as previously described.
  • the present disclosure provides an engineered IL2 polypeptide as provided herein, fused to a half-life extending molecule.
  • the present disclosure provides a fusion polypeptide comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an engineered IL2 polypeptide as provided herein.
  • the present disclosure provides an isolated polynucleotide encoding an engineered IL2 polypeptide or a fusion polypeptide thereof, an expression vector comprising the isolated polynucleotide, or a modified cell comprising the isolated polynucleotide or expression vector.
  • the present disclosure provides a pharmaceutical composition comprising the engineered IL2 polypeptide or fusion polypeptide thereof, and a pharmaceutically acceptable carrier.
  • the present disclosure provides a method of modulating an immune response in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an engineered IL2 polypeptide or fusion polypeptide thereof, or a pharmaceutical composition thereof.
  • modulating the immune response comprises at least one of: enhancing effector T cell activity, enhancing NK cell activity, and suppressing regulatory T cell activity.
  • the present disclosure provides a method of treating a disease in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an engineered IL2 polypeptide or fusion polypeptide thereof, or a pharmaceutical composition thereof.
  • the disease is cancer.
  • the method further comprises administering an additional therapeutic agent, such as an antigen binding moiety, an immune cell expressing a chimeric antigen receptor, an immune cells expressing an engineered T cell receptor, a tumor infiltrating lymphocyte, an immune checkpoint inhibitor, an oncolytic virus, a tumor microenvironment (TME) inhibitor, or a cancer vaccine.
  • an additional therapeutic agent such as an antigen binding moiety, an immune cell expressing a chimeric antigen receptor, an immune cells expressing an engineered T cell receptor, a tumor infiltrating lymphocyte, an immune checkpoint inhibitor, an oncolytic virus, a tumor microenvironment (TME) inhibitor, or a cancer vaccine.
  • the methods comprise administering to the subject an immune cell comprising a polynucleotide encoding the engineered IL2 polypeptide or fusion polypeptide thereof.
  • Fig.1A shows the regions of IL2 responsible for binding IL2Ra (solid open boxes), IL2Rb (dashed boxes), and IL2Rg (gray boxes)
  • Fig.1B shows a graphic depiction of IL2Ra, IL2Rb, and IL2Rg bound to IL2
  • Fig.1C shows the IL2Ra binding site of IL2 highlighting four residues (K35, R38, F42 and Y45) of IL2 critical for IL2Ra interaction.
  • Figs.2A-2B show the identification of IL2Ra reduced binding mutations by ELISA.
  • Fig.3 shows characterization of IL2Ra-reduced binding mutations by surface plasmon resonance sequence alignments of IL2Ra reduced binding mutations.
  • Fig.4 shows characterization of IL2Ra-reduced binding mutations by surface plasmon resonance.
  • Fig.5 shows the IL2Rb agonist mutagenic libraries
  • Fig.6 shows IL2Rb agonist expression in E.coli and binding to IL2Rb.
  • Fig.7 shows a multiple sequence alignment of the IL2Rb binding region 2 for IL2Rb agonists identified through mRNA display.
  • Fig.8 shows SDS analysis of IL2Rb agonist clones produced in E. coli.
  • Figs.9A-9B show sensorgrams and binding kinetics of wild-type IL2 to IL2Ra (Fig.9A) and IL2Rb (Fig.9B) in SPR.
  • Figs.10A-10H show sensorgrams of E. coli produced wild-type IL2 and engineered IL2Rb agonists to IL2Ra in SPR.
  • Fig.10A shows a sensorgram of wild-type IL2;
  • Fig.10B shows a sensorgram of EP001;
  • Fig.10C shows a sensorgram of EP004;
  • Fig.10D shows a sensorgram of EP005;
  • Fig.10E shows a sensorgram of EP002;
  • Fig.10A shows a sensorgram of wild-type IL2;
  • Fig.10B shows a sensorgram of EP001;
  • Fig.10C shows a sensorgram of EP004;
  • Fig.10D shows a sensorgram of EP00
  • FIG. 10F shows a sensorgram of EP03
  • Fig.10G shows a sensorgram of EPIM-06
  • Fig. 10H shows a sensorgram of EP007.
  • Figs.11A-11H show sensorgrams of E. coli produced wild-type IL2 and engineered IL2Rb agonists to IL2Rb in SPR.
  • Fig.11A shows a sensorgram of EP003
  • Fig.11B shows a sensorgram of EP005
  • Fig.11C shows a sensorgram of E002; Fig.
  • Figs.12A-12D show sensorgrams of IL2Rb binding to mammalian produced wild-type IL2 (Fig.12A) and engineered IL2Rb agonists EP0001 (Fig.12B), EP0003 (Fig.12C), and EP004 (Fig.12D) in SPR.
  • Figs.13A-13D show sensorgrams of IL2Ra binding to mammalian produced wild-type IL2 (Fig.13A) and engineered IL2Rb agonists EP001 (Fig.13B), EP003 (Fig.13C), and EP004 (Fig.13D) in SPR.
  • Figs.14A-14I show pSTAT5 expression as measured from blood donors 1-3, following stimulation of human PBMCs with wild-type IL2 and engineered IL2Rb agonists, as measured for CD8+ T cells (Fig.14A for blood donor 1, Fig.14D for blood donor 2, and Fig.14G for blood donor 3), NK cells (Fig.14B for blood donor 1, Fig.14E for blood donor 2, and Fig.14H for blood donor 3), and T regs (Fig.14C for blood donor 1, Fig.14F for blood donor 2, and Fig.14I for blood donor 3).
  • Figs.15A-15B show characterization by ELISA of IL2Rb agonist EP001 back-mutation clones for binding to IL2Ra (Fig.15A) and IL2Rb (Fig 15B) by ELISA.
  • Figs.16A-16H show IL2Rb binding sensorgrams of IL2Rb agonist EP001 back-mutation clones by SPR.
  • Fig.17 shows examples of SDS-PAGE results for purified clones of IL2Ra/IL2Rb clones.
  • Figs.18A-18H show binding sensorgrams of engineered IL2Ra/IL2Rb clones to human IL2a by SPR.
  • Figs.19A-19H show binding sensorgrams of engineered IL2Ra/IL2Rb clones to human IL2b by SPR.
  • Figs.20A-20G show single concentration binding sensorgrams of engineered IL2Ra/IL2Rb clones to human IL2Ra by SPR.
  • Figs.21A-21G show single concentration binding of engineered IL2Ra/IL2Rb clones to human IL2Rb by SPR.
  • Figs.22A-22B show multi-concentration binding of engineered IL2Ra/IL2Rb clones to human IL2Ra (Fig.22A) and IL2Rb (Fig.22B) by SPR.
  • Figs.23A-23E show ELISA binding to human IL2Ra.
  • Fig.23A shows the ELISA binding of EP252 and its IL2Ra binding reduced mutations to human IL2Ra.
  • Fig.23B shows the ELISA binding of EP253 and its IL2Ra binding reduced mutations to human IL2Ra.
  • Fig.23C shows the ELISA binding of EP258 and its IL2Ra binding reduced mutations to human IL2Ra.
  • Fig.23D shows the ELISA binding of EP260 and its IL2Ra binding reduced mutations to human IL2Ra.
  • Fig.23E shows dose dependent binding for selected engineered IL2Rb/IL2Ra clones.
  • Figs.24A-24D show ELISA binding to human IL2Rb.
  • Fig.24A shows the ELISA binding of EP252 and its IL2Ra binding reduced mutations to human IL2Rb.
  • Fig.24B shows the ELISA binding of EP253 and its IL2Ra binding reduced mutations to human IL2Rb.
  • Fig.24C shows the ELISA binding of EP258 and its IL2Ra binding reduced mutations to human IL2Rb.
  • Fig.24D shows the ELISA binding of EP260 and its IL2Ra binding reduced mutations to human IL2Rb.
  • Figs.25A-25D show p-STAT5 activation of human CD8+ T cells from donor 656, by engineered IL2Ra/IL2Rb clones.
  • Fig.25A shows p-STAT5 activation of human CD8+ T cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.25B shows p-STAT5 activation of human CD8+ T cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.25C shows p-STAT5 activation of human CD8+ T cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.25D shows p-STAT5 activation of human CD8+ T cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.26A-26D show p-STAT5 activation of human CD8+ T cells from donor 648, by engineered IL2Ra/IL2Rb clones.
  • Fig.26A shows p-STAT5 activation of human CD8+ T cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.26B shows p-STAT5 activation of human CD8+ T cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.26C shows p-STAT5 activation of human CD8+ T cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.26D shows p-STAT5 activation of human CD8+ T cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.27A-27D show p-STAT5 activation of human NK cells from donor 656, by engineered IL2Ra/IL2Rb clones.
  • Fig.27A shows p-STAT5 activation of human NK cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.25B shows p-STAT5 activation of human NK cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.27C shows p-STAT5 activation of human NK cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.27D shows p-STAT5 activation of human NK cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.28A-28D show p-STAT5 activation of human NK cells from donor 648, by engineered IL2Ra/IL2Rb clones.
  • Fig.28A shows p-STAT5 activation of human NK cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.28B shows p-STAT5 activation of human NK cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.28C shows p-STAT5 activation of human NK cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.28D shows p-STAT5 activation of human NK cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.29A-29D show p-STAT5 activation of human T reg cells from donor 656, by engineered IL2Ra/IL2Rb clones.
  • Fig.29A shows p-STAT5 activation of human T reg cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.29B shows p-STAT5 activation of human T reg cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.29C shows p-STAT5 activation of human T reg cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.29D shows p-STAT5 activation of human T reg cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.30A-30D show p-STAT5 activation of human T reg cells from donor 648, by engineered IL2Ra/IL2Rb clones.
  • Fig.30A shows p-STAT5 activation of human T reg cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.30B shows p-STAT5 activation of human T reg cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.30C shows p-STAT5 activation of human T reg cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.30D shows p-STAT5 activation of human T reg cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.31A-31D show p-STAT5 activation of murine CD8+ T cells.
  • Fig. 31A shows p-STAT5 activation of murine CD8+ T cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.31B shows p-STAT5 activation of murine CD8+ T cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.31C shows p-STAT5 activation of murine CD8+ T cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.31D shows p-STAT5 activation of murine CD8+ T cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.32A-32D show p-STAT5 activation of murine NK cells.
  • Fig.32A shows p-STAT5 activation of murine NK cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.32B shows p-STAT5 activation of murine NK cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.32C shows p-STAT5 activation of murine NK cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.32D shows p-STAT5 activation of murine NK cells for EP260 and its IL2Ra binding reduced mutations.
  • Figs.33A-33D show p-STAT5 activation of murine T regulatory cells.
  • Fig.33A shows p-STAT5 activation of murine T regulatory cells for EP252 and its IL2Ra binding reduced mutations.
  • Fig.33B shows p-STAT5 activation of murine T regulatory cells for EP253 and its IL2Ra binding reduced mutations.
  • Fig.33C shows p- STAT5 activation of murine T regulatory cells for EP258 and its IL2Ra binding reduced mutations.
  • Fig.33D shows p-STAT5 activation of murine T regulatory cells for EP260 and its IL2Ra binding reduced mutations.
  • Fig.34 shows a summary of p-STAT5 activation of murine CD8+ T cells, NK cells, and Tregs.
  • Figs.35A-35C show structure diagrams of monovalent and bivalent IL2Rb agonist Fc fusion proteins.
  • Figs.36A-36B show SDS-PAGE analysis of the purified IL2Rb agonist Fc fusion proteins.
  • Figs.37A-37G show receptor binding analysis by ELISA of bivalent IL2Rb agonist Fc fusion proteins.
  • Figs.38A-38B show receptor binding analysis by ELISA of monovalent IL2Rb agonist Fc fusion proteins.
  • Figs.39A-39D show receptor binding analysis of monovalent IL2Rb Fc fusion proteins by SPR.
  • Figs.40A-40C show p-STAT5 activation of human PBMCs by bivalent IL2Rb agonist Fc-fusion proteins.
  • Figs.41A-41C show p-STAT5 activation of human PBMCs by monovalent IL2Rb agonist Fc-fusion proteins.
  • Figs.42A-42B show pharmacokinetics with murine i.v. (Fig.42A) and i.p.
  • Fig.42B administration of IL2Rb agonist.
  • Figs.43A-43D show normalized counts of tumor infiltrating immune cells following administration of IL2Rb agonist.
  • Figs.44A-44B show ratios of effector cells to T regulatory cell in tumors.
  • Figs.45A-45C show percentages of effector and memory T cells.
  • DETAILED DESCRIPTION IL2 has been a promising new immunotherapy, but therapies based on wild-type human IL2 may activate T regulatory cells in addition to activating effector T cells and NK cells. Activation of T regulatory cells by IL2 may hamper the anti-cancer response that may otherwise be elicited by IL2.
  • IL2-based therapies with reduced activation of T regulatory cells and/or preferential activation of T effector cells, NK cells, or a combination thereof are needed.
  • IL2Rb agonists which are engineered IL2 polypeptides having amino acid substitutions in IL2Rb binding region 2 that enhance binding to IL2Rb.
  • the engineered IL2Rb agonists provide the advantage of increasing stimulation of NK cells and T effector cells compared to wild-type IL2, but not T regulatory cells.
  • the engineered IL2Rb agonists are useful for modulating or activating an immune response, for example, for treatment of cancer.
  • IL2 refers to an IL2 from any vertebrate source, including mammals such humans or mice, unless otherwise indicated.
  • the term encompasses precursor or unprocessed IL2, as well as any form of IL2 that results from cellular processing.
  • the term also encompasses naturally occurring variants of IL2, such as splice variants or allelic variants.
  • the amino acid sequence of an example mature human IL2 is shown in SEQ ID NO: 65.
  • Precursor or unprocessed human IL2 is shown in SEQ ID NO: 66, and includes a 20-residue signal peptide, which is absent in the mature IL2 polypeptide.
  • Wild-type or “native” when used in reference to IL2 is intended to mean the mature IL2 molecule (e.g., SEQ ID NO: 65).
  • engineered IL2 or “engineered IL2 polypeptide” as used herein encompasses an IL2 having at least one residue that differs from a native or wild-type IL2, and includes full-length IL2, truncated forms of IL2, and forms where IL2 is linked or fused with another molecule, such as another polypeptide.
  • the various forms of engineered IL2 are characterized in having at least one amino acid substitution affecting the interaction of IL2 with IL2Rb and/or IL2Ra.
  • IL2Rb binding region 1 and IL2Rb binding region 2 are responsible for IL2 binding to IL2Rb.
  • IL2Rb binding region 1 refers to residues 11-23 of wild-type or native human IL2. The amino acid sequence of IL2Rb binding region 1 is provided in SEQ ID NO: 67.
  • IL2Rb binding region 2 refers to residues 81-95 of wild-type or native human IL2.
  • the amino acid sequence of IL2Rb binding region 2 is provided in SEQ ID NO: 68.
  • IL2Ra binding region 1 and IL2Ra binding region 2 are responsible for IL2 binding to IL2Ra.
  • IL2Ra binding region 1 refers to residues 34-45 of wild-type or native human IL2.
  • the amino acid sequence of IL2Ra binding region 1 is provided in SEQ ID NO: 223.
  • substitution or “residue substitution” as used herein refers to replacement of a native or wild-type residue with a different residue.
  • Any residue refers to an amino acid residue having one of the twenty canonical amino acid side chains: alanine (Ala, A); arginine (Arg, R); asparagine (Asn, N); aspartic acid (Asp, D); cysteine (Cys, C); glutamine (Gln, Q); glutamic acid (Glu, E); glycine (Gly, G); histidine (His, H); isoleucine (Ile, I); leucine (Leu, L); lysine (Lys, K); methionine (Met, M); phenylalanine (Phe, F); proline (Pro, P); serine (Ser, S); threonine (Thr, T); tryptophan (Trp, W); tyrosine (Tyr, Y); and valine (Val, V).
  • alanine Al, A
  • arginine Arg, R
  • asparagine Asn, N
  • aspartic acid
  • the uncharged residues are: alanine (Ala, A); asparagine (Asn, N); cysteine (Cys, C); glutamine (Gln, Q); glycine (Gly,G); histidine (His, H); isoleucine (Ile, I); leucine (Leu, L); methionine (Met, M); phenylalanine (Phe, F) ; proline (Pro, P); serine (Ser, S); threonine (Thr, T); tryptophan (Trp, W); tyrosine (Tyr, Y); and valine (Val, V).
  • the uncharged polar residues are: asparagine (Asn, N); cysteine (Cys, C); glutamine (Gln, Q); serine (Ser, S); threonine (Thr, T); and tyrosine (Tyr, Y).
  • the uncharged nonpolar residues are: alanine (Ala, A); glycine (Gly, G); histidine (His, H); isoleucine (Ile, I); leucine (Leu, L); methionine (Met, M); phenylalanine (Phe, F); proline (Pro, P); tryptophan (Trp, W); and valine (Val, V).
  • the basic residues are lysine (Lys, K); and arginine (Arg, R).
  • the acidic residues are aspartic acid (Asp, D); and glutamic acid (Glu, E).
  • Fusion polypeptide or “fusion protein” refers to a polypeptide that is encoded by at least two different DNA sequences corresponding to genes or fragments thereof, which are not naturally expressed from the same gene.
  • An example of a fusion polypeptide is an engineered IL2-Fc fusion polypeptide, which includes an amino acid sequence of an engineered IL2 polypeptide and an amino acid sequence of an Fc domain.
  • Binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., receptor and a ligand).
  • the affinity of a molecule-X for its partner Y can generally be represented by the dissociation constant (K D ), which is the ratio of dissociation and association rate constants (koff and kon, respectively).
  • K D dissociation constant
  • equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same.
  • Half-life extending molecule refers to a molecule that when attached (e.g., covalently) to a second molecule, extends the half-life of the second molecule.
  • Examples of half-life extending molecules include an Fc domain, human serum albumin (HSA), an HSA binding molecule, polyethylene glycol (PEG), and polypropylene glycol (PPG).
  • Fc domain or “Fc region” as used herein refers to a polypeptide derived from a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes polypeptides having a native sequence Fc region, or variants thereof.
  • the human IgG heavy chain Fc region is usually defined to extend from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present. Examples of Fc regions are disclosed in US Patent No.7,317,091; US Patent No.8,735,545; US Patent No.7,371,826; US Patent No.7,670,600; and US 9,803,023; all of which are incorporated by reference in their entirety.
  • HSA Human serum albumin
  • the commonly used form of HSA has a molecular mass of 66.5kDa and a half-life of approximately 20 days. Examples of HSA molecules are disclosed in US Patent No.8,143,026 and US Patent No.7,189,690, which are incorporated by reference in their entirety.
  • HSA binding molecule refers to a molecule that specifically binds to human serum albumin (HSA), such as an antigen binding moiety having an HSA binding domain.
  • Polyethylene glycol” or “PEG,” also referred to as polyethylene oxide or polyoxyethylene is a polyether polymer that may be used to extend half-life.
  • Polypropylene glycol or “PPG,” also referred to as polypropylene oxide, is a polymer of propylene glycol that may be used to extend half-life.
  • Antigen binding moiety refers to the site (i.e., amino acid residues) of an antigen binding molecule (e.g., antibody) that provides interaction with the antigen epitope.
  • An antigen binding moiety may include one or more antibody variable domains (also called antibody variable regions).
  • an antigen binding domain comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
  • antigen binding moieties include immunoglobulins, Fab molecules, scFv, bispecific antibodies, diabodies, bi-specific T-cell engagers, and nanobodies.
  • antigen binding moieties include nivolumab, pembrolizumab, pidilizumab, atezolizumab, ipilimumab, tremelimumab, rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab tiuxetan, tositumomab, ublituximab, and bevacizumab.
  • immunoglobulin refers to a protein having the structure of a naturally occurring antibody.
  • immunoglobulins of the IgG class are heterotetrameric glycoproteins with two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, the heavy chains each have a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3), also called a heavy chain constant region.
  • VH variable region
  • CH1, CH2, and CH3 constant domains
  • light chain each have a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain, also called a light chain constant region.
  • the heavy chain of an immunoglobulin may be assigned to one of five classes, called a (IgA), d (IgD), e (IgE), g (IgG), or m (IgM), some of which may be further divided into subclasses, e.g., g1 (IgG1), g2 (IgG2), g3 (IgG3), g4 (IgG4), a1 (IgA1) and a2 (IgA2).
  • the light chain of an immunoglobulin may be assigned to one of two types, called kappa (k) and lambda (l), based on the sequence of its constant domain.
  • An immunoglobulin includes two Fab molecules and an Fc domain, linked via the immunoglobulin hinge region.
  • Fab molecule or “antigen binding fragment” is an antigen binding fragment of an antibody that includes the variable domain and constant domain of a light chain, and a variable domain and a CH1 domain of a heavy chain.
  • Single chain variable domain or “scFv” refers to an antigen binding moiety that includes variable regions of a heavy chain and light chain, which are linked by a linker peptide.
  • Bispecific antibody refers to an artificial antibody with two different antigen binding sites.
  • Bispecific antibody can refer to a full immunoglobulin protein with two different antigen binding sites, or can refer to other molecules having two antigen binding moieties, such as a fusion protein including two Fabs or two scFvs.
  • “Diabody” refers to a class of antigen binding molecules that are bivalent and bispecific. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) on the same polypeptide chain (VH- VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • Bi-specific T-cell engager refers to a class of bispecific antibodies having a first antigen binding moiety that binds to a T cell (e.g., by binding CD3), and a second antigen binding moiety that binds a different antigen (e.g., a tumor antigen).
  • “Nanobody” or “single domain antibody” refers to an antigen binding moiety that consists of a single monomeric variable antibody domain.
  • Transferrin is an iron transporter protein that may be used in a fusion protein to extend half-life. Human transferrin has a half-life of 12 days in serum.
  • Cytoke refers to a class of small ( ⁇ 25kDa) proteins that are involved in cell signaling and immunomodulation. Cytokines include, for example, IL2, interleukin-10 (IL-10), interleukin-1 (IL-1), interleukin-17 (IL-17), interleukin-18 (IL-18), interferon a, interferon b, interferon g, TGF-b1, TGF-b2, and TGF-b3, chemokine (C-C motif) ligand 2 (CCL2), and chemokine (C-C motif) ligand 19 (CCL19).
  • IL2 interleukin-10
  • IL-17 interleukin-17
  • IL-18 interleukin-18
  • interferon a interferon b
  • interferon g interferon g
  • TGF-b1, TGF-b2, and TGF-b3 chemokine (C-C motif) ligand 2 (CCL2)
  • C-C motif chemokine
  • Mammals include but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., human and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
  • domesticated animals e.g., cows, sheep, cats, dogs, and horses
  • primates e.g., human and non-human primates such as monkeys
  • rabbits e.g., mice and rats
  • rodents e.g., mice and rats.
  • the subject is a human.
  • Modulating an immune response may include one or more of a general increase, an increase in T effector cell response (e.g., cytotoxicity against tumor cells and virus infected cells), an increase in B cell activation, restoration of lymphocyte activation and proliferation, an increase in the expression of IL2 receptors, an increase in T cell responsiveness, an increase in natural killer cell activity or lymphokine- activated killer (LAK) cell activity, a decrease in regulatory T cells response to other T cells, and the like.
  • Regulatory T cell or “Treg cell” refers to a specialized type of CD4+ T cell that can function to suppress the responses of other T cells.
  • Treg cells express the a-subunit of the IL2 receptor (CD25) and the transcription factor forkhead box P3 (FOXP3) (Sakaguchi, Annu Rev Immunol 22, 531-62 (2004)), and are involved in the induction and maintenance of peripheral self-tolerance to antigens, including those expressed by tumors. Treg cells require IL2 for their function and development and induction of their suppressive characteristics.
  • T effector cells refers to a population of T cells that respond to stimulus, such as IL2. T effector cells include CD8+ cytotoxic T cells and CD4+ helper T cells. As used herein, T effector cell does not include a T regulatory cell.
  • NK cells Natural Killer cells
  • NK cells are a component of the innate immune system and are cytotoxic lymphocytes that play a major role in rejection of tumors and virus infected cells.
  • Treatment refers to medical management of a condition, disease, or disorder of a subject (e.g., patient), which may be therapeutic, prophylactic/preventative, or a combination treatment thereof.
  • An “effective amount” or a “therapeutically effective amount” may refer to an amount of therapeutic agent (e.g., an engineered IL2 polypeptide or engineered IL2 fusion polypeptide described herein) that provides a desired physiological change, such as an anti-cancer effect.
  • the desired physiological change may, for example, be a decrease in symptoms of a disease, or a decrease in severity of a disease, or may be a reduction in the progression of a disease.
  • the desired physiological changes may include, for example, tumor regression, a decreased rate of tumor progression, a reduced level of a cancer biomarker, reduced symptoms associated with cancer, a prevention or delay in metastasis, or clinical remission.
  • Checkpoint inhibitor refers to an agent that reduces the activity of an immune checkpoint protein.
  • a checkpoint inhibitor can be an antigen binding moiety that binds to and reduces activity of an immune checkpoint protein.
  • Immune checkpoint proteins include, for example, programmed cell death protein 1 (PD-1 or CD279), programmed death-ligand 1 (PD-L1 or CD274), cytotoxic T-lymphocyte–associated antigen 4 (CTLA-4 or CD152), T-cell immunoglobulin mucin-3 (TIM3), Lymphocyte Activating 3 (LAG3 or CD223), B7-H2 (ICOSL or CD275), and B7-H3 (CD276).
  • checkpoint inhibitors includes ipilimumab (an anti-CTLA-4 antibody), nivolumab (an anti-PD-1 antibody), and pembrolizumab (an anti-PD-1 antibody).
  • cancer antigen refers to a molecule that is preferentially expressed by cancer cells.
  • cancer antigens include CD19, CD20, ROR1, fibroblast activation protein-a, and carcinoembryonic antigen (CEA).
  • Oncolytic virus refers to a virus that preferentially infects and kills cancer cells. For example oncolytic herpes viruses have been engineered to delete ICP34.5, resulting in a virus that only replicates in cancer (not healthy cells).
  • An example of an oncolytic virus is Talimogene laherparepvec, which is used to treat melanoma.
  • Cancer vaccine refers to a vaccine that presents a cancer epitope to the immune system to elicit an anti-cancer response from the immune system.
  • sipuleucel-T is a vaccine for metastatic prostate cancer, which targets the immune response to the prostate cancer antigen prostatic acid phosphatase (PAP).
  • PAP prostate cancer antigen prostatic acid phosphatase
  • Chimeric antigen receptors” or “CARs” are engineered antigen binding receptors that, when expressed in certain types of immune cells, activate the immune cell upon antigen binding.
  • CARs typically include an extracellular domain comprising an antigen binding moiety (e.g., an scFv), a transmembrane domain, and an intracellular immune signaling domain (e.g., including signaling domains from CD3z, 4-1BB, and/or CD28).
  • CARs may be expressed, for example, by T cells or NK cells, and may include an antigen binding moiety that targets a cancer antigen, such as CD19 or ROR1.
  • Tumor infiltrating lymphocyte refers to a lymphocyte that is isolated from tumor tissue, manipulated in vitro (e.g., stimulated using a cytokine such as interleukin-2), and then infused back into a patient so that the activating TIL returns to the tumor site and induces tumor regression.
  • Tuor microenvironment inhibitor refers to an agent that inhibits one or more conditions or cell types that promote tumor growth and are present in the local environment surrounding a tumor. For example, bevacizumab can inhibit the tumor microenvironment by reducing angiogenesis in a tumor microenvironment.
  • the term “about” means ⁇ 20% of the indicated range, value, or structure, unless otherwise indicated.
  • IL2 polypeptides of the present disclosure include IL2Rb agonists having an engineered IL2 receptor b (IL2Rb) binding region 2.
  • the binding region 2 comprises: X 1 -X 2 -X 3 -D-X 4 -X 5 -X 6 -N-X 7 -X 8 -X 9 -X 10 -X 11 -X 12 -X 13 (SEQ ID NO: 1), wherein X 1 , X 3 , X 6 , X 8 , X 12 , and X 13 each comprise any residue, wherein X 2 , X 4 , and X 10 are uncharged residues, and wherein X 5 , X 7 , X 9 , and X 11 each comprise uncharged, nonpolar residues.
  • the engineered IL2 polypeptide has the amino acid sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATEL KHLQCLEEELKPLEEVLNLAQSKNFHLX 1 X 2 X 3 DX 4 X 5 X 6 NX 7 X 8 X 9 X 10 X 11 X 12 X 13 L KGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT (SEQ ID NO: 22), wherein X 1 , X 3 , X 6 , X 8 , X 12 , and X 13 each comprise any residue, wherein X 2 , X 4 , and X 10 are uncharged residues, and wherein X 5 , X 7 , X 9 , and X 11 each comprise uncharged, nonpolar residues.
  • X 1 is an uncharged polar residue, an uncharged nonpolar residue, a basic residue, or an acidic residue. In some embodiments, X 1 is selected from C, T, G, W, I, S, E, and K. In some embodiments, X 1 is selected from G, K, E, C, and T. In certain embodiments, X 2 is an uncharged polar residue or an uncharged nonpolar residue. In some embodiments, X 2 is selected from Y, P, V, W, L, A, and G. In some embodiments, X 2 is selected from V, P, W, and A.
  • X 3 is an uncharged polar residue, an uncharged nonpolar residue, a basic residue, or an acidic residue. In some embodiments, X 3 is selected from S, T, Q, G, M, E, R, and K. In some embodiments, X 3 is selected from T, G, S, R, and E. In certain embodiments, X 4 is not L. In some embodiments, X 4 is an uncharged nonpolar residue or an uncharged polar residue. In some embodiments, X 4 is selected from A, V, S, and T. In certain embodiments, X 5 is selected from I, L, T, and V. In some embodiments, X 5 is selected from I and V.
  • X 6 is an uncharged polar residue, a basic residue, or an acidic residue. In some embodiments, X 6 is selected from S, T, E, D, and R. In some embodiments, X 6 is selected from S, D, E, and T. In certain embodiments, X 7 is selected from I, A, M, and V. In some embodiments, X 7 is selected from I, A, and M. In certain embodiments, X 8 is an uncharged polar residue, an uncharged nonpolar residue, a basic residue, or an acidic residue. In some embodiments, X 8 is selected from S, T, N, Q, I, G, E, K, and R.
  • X 8 is selected from I, R, N, and T.
  • X 9 is selected from V, L, and I.
  • X 9 is V.
  • X 10 is an uncharged polar residue or an uncharged nonpolar residue.
  • X 10 is selected from N, T, I, and L.
  • X 10 is selected from I and L.
  • X 11 is selected from V, A, and I.
  • X 12 is an uncharged polar residue, an uncharged nonpolar residue, or an acidic residue.
  • X 12 is selected from Q, L, G, K, and R.
  • X 12 is selected from R, G, Q, and K.
  • X 13 is an uncharged nonpolar residue or a basic residue.
  • X 13 is selected from A, D, and E.
  • X 13 is selected from E and A.
  • the IL2Rb binding region 2 is selected from: GVTDSISNAIVLARE (SEQ ID NO:2); KWGDAVSNARVLAGE (SEQ ID NO: 3); KWGDAVSNARVLAGA (SEQ ID NO:4); TLMDTTDNIGVLVRE (SEQ ID NO: 5); EPSDVISNINVLVQE (SEQ ID NO:6); SPQDSIENISVLVRE (SEQ ID NO: 7); WASDSIENITLLIQE (SEQ ID NO:8); CPTDTIENITVLIQE (SEQ ID NO: 9); RYKDSLENMQIIIQE (SEQ ID NO:10); TARDAVDNMRVIIQE (SEQ ID NO: 11); TPRDVVENMNVLVLE (SEQ ID NO:12); TPSDVIENMEVLILD (SEQ ID NO: 13); TPSDAIENINVLIRE (SEQ ID NO: 14); TPSDVIENITVLVQE (SEQ ID NO:15); GVGDTIDNINV
  • the engineered IL2Rb binding region 2 is selected from: TPRDAIDNIRVIVQE (SEQ ID NO: 213); TPRDAIDNIRVIILE (SEQ ID NO:214); TARDAISNINVIIQE (SEQ ID NO: 215); and TARDAIDNINVIVQE (SEQ ID NO: 216).
  • the engineered IL2Rb binding region 2 is selected from: GVTDSISNAIVLARE (SEQ ID NO:2); KWGDAVSNARVLAGA (SEQ ID NO:4); EPSDVISNINVLVQE (SEQ ID NO:6); CPTDTIENITVLIQE (SEQ ID NO: 9); TARDAVDNMRVIIQE (SEQ ID NO:11); GVGDTIDNINVLVKE (SEQ ID NO: 16); TAEDVVTNITVLVQE (SEQ ID NO:19).
  • the engineered IL2Rb binding region 2 is selected from: GVTDSISNAIVLARE (SEQ ID NO:2); CPTDTIENITVLIQE (SEQ ID NO: 9); and TARDAVDNMRVIIQE (SEQ ID NO:11).
  • the engineered IL2 polypeptide has an amino acid sequence of SEQ ID NO: 22.
  • the engineered IL2 polypeptide has an amino acid sequence of any one of SEQ ID NOs: 23-42.
  • the IL2Rb agonists of the present disclosure include engineered IL2 polypeptides comprising a substitution to at least one residue selected from: R81, P82, R83, L85, I86, S87, I89, N90, I92, V93, and L94, relative to SEQ ID NO: 65.
  • the at least one substitution is a substitution to residue L85.
  • the IL2 polypeptide includes substitutions to at least two residues selected from: R81, P82, R83, L85, I86, S87, I89, N90, I92, V93, and L94.
  • the at least two residues are selected from R81, R83, L85, I92, and L94.
  • the IL2 polypeptide includes substitutions to at least three residues selected from R81, R83, L85, I92, and L94.
  • the engineered IL2 polypeptide includes substitutions to R81, R83, L85, I92, and L94.
  • the R81 substitution is selected from R81G, R81K, R81E, R81C, and R81T.
  • the R83 substitution is selected from R83T, R83G, R83S, and R83E.
  • the L85 substitution is selected from L85S, L85A, L85V, and L85T.
  • the I92 substitution is I92L.
  • the L94 substitution is selected from L94R, L94G, L94Q, and L94K.
  • the engineered IL2 polypeptide comprising a substitution to at least one residue selected from: R81, P82, R83, L85, I86, S87, I89, N90, I92, V93, and L94 has an IL2Rb binding region 2 of any of SEQ ID NOs: 2-24.
  • the engineered IL2 polypeptide has increased affinity for IL2Rb as compared to the wild-type IL2.
  • the binding of the engineered IL2 polypeptide to IL2Rb has a K D at least 10-fold greater, at least 15-fold greater, at least 20-fold greater, at least 25-fold greater, or at least 30-fold greater than binding of a wild-type IL2 to IL2Rb.
  • the engineered IL2 polypeptide binds to IL2Rb with a K D at least 30-fold greater than a wild-type IL2.
  • the engineered IL2 polypeptide has at least a 10- fold increase, at least a 15-fold increase, at least a 20-fold increase, at least a 25-fold increase, or at least a 30-fold increase in affinity for IL2Rb as compared to wild-type IL2. In some embodiments, the engineered IL2 polypeptide has a decrease in affinity for IL2Ra as compared to wild-type IL2. In certain embodiments, the engineered IL2 polypeptide has at least a 5% decrease, at least a 10% decrease, at least a 15% decrease, or at least a 20% decrease in affinity for IL2Ra as compared to wild- type IL2.
  • the engineered IL2 polypeptide has a similar affinity for IL2Ra as compared to wild-type IL2. In certain embodiments, the engineered IL2 polypeptide has an affinity for IL2Ra that varies from the affinity of wild-type IL2 for IL2Ra by no more than ⁇ 20%, no more than ⁇ 15%, no more than ⁇ 10%, or no more than ⁇ 5%.
  • Some embodiments of the present disclosure provide an engineered IL2 polypeptide comprising an engineered IL2 receptor a (IL2Ra) binding region 1.
  • the engineered IL2Ra binding region 1 can comprise a substitution selected from: a substitution at position K35, a substitution at R38, a substitution at F42, a substitution at Y45, or combinations thereof.
  • the engineered IL2 polypeptide binds to IL2Ra with at least 2-fold reduced binding kinetics as compared to wild-type IL2.
  • the engineered IL2 polypeptide may comprise a substitution at position K35.
  • the substitution at position K35 comprises a non-basic residue.
  • the substitution at position K35 comprises an uncharged residue or an acidic residue.
  • the substitution at position K35 is selected from: K35G, K35L, K35S, K35V, K35D, K35E, and K35C.
  • the engineered IL2 polypeptide comprises a substitution at position R38.
  • the substitution at position R38 comprises a non-basic residue.
  • the substitution at position R38 comprises an uncharged residue or an acidic residue.
  • the substitution at position R38 is selected from: R38V, R38D, R38E, R38S, R38I, R38A, R38Y, R38G, R38C, and R38N.
  • the engineered IL2 polypeptide may comprise a substitution at position F42.
  • the substitution at position F42 comprises an uncharged residue. In some embodiments, the substitution at position F42 comprises a basic residue. In some embodiments, the substitution at position F42 is selected from: F42A, F42R, F42G, F42I, F42L, F42P and F42H. In some embodiments, the engineered IL2 polypeptide may comprise a substitution at position Y45. In some embodiments, the substitution at position Y45 comprises an uncharged residue. In some embodiments, the substitution at position Y45 comprises an uncharged polar residue or an uncharged non-polar residue.
  • the Y45 substitution is Y45S, Y45P, Y45A, Y45V, Y45C, Y45T, and Y45F.
  • the engineered IL2 polypeptide may comprise a substitution at position K35 and a substitution at position R38.
  • the engineered IL2 polypeptide comprises a K35G substitution and R38E substitution.
  • the engineered IL2 polypeptide may comprise a substitution at position K35 and a substitution at position F42.
  • the engineered IL2 polypeptide comprises a K35S substitution and an F42G substitution.
  • the engineered IL2 polypeptide may comprise a substitution at position K35, a substitution at position R38, and a substitution at position F42. In some embodiments, the engineered IL2 polypeptide comprises a K35L substitution, an R38D substitution, and an F42R substitution. In some embodiments, the engineered IL2 polypeptide may comprise a substitution at position R38 and a substitution at position Y45S. In some embodiments, the engineered IL2 polypeptide comprises an R38D substitution and an Y45S substitution. In some embodiments, the engineered IL2 polypeptide comprises an R38V substitution and an Y45S substitution.
  • the engineered IL2 polypeptide binds to IL2Ra with at least 10-fold reduced binding kinetics as compared to wild-type IL2.
  • the IL2Ra binding region 1 is selected from: PVLTRMLTIKFY (SEQ ID NO: 183); PKLTRMLTLKFP (SEQ ID NO:184); PDLTSMLAFKFY (SEQ ID NO:185); PGLTEMLTFKFY (SEQ ID NO:186); PSLTRMLTGKFY (SEQ ID NO:187); PELTIMLTPKFY (SEQ ID NO:188); PCLTAMLTLKFA (SEQ ID NO:189); PCLTAMLTLKFA (SEQ ID NO:190); PKLTRMLTHKFV (SEQ ID NO:191); PCLTDMLTFKFY (SEQ ID NO:192); PLLTDMLTRKFY (SEQ ID NO:193); PLLTDMLTFKFY (SEQ ID NO:194); PKLTD
  • the engineered IL2 polypeptide shares at least 80%, for example, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% sequence identity with the residues outside of the IL2Rb binding region 2 (i.e., residues 1-80 and 96-133) of SEQ ID NO: 22 and binds to IL2Rb.
  • the engineered IL2 polypeptide shares at least 80%, for example, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% sequence identity with the residues outside of the IL2Ra binding region 1 (i.e., residues 1-33 and 46-133) of SEQ ID NO: 223 and has reduced binding to IL2Ra and binds to IL2Rb.
  • residues outside of the IL2Ra binding region 1 i.e., residues 1-33 and 46-133
  • the engineered IL2 polypeptide shares at least 80%, for example, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% sequence identity with the residues outside of the IL2Ra binding region 1 and IL2Rb binding region 2 (i.e., residues 1-33, 46-80, 96-133) of SEQ ID NO: 22 or SEQ ID NO: 223 and has reduced binding to IL2Ra and binds to IL2Rb.
  • the present disclosure provides an engineered IL2 polypeptide including an engineered IL2Rb binding region 2 as previously described and an engineered IL2Ra binding region 1 as previously described.
  • the engineered IL2 polypeptide comprises an engineered IL2Ra binding region 1 selected from PVLTRMLTIKFY (SEQ ID NO: 183); PKLTRMLTLKFP (SEQ ID NO:184); PDLTSMLAFKFY (SEQ ID NO:185); PGLTEMLTFKFY (SEQ ID NO:186); PSLTRMLTGKFY (SEQ ID NO:187); PELTIMLTPKFY (SEQ ID NO:188); PCLTAMLTLKFA (SEQ ID NO:189); PCLTAMLTLKFA (SEQ ID NO:190); PKLTRMLTHKFV (SEQ ID NO:191); PCLTDMLTFKFY (SEQ ID NO:192); PLLTDMLTRKFY (SEQ ID NO:193); PLLTDMLTF
  • the engineered IL2 polypeptide includes an engineered IL2Rb binding region 2 selected from GVTDSISNAIVLARE (SEQ ID NO: 2); TARDAVDNMRVIIQE (SEQ ID NO: 11); TPRDAIDNIRVIVQE (SEQ ID NO: 213); TPRDAIDNIRVIILE (SEQ ID NO:214); TARDAISNINVIIQE (SEQ ID NO: 215); and TARDAIDNINVIVQE (SEQ ID NO: 216); and an engineered IL2Ra binding region 1 as previously described.
  • GVTDSISNAIVLARE SEQ ID NO: 2
  • TARDAVDNMRVIIQE SEQ ID NO: 11
  • TPRDAIDNIRVIVQE SEQ ID NO: 213
  • TPRDAIDNIRVIILE SEQ ID NO:214
  • TARDAISNINVIIQE SEQ ID NO: 215
  • TARDAIDNINVIVQE SEQ ID NO: 216
  • the engineered IL2 polypeptide is selected from any one of SEQ ID NOs: 147-170, with the C-terminal histidine tag optionally included (or excluded). In some embodiments, the C-terminal histidine tag is replaced another linker, such as a gly-ser linker.
  • Engineered IL2 fusion polypeptides Some embodiments of the present disclosure provide engineered IL2 fusion polypeptides.
  • the engineered IL2 fusion polypeptide may include an engineered IL2 polypeptide as previously described herein, and at least one additional molecule covalently attached to the engineered IL2 polypeptide via a peptide bond or other chemical linkage.
  • the at least one additional molecule of the fusion polypeptide is a half-life extending molecule.
  • the half-life extending molecule comprises a half-life extending polypeptide.
  • the half-life extending polypeptide comprises an Fc domain, human serum albumin (HSA), an HSA binding molecule, or transferrin.
  • the IL2 fusion polypeptide comprises an Fc domain.
  • the Fc domain is derived from an IgG antibody. Human IgG antibodies have several subclasses, including, but not limited to IgG1, IgG2, IgG3, and IgG4.
  • the Fc domain is derived from an IgG1 antibody or an IgG4 antibody.
  • the Fc domain has one or more substitutions that reduce effector function of the Fc domain. Examples of substitutions that reduce Fc effector function include L34A, L235A, and P329G.
  • “LALAPG” may refer to a modified Fc domain including each of L34A, L235A, and P329G.
  • the Fc domain comprises at least one amino acid residue modification to increase serum half-life. Representative modifications to the Fc domain are described in US Patent No.7,317,091; US Patent No.8,735,545; US Patent No.
  • the Fc domain is SEQ ID NO: 64.
  • the engineered IL2-Fc fusion polypeptide comprises a sequence selected from SEQ ID NOs: 39-49.
  • the at least one additional molecule of the fusion polypeptide is an antigen binding moiety.
  • the antigen binding moiety comprises an immunoglobulin, a Fab molecule, an scFv, a bi-specific T-cell engager, a diabody, a single domain antibody, or a nanobody.
  • An antigen binding moiety may bind, for example, carcinoembryonic antigen (CEA), GD2, or CD20.
  • CEA carcinoembryonic antigen
  • An example of a CEA antigen moiety is CH1A1A-2F.
  • An example of a GD-2 antigen binding moiety is dinutuximab, and an example of a CD20 antigen binding moiety is rituximab.
  • the at least one additional molecule of the fusion polypeptide is a cytokine.
  • the cytokine is selected from interleukin-2, interleukin-15, interleukin-7, interleukin-10, and C-C motif chemokine ligand 19 (CCL19).
  • the additional molecule of the fusion polypeptide is a second engineered IL2 polypeptide as described herein.
  • the half-life extending molecule comprises poly- ethylene glycol (PEG) or polypropylene glycol (PPG).
  • the fusion polypeptide is a monovalent fusion polypeptide.
  • a monovalent fusion polypeptide refers to a fusion polypeptide that has one copy of an engineered IL2 polypeptide.
  • the monovalent fusion polypeptide includes an engineered IL2 polypeptide linked to a fusion partner, such as an Fc region.
  • linker A variety of linkers are known in the art and may be used to covalently link an engineered IL2 described herein to a fusion partner, such as an Fc region.
  • linker By “linker”, “linker sequence”, herein is meant a molecule or group of molecules (such as a monomer or polymer) that connects two molecules and often serves to place the two molecules in a preferred configuration.
  • the linker may contain amino acid residues that provide flexibility.
  • the linker peptide may predominantly include the following amino acid residues: Gly, Ser, Ala, or Thr.
  • the linker peptide should have a length that is adequate to link two molecules in such a way that they assume the correct conformation relative to one another so that they retain the desired activity.
  • Suitable lengths for this purpose include at least one and not more than 30 amino acid residues.
  • the linker is from about 1 to 30 amino acids in length, with linkers of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 1819 and 20 amino acids in length being preferred.
  • Useful linkers include glycine-serine polymers (including, for example, (GS)n, (GSGGS)n (SEQ ID NO:218), (GGGGS)n (SEQ ID NO:219) and (GGGS)n (SEQ ID NO:220), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers.
  • the fusion polypeptide is a bivalent fusion polypeptide.
  • a bivalent fusion protein may refer to a molecular complex that includes two copies of engineered IL2 polypeptides, which may be of the same sequence or different sequences. The molecular complex may be bound non-covalently.
  • a bivalent fusion protein may include two Fc regions bound together non- covalently such as by one or more disulfide bridges, or by knobs-into-holes chemistry.
  • Genetic methods may include, for example, site- specific mutagenesis of the DNA sequence encoding the polypeptide, PCR, and gene synthesis.
  • the intended nucleotide changes can be verified by sequencing.
  • the nucleotide sequence of native IL2 has been described by Taniguchi et al. (Nature 302, 305-10 (1983)) and a nucleic acid encoding native human IL2 is available from, for example, American Type Culture Collection (Rockville Md.).
  • Engineered IL2 polypeptides or engineered IL2 fusion polypeptides may be obtained, for example, by recombinant production or solid-state peptide synthesis.
  • a polynucleotide encoding an engineered IL2 polypeptide or engineered IL2 fusion polypeptide can be isolated and inserted into one or more vectors for cloning and/or expression in a host cell.
  • Such polynucleotides may be readily isolated and sequenced by conventional procedures.
  • a vector, such as an expression vector, comprising one or more of the polynucleotides of the instant disclosure is provided. Methods which are well known to those skilled in the art can be used to construct expression vectors containing the coding sequence engineered IL2 polypeptide or engineered IL2 fusion polypeptide along with appropriate transcriptional/translational control signals.
  • the expression vector can be part of a plasmid, virus, or may be a nucleic acid fragment.
  • the expression vector includes an expression cassette into which the polynucleotide encoding engineered IL2 polypeptide or engineered IL2 fusion polypeptide (i.e. the coding region) is cloned in operable association with a promoter and/or other transcription or translation control elements.
  • a “coding region” is a portion of nucleic acid which consists of codons translated into amino acids.
  • a “stop codon” (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, if present, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, 5 ⁇ and 3 ⁇ untranslated regions, and the like, are not part of a coding region.
  • Two or more coding regions can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors.
  • any vector may contain a single coding region, or may comprise two or more coding regions, e.g., a vector of the disclosed herein may encode one or more polyproteins, which are post- or co- translationally separated into the final proteins via proteolytic cleavage.
  • a vector, polynucleotide, or nucleic acid of the instant disclosure may encode heterologous coding regions, either fused of unfused to a first or second polynucleotide encoding the polypeptides disclosed herein, or variant or derivative thereof.
  • Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
  • An operable association is when a coding region for a gene product, e.g., a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s).
  • Two DNA fragments (such as a polypeptide coding region and a promoter associated therewith) are “operably associated” if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
  • a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid.
  • the promoter may be a cell-specific promoter that directs substantial transcription of the DNA only in predetermined cells.
  • Other transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription. Suitable promoters and other transcription control regions are disclosed herein. A variety of transcription control regions are known to those skilled in the art.
  • transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (e.g., the immediate early promoter, in conjunction with intron-A), simian virus 40 (e.g., the early promoter), and retroviruses (e.g., Rous sarcoma virus).
  • Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit b-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells.
  • tissue-specific promoters and enhancers as well as inducible promoters (e.g., promoters inducible tetracyclins).
  • inducible promoters e.g., promoters inducible tetracyclins
  • translation control elements include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from viral systems (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
  • the expression cassette may also include other features such as an origin of replication, and/or chromosome integration elements such as retroviral long terminal repeats (LTRs), or adeno-associated viral (AAV) inverted terminal repeats (ITRs).
  • LTRs retroviral long terminal repeats
  • AAV adeno-associated viral inverted terminal repeats
  • Polynucleotide and nucleic acid coding regions of the present disclosure may be associated with additional coding regions that encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present disclosure.
  • additional coding regions that encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present disclosure.
  • DNA encoding a signal sequence may be placed upstream of the nucleic acid encoding the mature amino acids of the an engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the translated polypeptide to produce a secreted or “mature” form of the polypeptide.
  • native human IL2 is translated with a 20 amino acid signal sequence at the N- terminus of the polypeptide, which is subsequently cleaved off to produce mature, 133 amino acid human IL2.
  • the native signal peptide e.g.
  • a polynucleotide encoding the engineered IL2 polypeptide or engineered IL2 fusion polypeptide further includes a DNA sequence encoding a sequence to facilitate purification (e.g., a histidine tag) or for labeling the engineered IL2 polypeptide or engineered IL2 fusion polypeptide within or at the ends of the polynucleotide encoding the engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • a host cell comprising one or more polynucleotides encoding an engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • the host cell comprises one or more vectors encoding the engineered IL2 polypeptide or engineered IL2 fusion.
  • the host cell can be any kind of cellular system that can be used to generate the engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • Such cells may be transfected or transduced as appropriate with the particular expression vector encoding the engineered IL2 polypeptide or engineered IL2 fusion, and large quantities of vector containing cells can be grown for seeding large scale fermenters to obtain sufficient quantities of encoding the engineered IL2 polypeptide or engineered IL2 fusion for clinical applications.
  • Suitable host cells include prokaryotic microorganisms, such as E. coli, or various eukaryotic cells, such as Chinese hamster ovary cells (CHO), insect cells, or the like.
  • polypeptides may be produced in bacteria in particular when glycosylation is not needed. After expression, the polypeptide may be isolated from the bacterial cell in a soluble fraction and can be further purified.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized,” resulting in the production of a polypeptide with a partially or fully human glycosylation pattern.
  • Suitable host cells for the expression of (glycosylated) polypeptides are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts.
  • Vertebrate cells may also be used as hosts.
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • TM4 cells as described, e.g., in Mather, Biol Reprod 23, 243-251 (1980)
  • monkey kidney cells CV1
  • African green monkey kidney cells VERO-76
  • human cervical carcinoma cells HELA
  • canine kidney cells MDCK
  • buffalo rat liver cells BBL 3A
  • human lung cells W138
  • human liver cells Hep G2
  • mouse mammary tumor cells MMT 060562
  • TRI cells as described, e.g., in Mather et al., Annals N.Y.
  • CHO Chinese hamster ovary
  • dhfr- CHO cells Urlaub et al., Proc Natl Acad Sci USA 77, 4216 (1980)
  • myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
  • Yazaki and Wu Methods in Molecular Biology, Vol.248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp.255-268 (2003).
  • Host cells include cultured cells, e.g., mammalian cultured cells, yeast cells, insect cells, bacterial cells and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
  • the host cell is a eukaryotic cell, preferably a mammalian cell, such as a Chinese Hamster Ovary (CHO) cell, a human embryonic kidney (HEK) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell). Standard technologies are known in the art to express foreign genes in these systems.
  • Cells expressing an engineered IL2 polypeptide fused to either the heavy or the light chain of an antigen binding moiety, such as an antibody, may be engineered so as to also express the other of the antibody chains such that the expressed engineered IL2 fusion polypeptide comprises an antibody that has both a heavy and a light chain.
  • a method of producing an engineered IL2 polypeptide or engineered IL2 fusion polypeptide is provided.
  • the method comprises culturing a host cell comprising a polynucleotide encoding the an engineered IL2 polypeptide or engineered IL2 fusion polypeptide, as provided herein, under conditions suitable for expression of the an engineered IL2 polypeptide or engineered IL2 fusion polypeptide, and optionally recovering and/or purifying the an engineered IL2 polypeptide or engineered IL2 fusion polypeptide from the host cell (or host cell culture medium, for example, if the host cell secretes the polypeptide).
  • compositions comprising an engineered IL2 polypeptide or engineered IL2 fusion polypeptide as described herein and a pharmaceutically acceptable diluent(s), excipient(s), or carrier(s).
  • the pharmaceutical compositions comprise an engineered IL2 polypeptide or an engineered IL2 fusion polypeptide as disclosed herein and an additional therapeutic agent (e.g., combination therapy).
  • additional therapeutic agent e.g., combination therapy
  • the pharmaceutical compositions may be formulated in a conventional manner using one or more pharmaceutically acceptable carriers comprising excipients and auxiliaries which facilitate processing of the engineered IL2 or IL2 fusion polypeptide into preparations which can be used pharmaceutically.
  • pharmaceutically acceptable carrier and “physiologically acceptable carriers” are used interchangeably and include any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g.
  • antibacterial agents antifungal agents
  • isotonic agents absorption delaying agents, salts, preservatives, antioxidants, proteins, drugs, drug stabilizers, polymers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art and are molecular entities and compositions that are generally non-toxic to recipients at the dosages and concentrations employed, i.e., do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate (see, for example, Remington's Pharmaceutical Sciences, 18th Ed.
  • the pharmaceutical composition may comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it need to be sterile for such routes of administration as injection.
  • Engineered IL2 polypeptides or engineered IL2 fusion polypeptides as describe herein (and any additional therapeutic agent) can be administered intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrasplenically, intrarenally, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, intratumorally, intramuscularly, intraperitoneally, subcutaneously, subconjunctivally, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, topically, locally, by inhalation (e.g.
  • parenteral administration in particular intravenous injection, is most commonly used for administering polypeptide molecules such as the engineered IL2 polypeptides or engineered IL2 fusion polypeptides describe herein.
  • Parenteral compositions include those designed for administration by injection, e.g.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer.
  • the solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • Sterile injectable solutions are prepared by incorporating the engineered IL2 polypeptides or engineered IL2 fusion polypeptides in the required amount in the appropriate solvent with various of the other ingredients enumerated below, as required. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, suspensions or emulsion, methods of preparation include vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered liquid medium thereof.
  • the liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose.
  • the pharmaceutical composition is preferably stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein.
  • Suitable pharmaceutically acceptable carriers include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides
  • Aqueous injection suspensions may contain compounds which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, dextran, or the like.
  • the suspension may also contain suitable stabilizers or agents, which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
  • suspensions of the active compounds may be prepared as appropriate oily injection suspensions.
  • Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl cleats or triglycerides, or liposomes.
  • aqueous suspensions contain one or more polymers as suspending agents.
  • Example polymers include water-soluble polymers such as cellulosic polymers, e.g., hydroxypropyl methylcellulose, and water-insoluble polymers such as cross-linked carboxyl-containing polymers.
  • Certain pharmaceutical compositions described herein comprise a mucoadhesive polymer, selected for example from carboxymethylcellulose, carbomer (acrylic acid polymer), poly(methylmethacrylate), polyacrylamide, polycarbophil, acrylic acid/butyl acrylate copolymer, sodium alginate and dextran.
  • the pharmaceutical compositions include solubilizing agents to aid in the solubility of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • solubilizing agent generally includes agents that result in formation of a micellar solution or a true solution of the agent.
  • Certain acceptable nonionic surfactants for example polysorbate 80, are useful as solubilizing agents. Examples include glycols, polyglycols, e.g., polyethylene glycol 400, and glycol ethers.
  • the pharmaceutical compositions include one or more pH adjusting agents or buffering agents, including acids such as acetic, boric, citric, lactic, phosphoric and hydrochloric acids; bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, sodium lactate and tris-hydroxymethylaminomethane; and buffers such as citrate/dextrose, sodium bicarbonate and ammonium chloride. Such acids, bases and buffers are included in an amount required to maintain pH of the composition in an acceptable range.
  • the pharmaceutical compositions include one or more salts in an amount required to bring osmolality of the composition into an acceptable range.
  • Such salts include those having sodium, potassium or ammonium cations and chloride, citrate, ascorbate, borate, phosphate, bicarbonate, sulfate, thiosulfate or bisulfite anions; suitable salts include sodium chloride, potassium chloride, sodium thiosulfate, sodium bisulfite and ammonium sulfate.
  • the pharmaceutical compositions include one or more preservatives to inhibit microbial activity. Suitable preservatives include mercury- containing substances such as merfen and thiomersal; stabilized chlorine dioxide; and quaternary ammonium compounds such as benzalkonium chloride, cetyltrimethylammonium bromide and cetylpyridinium chloride.
  • the pharmaceutical compositions include one or more surfactants to enhance physical stability or for other purposes.
  • Suitable nonionic surfactants include polyoxyethylene fatty acid glycerides and vegetable oils, e.g., polyoxyethylene (60) hydrogenated castor oil; and polyoxyethylene alkylethers and alkylphenyl ethers, e.g., octoxynol 10, octoxynol 40.
  • the pharmaceutical compositions include one or more antioxidants to enhance chemical stability where required. Suitable antioxidants include, by way of example only, ascorbic acid and sodium metabisulfite.
  • aqueous suspension compositions are packaged in single-dose non-reclosable containers.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein are delivered using a sustained-release system, such as semipermeable matrices of solid hydrophobic polymers containing the therapeutic agent.
  • sustained-release materials are useful herein.
  • sustained-release capsules release the engineered IL2 polypeptide or engineered IL2 fusion polypeptides for a few weeks up to over 100 days.
  • additional strategies for protein stabilization are employed.
  • sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
  • prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
  • engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • macroemulsions for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
  • compositions comprising the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein may be manufactured by means of conventional mixing, dissolving, emulsifying, encapsulating, entrapping or lyophilizing processes.
  • Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the proteins into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides may be formulated into a composition in a free acid or base, neutral or salt form.
  • Pharmaceutically acceptable salts are salts that substantially retain the biological activity of the free acid or base. These include the acid addition salts, e.g., those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine. Pharmaceutical salts tend to be more soluble in aqueous and other protic solvents than are the corresponding free base forms.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein are formulated for oral administration.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein are formulated in oral dosage forms that include, by way of example only, tablets, powders, pills, dragees, capsules, liquids, gels, syrups, elixirs, slurries, suspensions and the like.
  • pharmaceutical preparations for oral use are obtained by mixing one or more solid excipient with one or more of the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
  • Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as: for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methylcellulose, microcrystalline cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose; or others such as: polyvinylpyrrolidone (PVP or povidone) or calcium phosphate.
  • disintegrating agents are optionally added.
  • Disintegrating agents include, by way of example only, cross-linked croscarmellose sodium, polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • dosage forms such as dragee cores and tablets, are provided with one or more suitable coating.
  • concentrated sugar solutions are used for coating the dosage form.
  • the sugar solution optionally contain additional components, such as by way of example only, gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
  • Dyestuffs and/or pigments are also optionally added to the coatings for identification purposes.
  • the dyestuffs and/or pigments are optionally utilized to characterize different combinations of active agent doses.
  • therapeutically effective amounts of at least one of the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein are formulated into other oral dosage forms.
  • Oral dosage forms include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
  • push-fit capsules contain the active ingredients in admixture with one or more filler. Fillers include lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • soft capsules contain one or more active agent that is dissolved or suspended in a suitable liquid.
  • suitable liquids may include one or more fatty oil, liquid paraffin, or liquid polyethylene glycol.
  • stabilizers are optionally added.
  • therapeutically effective amounts of at least one of the engineered IL2 polypeptides or engineered IL2 fusion polypeptides described herein are formulated for buccal or sublingual administration.
  • Formulations suitable for buccal or sublingual administration include, by way of example only, tablets, lozenges, or gels.
  • the engineered IL2 polypeptide or engineered IL2 fusion polypeptide is administered topically.
  • the engineered IL2 polypeptide or engineered IL2 fusion polypeptide described herein are formulated into a variety of topically administrable compositions, such as solutions, suspensions, lotions, gels, pastes, medicated sticks, balms, creams or ointments.
  • Such pharmaceutical compositions optionally contain solubilizers, stabilizers, tonicity enhancing agents, buffers and preservatives.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides are formulated for transdermal administration.
  • transdermal formulations employ transdermal delivery devices and transdermal delivery patches and can be lipophilic emulsions or buffered, aqueous solutions, dissolved and/or dispersed in a polymer or an adhesive.
  • patches are constructed for continuous, pulsatile, or on demand delivery of pharmaceutical agents.
  • the transdermal delivery of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide is accomplished by means of iontophoretic patches and the like.
  • transdermal patches provide controlled delivery of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • the rate of absorption is slowed by using rate-controlling membranes or by trapping the engineered IL2 polypeptide or engineered IL2 fusion polypeptide within a polymer matrix or gel.
  • absorption enhancers are used to increase absorption.
  • Absorption enhancers or carriers include absorbable pharmaceutically acceptable solvents that assist passage through the skin.
  • transdermal devices are in the form of a bandage comprising a backing member, a reservoir containing the engineered IL2 polypeptide or engineered IL2 fusion polypeptide optionally with carriers, optionally a rate controlling barrier to deliver the engineered IL2 polypeptide or engineered IL2 fusion polypeptide to the skin of the host at a controlled and predetermined rate over a prolonged period of time, and means to secure the device to the skin.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides are formulated for administration by inhalation.
  • Various forms suitable for administration by inhalation include, but are not limited to, aerosols, mists or powders.
  • compositions of the engineered IL2 polypeptides or engineered IL2 fusion polypeptides may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas).
  • a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • the dosage unit of a pressurized aerosol is determined by providing a valve to deliver a metered amount.
  • capsules and cartridges of, such as, by way of example only, gelatin for use in an inhaler or insufflator is formulated containing a powder mix of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide and a suitable powder base such as lactose or starch.
  • the engineered IL2 polypeptide or engineered IL2 fusion polypeptides are formulated in rectal compositions such as enemas, rectal gels, rectal foams, rectal aerosols, suppositories, jelly suppositories, or retention enemas, containing conventional suppository bases such as cocoa butter or other glycerides, as well as synthetic polymers such as polyvinylpyrrolidone, PEG, and the like.
  • a low-melting wax such as, but not limited to, a mixture of fatty acid glycerides, optionally in combination with cocoa butter is first melted.
  • the formulations described herein comprise one or more antioxidants, metal chelating agents, thiol containing compounds and/or other general stabilizing agents.
  • stabilizing agents include, but are not limited to: (a) about 0.5% to about 2% w/v glycerol, (b) about 0.1% to about 1% w/v methionine, (c) about 0.1% to about 2% w/v monothioglycerol, (d) about 1 mM to about 10 mM EDTA, (e) about 0.01% to about 2% w/v ascorbic acid, (f) 0.003% to about 0.02% w/v polysorbate 80, (g) 0.001% to about 0.05% w/v.
  • polysorbate 20 (h) arginine, (i) heparin, (j) dextran sulfate, (k) cyclodextrins, (l) pentosan polysulfate and other heparinoids, (m) divalent cations such as magnesium and zinc; or (n) combinations thereof.
  • the concentration of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is less than 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19%, 18%, 17%, 16%, 15%,14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, 0.009%, 0.008%, 0.007%, 0.006%, 0.005%, 0.004%, 0.003%, 0.002%, 0.001%, 0.0009%, 0.0008%, 0.0007%, 0.0006%, 0.0005%, 0.0004%, 0.0003%, 0.0002%, or 0.0001% w/w, w/v or v/v.
  • the concentration of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is greater than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19.75%, 19.50%, 19.25% 19%, 18.75%, 18.50%, 18.25% 18%, 17.75%, 17.50%, 17.25% 17%, 16.75%, 16.50%, 16.25% 16%, 15.75%, 15.50%, 15.25% 15%, 14.75%, 14.50%, 14.25% 14%, 13.75%, 13.50%, 13.25% 13%, 12.75%, 12.50%, 12.25% 12%, 11.75%, 11.50%, 11.25% 11%, 10.75%, 10.50%, 10.25% 10%, 9.75%, 9.50%, 9.25% 9%, 8.75%, 8.50%, 8.25% 8%, 7.75%, 7.50%, 7.25% 7%, 6.75%, 6.50%, 6.25% 6%, 5.75%
  • the concentration of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is in the range from approximately 0.0001% to approximately 50%, approximately 0.001% to approximately 40 %, approximately 0.01% to approximately 30%, approximately 0.02% to approximately 29%, approximately 0.03% to approximately 28%, approximately 0.04% to approximately 27%, approximately 0.05% to approximately 26%, approximately 0.06% to approximately 25%, approximately 0.07% to approximately 24%, approximately 0.08% to approximately 23%, approximately 0.09% to approximately 22%, approximately 0.1% to approximately 21%, approximately 0.2% to approximately 20%, approximately 0.3% to approximately 19%, approximately 0.4% to approximately 18%, approximately 0.5% to approximately 17%, approximately 0.6% to approximately 16%, approximately 0.7% to approximately 15%, approximately 0.8% to approximately 14%, approximately 0.9% to approximately 12%, approximately 1% to approximately 10% w/w, w/v or v/v.
  • the concentration of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is in the range from approximately 0.001% to approximately 10%, approximately 0.01% to approximately 5%, approximately 0.02% to approximately 4.5%, approximately 0.03% to approximately 4%, approximately 0.04% to approximately 3.5%, approximately 0.05% to approximately 3%, approximately 0.06% to approximately 2.5%, approximately 0.07% to approximately 2%, approximately 0.08% to approximately 1.5%, approximately 0.09% to approximately 1%, approximately 0.1% to approximately 0.9% w/w, w/v or v/v.
  • the amount the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is equal to or less than 10 g, 9.5 g, 9.0 g, 8.5 g, 8.0 g, 7.5 g, 7.0 g, 6.5 g, 6.0 g, 5.5 g, 5.0 g, 4.5 g, 4.0 g, 3.5 g, 3.0 g, 2.5 g, 2.0 g, 1.5 g, 1.0 g, 0.95 g, 0.9 g, 0.85 g, 0.8 g, 0.75 g, 0.7 g, 0.65 g, 0.6 g, 0.55 g, 0.5 g, 0.45 g, 0.4 g, 0.35 g, 0.3 g, 0.25 g, 0.2 g, 0.15 g, 0.1 g, 0.09 g, 0.08 g, 0.07 g, 0.06 g, 0.05 g, 0.04 g, 0.
  • the amount of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is more than 0.0001 g, 0.0002 g, 0.0003 g, 0.0004 g, 0.0005 g, 0.0006 g, 0.0007 g, 0.0008 g, 0.0009 g, 0.001 g, 0.0015 g, 0.002 g, 0.0025 g, 0.003 g, 0.0035 g, 0.004 g, 0.0045 g, 0.005 g, 0.0055 g, 0.006 g, 0.0065 g, 0.007 g, 0.0075 g, 0.008 g, 0.0085 g, 0.009 g, 0.0095 g, 0.01 g, 0.015 g, 0.02 g, 0.025 g, 0.03 g, 0.035 g, 0.04 g, 0.045 g, 0.05 g, 0.055
  • the amount of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide provided in the pharmaceutical compositions of the present disclosure is in the range of 0.0001-10 g, 0.0005-9 g, 0.001-8 g, 0.005-7 g, 0.01- 6 g, 0.05-5 g, 0.1-4 g, 0.5-4 g, or 1-3 g.
  • Methods of Treatment and Use in some embodiments of the present disclosure provided herein are methods of modulating an immune response in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of an engineered IL2 polypeptide, an engineered IL2 fusion polypeptide, or a pharmaceutical composition thereof as previously described herein.
  • modulating the immune response includes at least one of: enhancing effector T cell activity, enhancing NK cell activity, and suppressing regulatory T cell activity.
  • modulating the immune response comprising increasing STAT5 phosphorylation compared to WT IL2.
  • engineered IL2 polypeptide as previously described, fusion polypeptides as previously described, and/or pharmaceutical compositions as previously described, for use in a method of treating a subject for a disease.
  • diseases or condition contemplated in the method include proliferative disorders, such as cancer, and immunosuppression.
  • a method of treating a proliferative disorder comprising administering to the subject a therapeutically effective amount of an engineered IL2 polypeptide, an engineered IL2 fusion polypeptide, or a pharmaceutical composition thereof as previously described herein.
  • the proliferative disorder is cancer.
  • Non-limiting examples of cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, glioblastoma, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, skin cancer, melanoma, bone cancer, renal cell carcinoma, and kidney cancer. Also included are pre- cancerous conditions or lesions and cancer metastases.
  • cell proliferation disorders include, but are not limited to neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system.
  • neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system.
  • the method of treatment or modulating the immune response further comprises administering to the subject a therapeutically effective amount of at least one additional therapeutic agent (e.g., a combination therapy).
  • the additional therapeutic agent is an anti-cancer agent.
  • anti-cancer agents include checkpoint inhibitors (e.g., anti-PD1 antibodies), chemotherapeutic agents, agents that inhibit a tumor microenvironment, cancer vaccines (e.g., Sipuleucel-T), oncolytic viruses (e.g., talimogene laherparepvec), immune cells expressing a chimeric antigen receptor, and tumor infiltrating lymphocytes.
  • the additional therapeutic agent is a molecule including an antigen binding moiety.
  • the antigen binding moiety is selected from a single domain antibody, a Fab molecule, an scFv, a diabody, a nanobody, a bi-specific T cell engager, or an immunoglobulin.
  • the antigen binding moiety is specific to a tumor antigen (e.g., carcinoembryonic antigen, fibroblast activation protein-a, CD20) or a check point protein (e.g., CTLA-4, PD-1 or PD-L1).
  • the additional therapeutic agent comprises an immune cell expressing a chimeric antigen receptor, an immune cell expressing an engineered T cell receptor, or a tumor infiltrating lymphocyte.
  • the engineered IL2 polypeptide or engineered IL2 fusion polypeptide may be encoded by a polynucleotide transfected, transvected, or otherwise introduced into the immune cell that expresses the chimeric antigen receptor, the immune cell expressing an engineered T cell receptor, or the tumor infiltrating lymphocyte.
  • the immune cell may be an armored chimeric antigen receptor-expressing cell.
  • the polynucleotide may additionally encode a secretion signal (e.g., the native IL2 signal sequence or a signal sequence derived from another protein) directly upstream of the engineered IL2 polypeptide coding sequence, to allow the cell to secrete the engineered IL2 polypeptide or engineered IL2 fusion polypeptide.
  • a secretion signal e.g., the native IL2 signal sequence or a signal sequence derived from another protein
  • the methods of treatment or modulating the immune response include administering to the subject an engineered IL2 polypeptide having an IL2Rb binding region two of SEQ ID NO: 1.
  • the methods of treatment or modulating the immune response include administering to the subject an engineered IL2 polypeptide having an IL2Rb binding region two of any one of SEQ ID NOs: 2-21.
  • the method includes administering to the subject an engineered IL2 polypeptide of any of SEQ ID NOs: 23-42, any one of SEQ ID NOs: 44-63, any one of SEQ ID NOs: 147-170 (with the C-terminal histidine tag optionally included), or an Fc fusion polypeptide of SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 144 or SEQ ID NO: 145.
  • the methods of treatment or modulating the immune response include administering to the subject an engineered IL2 polypeptide of SEQ ID NO: 22, or of any one of SEQ ID NOs: 23-42.
  • the methods of treatment or modulating the immune response include administering to the subject an engineered IL2 fusion polypeptide of SEQ ID NO: 51. In certain embodiments, the methods of treatment or modulating the immune response include administering to the subject an engineered IL2 fusion polypeptide of SEQ ID NO: 43, or of any one of SEQ ID NOs: 44-63.
  • Suitable routes of administration include, but are not limited to, intravenous, parenteral, transdermal, oral, rectal, aerosol, ophthalmic, pulmonary, transmucosal, vaginal, otic, nasal, and topical administration.
  • parenteral delivery includes intramuscular, subcutaneous, intravenous, intramedullary injections, as well as intrathecal, direct intraventricular, intraperitoneal, intralymphatic, and intranasal injections.
  • an engineered IL2 polypeptide or IL2 fusion polypeptide is administered systemically.
  • an engineered IL2 polypeptide or engineered IL2 fusion polypeptide as described herein is administered in a local rather than systemic manner, for example, via injection of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide directly into an organ, tissue, or tumor.
  • long acting formulations are administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
  • the drug is delivered in a targeted drug delivery system, for example, in a liposome coated with organ-specific or cell-specific antibody.
  • the liposomes are targeted to and taken up selectively by the organ.
  • the engineered IL2 polypeptide or engineered IL2 fusion polypeptide as described herein is provided in the form of a rapid release formulation, in the form of an extended or sustained release formulation, in the form of an intermediate release formulation, or in the form of a depot preparation.
  • the engineered IL2 polypeptide or engineered IL2 fusion polypeptide described herein is administered topically.
  • the appropriate dosage of an engineered IL2 polypeptide or engineered IL2 fusion polypeptide will depend on the type of disease or condition, the route of administration, body weight of the subject, severity and progression of the disease, whether the polypeptide is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the subject's clinical history and response to the engineered IL2 polypeptide or engineered IL2 fusion polypeptide, and the discretion of the attending physician.
  • a single administration of an engineered IL2 polypeptide may range from about 50,000 IU/kg to about 1,000,000 IU/kg or moreof the engineered IL2 polypeptide. This may be repeated several times a day (e.g., 2-4 times per day), for several days (e.g., 3-5 consecutive days) and then may be repeated one or more times following a period of rest (e.g., 7-14 days).
  • a therapeutically effective amount may comprise only a single administration or many administrations over a period of time (e.g. about 10-30 individual administrations of about 600,000 IU/kg of IL2 each given over about a 5-20 day period).
  • a therapeutically effective of the engineered IL2 fusion polypeptide may be lower than a non-fusion engineered IL2 polypeptide (e.g., 10,000 IU/kg to about 600,000 IU/kg).
  • the engineered IL2 fusion polypeptide may be administered to the patient at one time or over a series of treatments as described above.
  • the daily dosage of the engineered IL2 polypeptide or engineered IL2 fusion polypeptide ranges from about 1 mg/kg to about 100 mg/kg or more.
  • the treatment may be sustained until a desired suppression of disease symptoms occurs (e.g., tumor shrinkage).
  • a single dose of an engineered IL2 polypeptide or engineered IL2 fusion polypeptide is in the range from about 0.005 mg/kg to about 10 mg/kg.
  • a dose may be about 1 mg/kg/body weight, about 5 mg/kg/body weight, about 10 mg/kg/body weight, about 50 mg/kg/body weight, about 100 mg/kg/body weight, about 200 mg/kg/body weight, about 350 mg/kg/body weight, about 500 mg/kg/body weight, about 1 mg/kg/body weight, about 5 mg/kg/body weight, about 10 mg/kg/body weight, about 50 mg/kg/body weight, about 100 mg/kg/body weight, about 200 mg/kg/body weight, about 350 mg/kg/body weight, about 500 mg/kg/body weight, to about 1000 mg/kg/body weight per administration, and any range derivable therein.
  • a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc. can be administered, based on the numbers described above. Such doses may be administered intermittently, e.g., 2-3 times per day, every week, or every three weeks. An initial higher loading dose, followed by one or more lower doses may be administered. However, other dosage regimens may be useful.
  • the engineered IL2 polypeptides and engineered IL2 fusion polypeptides described herein may be used in an amount effective to achieve the intended purpose.
  • the engineered IL2 polypeptides or engineered IL2 fusion polypeptides, or pharmaceutical compositions thereof are administered in a therapeutically effective amount. Determination of a therapeutically effective amount is within the capabilities of those of skill in the art, especially in light of the details provided herein.
  • a therapeutically effective amount can be estimated initially from in vitro assays, such as cell culture assays. A dose can then be formulated in animal models to achieve a circulating concentration range that includes the IC 50 as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Initial dosages can also be estimated from in vivo data, e.g., animal models, using techniques that are well known in the art.
  • Dosage amount and interval may each be adjusted to provide plasma levels of engineered IL2 polypeptides and engineered IL2 fusion polypeptides which are sufficient to maintain therapeutic effect. Levels in plasma may be measured, for example, by HPLC.
  • EXAMPLES EXAMPLE 1 LIBRARY STRATEGY TO IDENTIFY IL2Ra-REDUCED BINDING MUTATIONS The libraries of IL2 mutations to identify IL2Ra-reduced binders were rationally designed based on the structural modeling of IL2 interactions with IL2Ra (Figs.1A & 1B).
  • K35, R38, F42 and Y45 residues of IL2 were identified as the important residues interacting with IL2Ra (Fig.1C).
  • Mutagenic oligos carrying two, three and four randomized mutations at these residues were used for library construction (Table 1).
  • Table 1. Rationally designed IL2Ra-reduced mutagenic libraries
  • Table 2. Mutagenic oligo design for IL-2Ra-reduced binding libraries Upper case nucleotide trimer is mixed at 50% WT and 50% NNS, or 70% WT and 30% NNS, where “N” refers to any nucleotide, and “S” refers to G or C.
  • Library 1 includes mutagenic oligos 1-6
  • library 2 includes mutagenic oligos 7-9
  • library 3 includes mutagenic oligos 10-11 (Table 2).
  • Those mutagenic libraries have been further modified to have in vitro transcription and translation signal at the N-terminus.
  • a flag-tag sequence was also added to the C-terminus for selection and purification purpose.
  • EXAMPLE 2 SELECTION AND IDENTIFICATION OF IL2Ra-REDUCED BINDING CLONES mRNA display technology was used to select IL2 mutants with IL2Ra- reduced binding from the three IL2 mutagenic libraries. Briefly, the DNA libraries were first transcribed into mRNA libraries and then translated into mRNA-IL2 mutant fusion libraries by covalent coupling through a puromycin linker. The libraries were purified and converted to mRNA/cDNA fusion libraries. The fusion libraries were counter- selected with human and mouse IgGs (negative proteins) to remove nonspecific binders, then counter-selected against IL2Ra three times.
  • Fig.2A shows the ELISA results of supernatant of selected IL2 clones to IL2Ra.
  • Fig.2B shows the clone expression plotted against IL2Ra binding with supernatant.
  • Fig.3 shows a sequence alignment of the clones identified with IL2Ra-reduced binding.
  • the flow cells were then regenerated with Glycine pH 2.0 for 60 seconds at a flow rate of 30 uL/min.
  • a HBSP+ buffer was included with each sample as a baseline control.
  • the assay was set up in a 96-well format.
  • the kinetics data was analyzed with Biacore T200 evaluation software 3.0.
  • the specific binding response unit was derived from subtraction of binding to reference flow cell 1 from IL2Ra flow cell 2 and subtraction of buffer control. WT IL2 was included as control.
  • Relative response (RU) was determined for each IL2Ra-reduced binding clone (Fig.4, Table 3).
  • mutagenic libraries including mutations to IL2Rb binding region 1, IL2Rb binding region 2, or IL2Rb binding region 1 and IL2Rb binding region 2
  • two mutagenic oligomers Oligo 1, Oligo 2 encoding the sequences of these two regions were designed (Table 4).
  • Oligo 1 and Oligo 2 sequences each codon trimer with nucleotides shown as lower-case letters was a mixture of 50% WT and 50% NNS (with “N” referring to any nucleotide, and “S” referring to G or C).
  • Additional oligomers (Oligo 3 to Oligo 12) coding WT IL2 sequences were designed from WT region for mutagenic library assembly (Table 4).
  • mutagenic libraries were constructed using these oligos (Fig.5).
  • Library 4 was constructed using an overlapped PCR strategy with mutagenic oligo 1 and oligos 3-12.
  • Library 5 was constructed using an overlapped PCR strategy with mutagenic oligo 2 and oligos 3-9, 11, and 12.
  • Library 6 was constructed using an overlapped PCR strategy with mutagenic oligos 1 and 2 and oligos 3-8, 11, and 12.
  • the three mutagenic libraries were further modified to have an in vitro transcription and translation signal at N-terminus and a Flag-tag at the C-terminus for selection with mRNA display. Table 4. Mutagenic oligo design for IL-2Rb agonist libraries
  • EXAMPLE 5 SELECTION AND IDENTIFICATION OF IL2Rb AGONIST CLONES
  • An mRNA display technology platform was used for the identification of IL2Rb agonists from three IL2 mutagenic libraries.
  • the DNA libraries were first transcribed into mRNA libraries and then translated into mRNA-IL2 mutant fusion libraries by covalent coupling through a puromycin linker.
  • the libraries were then purified and converted to mRNA/cDNA fusion libraries (see, e.g., US Patent No. 6,258,558, hereby incorporated by reference).
  • the fusion libraries were first counter selected with human IgGs (negative proteins) to remove nonspecific binders, then counter selected to remove IL2Ra binders, followed by selection against recombinant IL2Rb/Fc protein captured on Protein G magnetic beads.
  • the IL2Rb binders were recovered and enriched by PCR amplification. A total of five rounds of selections were executed to generate highly enriched engineered IL2 mutants binding to IL2Rb. Following five rounds of selection, enriched libraries were cloned into bacterial periplasmic expression vector pET22b and transformed into TOP10 competent E. coli cells. Each engineered IL2 molecule was engineered to have a C-terminus flag and 6xHIS tag for purification and assay detection.
  • Clones from TOP10 cells were pooled and the miniprep DNA were prepared and subsequently transformed into E. coli Rosetta II strain for expression. Single clones were picked, grown and induced with 0.25 mM IPTG in 96-well plates for expression. The supernatant was collected after 16 to 24 hours induction at 30°C for assays to identify binders. Supernatants containing engineered IL2 mutants were assessed with sandwich ELISA assay to screen for expression. Briefly, an anti-HIS tag antibody (R&D Systems) was immobilized in a 96-well plate at a final concentration of 2 ⁇ g/mL in 1X PBS in a total volume of 50 ⁇ L per well.
  • R&D Systems an anti-HIS tag antibody
  • the plate was incubated overnight at 4°C followed by blocking with 200 ⁇ L of superblock per well for 1 hour.100 ⁇ L of 1:101X PBST diluted supernatant was added to each well and incubated for 1 hour with shaking.
  • the expression level of engineered IL2 mutant was detected by adding 50 ⁇ l of anti-Flag HRP diluted at 1:5000 in 1X PBST for one hour.
  • the plate was washed three times with 1X PBST using a plate washer.
  • the plate was then developed with 50 ⁇ L of TMB substrate for 5 minutes and stopped by adding 50 ⁇ L of 2N sulfuric acid.
  • the plate was read at OD 450 nm using a Biotek plate reader and the data was analyzed with Prism 8.1 software.
  • IL2Rb binding screening ELISA was developed for the identification of individual engineered IL2 mutant. Briefly, 96-well plate was immobilized with human Fc and human IL2Rb, respectively, at a final concentration of 2 ⁇ g/mL in 1X PBS in total volume of 50 ⁇ L per well. The plate was incubated overnight at 4°C followed by blocking with 200 ⁇ L of superblock per well for 1 hour.100 ⁇ l of supernatant was added to both Fc and IL2Rb immobilized wells and incubated for 1 hour with shaking.
  • the engineered IL2 mutant binding was detected by adding 50 ⁇ L of anti-Flag HRP diluted at 1:5000 in 1X PBST. In between each step, the plate was washed three times with 1X PBST in a plate washer. The plate was then developed with 50 ⁇ L of TMB substrate for five minutes and stopped by adding 50 ⁇ L of 2N sulfuric acid. The plate was read at OD450 nm using a Biotek plate reader and the binding and selectivity was analyzed. The correlation of expression and IL2Rb binding was plotted with Prism 8.1 software.
  • High IL2Rb-binding clones (shown to the right of the vertical OD450 nm cutoff) were identified from library 5 for further characterization as engineered IL2Rb agonists (Fig.6).
  • the IL2Rb-binding activity of the clones generally correlated with expression level of the clones.
  • Multiple sequence alignment of the IL2Rb binding region 2 revealed both highly conserved and highly varied amino acids as compared to IL2 WT, as well as clone sequences that were identified multiple times independently (Fig.7). No specific IL2Rb-binding clones were identified from libraries 4 and 6.
  • EXAMPLE 6 PRODUCTION OF IL2Rb AGONIST CLONES IN E.COLI AND MAMMALIAN CELLS
  • the glycerol stock of each engineered agonist clone was inoculated into TB medium for overnight growth. The next day, cells from the overnight culture were inoculated into TB medium and grown to a cell density of OD600 between 0.6-0.8. IPTG was added to a final concentration of 1 mM to induce the expression during culture at 30 degrees C overnight. The supernatant was collected by centrifugation.
  • the engineered agonists were purified by Ni-Sepharose (GE Healthcare) affinity column according to the manufacturer’s protocol.
  • the purity of the engineered agonists was further improved by Flag-tag affinity column purification (Sigma).
  • the agonists were each concentrated and loaded to a Sephadex 200 Increase 10/300 GL column in AKTA for size exclusion chromatographic column purification.
  • the high homogeneous monomeric peak fractions of the agonists were each pooled and concentrated.
  • Endotoxin was further removed using endotoxin removal resin (Pierce) according to the standard protocol. The final endotoxin level was less than 10 EU/mg.
  • Protein purity was confirmed by LC-MS spectrometry analysis and SDS gel (Fig.8).
  • the proteins were each stored in 1X PBS buffer for binding and functional analysis.
  • IL2Rb agonists For production of the IL2Rb agonists in mammalian cells, the DNA sequence corresponding to the amino-acid sequence was codon optimized, synthesized and subcloned into pCDNA3.4 (Invitrogen). Each engineered IL2 polypeptide was expressed transiently in ExpiHEK293-F cells in free style system (Invitrogen) according to standard protocol. The cells were grown in the above conditions for seven days before harvesting. The supernatant was collected by centrifugation and filtered through a 0.2 ⁇ m PES membrane. The agonists were first purified by Ni Sepharose Excel resin column (GE Healthcare) and buffer exchanged to PBS pH 7.4 + 300mM NaCl (total) with 7k Da Zeba columns.
  • coli produced WT IL2 and EP001-EP007 were assessed by surface plasmon resonance technology with Biacore T200 for engineered IL2 polypeptides produced in E. coli cells and engineered IL2 polypeptides produced in mammalian cells.
  • the assay was run with Biacore T200 control software version 2.0. For each cycle, 1 ⁇ g/mL of human IL2Rb or IL2Ra was captured for 60 seconds at flow rate of 10 ⁇ L/min on flow cell 2 in 1X HBST buffer on Protein A sensor chip.
  • Two-fold serial diluted HIS tag purified engineered IL2 mutant was injected onto both reference flow cell 1 and IL2Rb or IL2Ra captured flow cell 2 for 150 seconds at flow rate of 30 ⁇ L/min followed by washing for 300 seconds.
  • the flow cells were then regenerated with Glycine pH 2 for 40 seconds at a flow rate of 30 ⁇ L/mins.
  • Eight concentration points from 0 to 100 nM were assayed for each IL2Rb agonist clone 96-well plate format.
  • the kinetics data was analyzed with Biacore T200 evaluation software 3000.
  • the specific binding response unit was derived from subtraction of binding to reference flow cell 1 from target flow cell 2.
  • WT IL2 was used to validate the binding protocols and was included in each run as a control (Figs.9A & 9B).
  • Representative sensorgrams of binding kinetics of E. coli and mammalian produced IL2Rb agonist binding to IL2Ra Figs.10A-10H for E. coli produced, Figs.12A-12D for mammalian produced
  • IL2Rb Figs.11A- 11H for E. coli produced, Figs.13A-13D for mammalian produced
  • Binding kinetics for E.coli-produced IL2 (Table 5) and mammalian-produced IL2 (Table 6) are summarized.
  • IL2Rb agonists EP001, EP006, and EP007 demonstrated no detectable IL2Ra binding or a significant decrease (greater than a twenty-fold decrease) in IL2Ra binding, but had a significant increase in IL2Rb binding as compared to WT IL2 (Table 5, 6).
  • the IL2Rb agonists EP002, EP003, EP004, and EP005 did not demonstrate a significant decrease in IL2Ra (less than a twenty-fold decrease) as compared to wild-type IL2, but had a significant increase in IL2Rb binding as compared to WT IL2 (Tables 5, 6). Table 5.
  • Stimulated PBMCs were immediately fixed, permeabilized, stained for cell lineage markers (CD3, CD56, CD4, CD8, FOXP3) and p-STAT5 and visualized on the Attune flow cytometer.
  • CD8+ T cells were defined as CD3+CD56-CD4-CD8+.
  • NK cells were defined as CD3-CD56+.
  • T regulatory cells were defined as CD3+CD56-CD4+CD8-FOXP3+.
  • the % of cells that were p-STAT5+ was determined and graphed versus each IL2 titration (Figs.14A- 14C for blood donor 1, Figs.14D-14F for blood donor 2, and Figs.14G-14I for blood donor 3).
  • EC50 values for P-STAT5 activation were determined using Prism software (Table 7). Table 7. Summary of P-STAT5 activation of human CD8+ T cells, NK cells and Tregs
  • EXAMPLE 9 RATIONAL GENERATION OF IL2Rb AGONIST BACK-MUTATION CLONES
  • IL2Rb agonist back-mutation strategy was carried out to create a range of IL2Rb agonist candidate mutations.
  • EP001 contains R81T, P82A, L85A, I86V, S87D, I89M, N90R, V93I and L94Q mutations.
  • Four back mutations to WT IL2 were designed for each candidate.
  • the I86 and I89 were back- mutated to 86I and 89I of WT IL2 for all mutations.
  • a systemic back-mutation was then applied to the other two residues in combination with 86I and 89I.
  • EP001 back-mutation clones were characterized for their binding activities to IL2Rb and IL2Ra receptors by ELISA. Briefly, 384 well plate was immobilized with human IL2Ra and IL2Rb Fc fusion proteins at a final concentration of 2 ug/mL in 1X PBS in total volume of 25 uL per well. The plate was incubated overnight at 4C and blocked with 80 uL of superblock per well for 1 hour. The purified EP001 back-mutation clones were serially diluted from 100 nM to 0 nM.
  • Binding activity of back-mutation clones EXAMPLE 11 BINDING KINETICS OF IL2Rb AGONIST BACK-MUTATION CLONES USING SURFACE PLASMON RESONANCE Binding kinetics analysis of EP001 back-mutation clones have been assessed by SPR technology with a Biacore T200. The assay was run with Biacore T200 control software version 2.0.
  • each cycle 1 ug/mL of human IL2Rb was captured for 60 seconds at flow rate of 10 uL/min on flow cell 2 in 1X HBSP buffer on Protein A sensor chip.100 nM of HIS and Flag tag purified each IL2 mutant was 2-fold serial diluted and injected onto both reference flow cell 1 and IL2Rb captured flow cell 2 for 150 seconds at flow rate of 30 uL/min followed by washing for 300 seconds. The flow cells were then regenerated with Glycine pH2 for 60 seconds at a flow rate of 30 uL/min. The assay was set up with 8 serial diluted concentration points in 96-well format. The kinetics data was analyzed with Biacore T200 evaluation software 3.0.
  • the specific binding response unit was derived from subtraction of binding to reference flow cell 1 from target flow cell 2 (Figs.16A-16F, Table 10). Table 10. Summary of binding kinetics for back-mutation clones. (NA: data not available; *: KD measured from steady state affinity fitting)
  • EXAMPLE 12 ENGINEERED IL2Rb AGONISTS WITH REDUCED IL2Ra ACTIVITY IL2 mutations with potentially reduced or eliminated IL2Ra binding generated through mRNA library selection and screen were first expressed in E.coli and purified by Ni-Sepharose (GE Healthcare) affinity column and Flag tag affinity column purification (Sigma) according to the manufacturer’s protocol.
  • IL2 mutations with significant reduced IL2Ra binding activities confirmed by both Biacore SPR binding and ELISA binding were then selected for generating IL2Rb agonists with reduced IL2Ra binding activities.
  • mutations were introduced by site directed mutagenesis technologies to IL2Rb agonist constructs in pCDNA3.4 mammalian expression vector and confirmed by DNA sequence analysis (Table 11).
  • Each engineered IL2 polypeptide was expressed transiently in ExpiHEK293-F cells in free style system (Invitrogen) according to standard protocol. The cells were grown in above conditions for five days before harvesting. The supernatant was collected by centrifugation and filtered through a 0.2 ⁇ m PES membrane.
  • the agonists were first purified by Ni Sepharose Excel resin column (GE Healthcare) and further purified by a Superdex 200 Increase 10/300 GL column (GE Healthcare) to more than 95% homogeneity (Fig.17).
  • the final purified proteins have less than 10 EU/mg endotoxin.
  • the proteins were stored in 1X PBS buffer for binding, functional and mechanism analysis. Table 11.
  • each cycle 1 ug/mL of human IL2Rb was captured for 60 seconds at flow rate of 10 ul/min on flow cell 2 in 1XHBSP buffer on Protein A sensor chip.100 nM of HIS and Flag tag purified each IL2 mutant was 2 fold serial diluted and injected onto both reference flow cell 1 and IL2Rb captured flow cell 2 for 150 seconds at flow rate of 30 ul/mins followed by wash for 300 seconds. The flow cells were then regenerated with Glycine pH2 for 60 seconds at flow rate of 30 ul/mins. The assay was set up with 8 serial diluted concentration points in 96 well format. The kinetics data was analyzed with Biacore T200 evaluation software 3.0.
  • the specific binding response unit was derived from subtraction of binding to reference flow cell 1 from target flow cell 2.
  • Figs.18A-18H show titrated binding of engineered IL2Rb/a clones to IL2Ra
  • Figs.19A-19H show titrated binding of engineered IL2Rb/a clones to IL2Rb.
  • Figs.20A-20G show IL2Ra single concentration binding
  • Figs. 21A-21G show IL2Rb single concentration binding
  • Figs.22A and 22B show IL2Ra multi-concentration binding, which are summarized in Table 13).
  • Table 13 Summary of binding kinetics of engineered IL2Rb/IL2Ra clones to human IL2R by SPR ND: Non-detectable binding.
  • IL2 mutants were diluted in 0.05% Tween 20/1X PBS from 1000 nM to 0 nM and added to plates for 2 hrs at room temperature. Plates were then washed 6 times with 0.05% Tween20/1X PBS. Anti-HisTag-HRP was diluted 1:5000 in 0.05% Tween20/1X PBS and added to plates for 1 hr at RT. Plates were then washed 6 times with 0.05% Tween 20/1X PBS, and TMB was added to develop blue color. Reactions were stopped with 2N hydrogen sulfide and light absorbance at 450 nm was read on a BioTek plate reader.
  • EXAMPLE 15 P-STAT5 ACTIVATION OF HUMAN PBMCS BY ENGINEEREDIL2Ra/IL2Rb CLONES
  • Human PBMCs were isolated from peripheral blood of two donors and plated at 250,000 cells/well in a 96-well plate in 75 ⁇ L of media. Cells were rested 1 hr at 37°C. Cells were stimulated with human IL2 WT and engineered His-Flag tagged IL2 at 4X concentration in 25 ⁇ L for 20 min at 37°C. Stimulated PBMCs were immediately fixed, permeabilized, stained for cell lineage markers (CD3, CD56, CD4, CD8, FOXP3) and p-STAT5 and visualized on the Attune flow cytometer.
  • cell lineage markers CD3, CD56, CD4, CD8, FOXP3
  • CD8+ T cells were defined as CD3+CD56-CD4-CD8+.
  • NK cells were defined as CD3-CD56+.
  • Table 15 Summary of P-STAT5 activation of human CD8+ T cells, NK cells and Tregs for donor 1.
  • Table 16 Summary of P-STAT5 activation of human CD8+ T cells, NK cells and Tregs for donor 2.
  • EXAMPLE 16 P-STAT5 ACTIVATION OF MURINE CELLS BY ENGINEERED IL2Ra/IL2RbCLONES
  • Murine splenocytes were plated at 250,000 cells/well in a 96-well plate in 75 ⁇ L of media. Cells were rested 1 hr at 37°C. Cells were stimulated with human IL2 WT and engineered His-Flag tagged IL2 at 4X concentration in 25 ⁇ L for 20 min at 37°C.
  • Fig.34 A summary of the EC50 values of P-STAT5 activation in each cell type is shown in Fig.34.
  • Isolated NK cells or mouse T regulatory cells were plated at 20,000 cells/well in a 96-well plate in 75 ⁇ L of media.
  • EXAMPLE 17 DESIGN OF IL2Rb AGONIST FC-FUSION PROTEINS
  • the protein sequences encoding engineered IL2 polypeptides of EP003 (SEQ ID NO: 2), EP007 (SEQ ID NO: 4), EP002 (SEQ ID NO: 6), EP004 (SEQ ID NO: 09), EP001 (SEQ ID NO: 11), EP006 (SEQ ID NO: 16), EP009 (SEQ ID NO: 18), and EP005 (SEQ ID NO: 19) were fused to the N-terminal site of the constant frame sequence of human IgG1 isoform to produce engineered agonist-Fc fusion proteins (SEQ ID NOs: 44, 46, 48, 51, 53, 58, and 61).
  • L234A, L235A and P329G mutations in the human IgG1 were introduced to eliminate complement binding and Fc-g dependent antibody-dependent cell-mediated cytotoxity (ADCC) effects (Lo et al., JBC 2017) (Fig.35A).
  • ADCC Fc-g dependent antibody-dependent cell-mediated cytotoxity
  • the protein sequences encoding engineered IL2 polypeptides of EP003 (SEQ ID NO: 2), EP007 (SEQ ID NO: 4), EP002 (SEQ ID NO: 6), EP004 (SEQ ID NO: 09), EP001 (SEQ ID NO: 11), EP006 (SEQ ID NO: 16), EP009 (SEQ ID NO: 18), and EP005 (SEQ ID NO: 19) were fused to the N-terminal site of the constant frame sequences of respective human IgG1 and IgG4 isoforms, to produce engineered agonist-Fc fusion proteins (SEQ ID NOs: 44, 46, 48, 51, 53, 58, and 61).
  • the knob mutations of S354C, T366W and K409A were introduced to the constructs.
  • the hole mutations of Y349C, T366S, L368A, F405K, Y407V were introduced to CH2 and CH3 fragments of IgG1 and IgG4, respectively.
  • the L234A, L235A and P329G mutations in the human IgG1 were introduced to eliminate complement binding and Fc-g dependent antibody-dependent cell-mediated cytotoxicity (ADCC) effects (Lo et al., JBC 2017) (Figs.35B & 35C).
  • the DNA encoding the entire Fc fusion agonist protein was then synthesized with codon optimized for mammalian cell expression, and subcloned to pCDNA3.4 (Invitrogen).
  • EXAMPLE 18 PRODUCTION OF IL2Rb AGONIST FC FUSION PROTEINS
  • the agonist was expressed transiently in ExpiHEK293-F cells in free style system (Invitrogen) according to standard protocol. The cells were grown in above conditions for seven days before harvesting. The supernatant was collected by centrifugation and filtered through a 0.2 ⁇ m PES membrane.
  • the Fc fusion agonist first was purified by MabSelect PrismA protein A resin (GE Health).
  • the protein was eluted with 100mM Gly pH2.5 + 150mM NaCl and quickly neutralized with 20mM citrate pH 5.0 + 300mM NaCl.
  • the agonist protein was then concentrated to 1 mL and further purified by a Superdex 200 Increase 10/300 GL column. The monomeric peak fractions were pooled and concentrated.
  • the final purified protein has endotoxin of lower than 10EU/mg and kept in 20mM citrate pH 5.0 + 300mM NaCl.
  • the purified IL2 - Fc fusion agonists were run on an SDS gel (4-12% Bis-Tris Bolt gel, with MES running buffer), comparing samples of each treated under reducing versus non-reducing conditions (Fig.36A).
  • the “knob” and “hole” constructs in respective IgG1 and IgG4 backbone format were transfected to ExpiHEK293-F cells with the ratio of 1:1.
  • the cells were grown in above conditions for five days before harvesting.
  • the supernatant was collected by centrifugation and filtered through a 0.2 ⁇ m PES membrane.
  • the Fc fusion agonist first was purified by MabSelect PrismA protein A resin (GE Health). The protein was eluted with 100mM Gly pH2.5 + 150mM NaCl and quickly neutralized with 20mM citrate pH 5.0 + 300mM NaCl.
  • the agonist protein was then concentrated to 1 mL and further purified by a Superdex 200 Increase 10/300 GL column. The monomeric peak fractions were pooled and concentrated. The final purified protein has endotoxin of lower than 10EU/mg and kept in 20mM citrate pH 5.0 + 300mM NaCl.
  • the purified monovalent IL2 - Fc fusion agonists were run on an SDS gel (4-12% Bis-Tris Bolt gel, with MES running buffer), comparing samples of each treated under reducing versus non-reducing conditions (Fig.36B).
  • EXAMPLE 19 ELISA BINDING ANALYSIS OF IL2Rb AGONIST FC-FUSION PROTEINS
  • human IL2Ra, and human IL2Rb were each immobilized in a 384 well plate at final concentration of 2 ⁇ g/mL in 1x PBS in total volume of 25 ⁇ L per well. The plate was incubated overnight at 4°C followed by blocking with 80 ⁇ L of superblock per well for 1 hour. The purified engineered IL2 mutant Fc fusion protein at 100 nM was 3-fold serial diluted 12 times. Each dilution was added to IL2Ra and IL2Rb wells in parallel.
  • the engineered IL2 mutant binding was detected by adding 50 ⁇ L of anti-human Fc HRP diluted at 1:5000 in 1x PBST. In between each step, the plate was washed 3 times with 1x PBST in a plate washer. The plate was then developed with 25 ⁇ l of TMB substrate for 5 mins and stopped by adding 25 ⁇ l of 2N sulfuric acid. The plate was read at OD450 nm Biotek plate reader and the EC50 was analyzed with Prism 8.1 software. Absorbance versus IL-2 concentration is graphed for human IL2Ra and IL2Rb (Figs.37A-37G). A summary of the EC50 values of ELISA binding is shown (Table 17). Table 17.
  • IL2Rb Fc fusion proteins For monovalent Fc-fusion proteins, recombinant His-tagged human IL2Ra and IL2Rb were added in 25 uL of 1X PBS to wells of 384-well plate and incubated overnight at 4 °C to coat the plates. Plates were washed three times with 0.05% Tween20/1X PBS. Plates were blocked with 100 uL of SuperBlock for 1 hr at RT and then washed 3 times with 0.05% Tween20/1X PBS. IL2 mutants were diluted in 0.05% Tween 20/1X PBS from 1000 nM to 0 nM and added to plates for 2 hrs at room temperature.
  • IL2 Fc fusion protein For each cycle, 1 ug/mL of IL2 Fc fusion protein was captured for 60 seconds at flow rate of 10 ul/min on flow cell 2 in 1XHBSP buffer on anti-hFc immobilized chip.100 nM IL2Ra-HIS tagged or IL2Rb-HIS tagged was 2-fold serial diluted and injected onto both reference flow cell 1 and IL2 Fc fusion protein were captured at flow cell 2 for 150 seconds at flow rate of 30 ul/mins.300 seconds wash was applied after the last injection. The assay was set up with 8 serial diluted concentration points in 96 well format. The kinetics data was analyzed with Biacore T200 evaluation software 3.0.
  • the specific binding response unit was derived from subtraction of binding to reference flow cell 1 from target flow cell 2 (Figs.39A-39D).
  • EXAMPLE 21 P-STAT5 ACTIVATION OF HUMAN PBMCS BY IL2RbAGONIST FC-FUSION PROTEINS
  • Human PBMCs were isolated from peripheral blood and plated at 250,000 cells/well in a 96-well plate in 75 ⁇ l of media. Cells were rested 1 hr at 37°C. Cells were stimulated with human IL2 WT and IL2Rb agonist Fc-fusion proteins at 4X concentration in 25 ⁇ l for 20 min at 37°C.
  • Stimulated PBMCs were immediately fixed, permeabilized, stained for cell lineage markers (CD3, CD56, CD4, CD8, FOXP3) and p-STAT5 and visualized on the Attune flow cytometer.
  • CD8+ T cells were defined as CD3+CD56-CD4-CD8+.
  • NK cells were defined as CD3-CD56+.
  • T regulatory cells were defined as CD3+CD56-CD4+CD8-FOXP3+.
  • the % of cells that were p-STAT5+ was determined and graphed versus each IL2 titration (Figs.40A-40C for bivalent fusion proteins and Figs.41A-41C for bivalent fusion proteins; see Table 19 for a summary).
  • Table 19 Table 19
  • IL2-WT and EP001 concentrations were determined by comparing absorbance values from plasma to spiked controls made in equally diluted untreated C57BL/6 mouse plasma. IL2 concentration is plotted versus time on a logarithmic scale (Figs.42A-42B; Table 20). Table 20. EXAMPLE 23 IL2Rb AGONIST MURINE IN VIVO TUMOR CELL INFILTRATION Seven (7)-week old, female C57BL/6 mice were injected with 100,000 MC38 cells in 50% matrigel subcutaneously on their back flank.
  • mice were treated with 32 ug of WT IL2, EP001, EP003, or EP004 BID for 5 days. On day 6, mice were sacrificed and the tumor infiltrating immune cells were analyzed by flow cytometry. Tumor sections used for flow cytometry were weighed to obtain normalized cell counts.
  • CD4+ T cells were defined as CD45+CD3+CD49b-CD4+CD8-.
  • CD8+ T cells were defined as CD45+CD3+CD49b-CD4-CD8+.
  • NK cells were defined as CD45+CD3-CD49b+.
  • T regulatory cells NK cells were defined as CD45+CD3+CD49b-CD4+CD8-FOXP3+.
  • Na ⁇ ve T cells were defined as CD44 lo CD62L hi .
  • Effector T cells were defined as CD44 hi CD62L lo and central memory T cells were defined as CD44 hi CD62L hi .
  • the normalized counts of tumor infiltrating immune cells (Figs.43A-43D), the effector cell to regulatory cell ratios (Figs.44A & 44B) and the T cell subtype (Figs.45A-45C) are graphed versus IL2 clone treatment group.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
EP20761980.0A 2019-08-13 2020-08-13 Engineered interleukin-2 receptor beta agonists Pending EP4013774A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962886148P 2019-08-13 2019-08-13
PCT/US2020/046244 WO2021030633A1 (en) 2019-08-13 2020-08-13 Engineered interleukin-2 receptor beta agonists

Publications (1)

Publication Number Publication Date
EP4013774A1 true EP4013774A1 (en) 2022-06-22

Family

ID=72243240

Family Applications (1)

Application Number Title Priority Date Filing Date
EP20761980.0A Pending EP4013774A1 (en) 2019-08-13 2020-08-13 Engineered interleukin-2 receptor beta agonists

Country Status (8)

Country Link
US (1) US20230002466A1 (https=)
EP (1) EP4013774A1 (https=)
JP (2) JP7783164B2 (https=)
KR (1) KR20220044534A (https=)
CN (1) CN114787182A (https=)
AU (1) AU2020329290A1 (https=)
CA (1) CA3147677A1 (https=)
WO (1) WO2021030633A1 (https=)

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11633488B2 (en) 2020-01-10 2023-04-25 Bright Peak Therapeutics Ag Modified IL-2 polypeptides and uses thereof
CA3169095A1 (en) * 2020-03-05 2021-09-10 Kenan Christopher GARCIA Designed il-2 variants
WO2022115865A2 (en) 2020-11-25 2022-06-02 Xilio Development, Inc. Tumor-specific cleavable linkers
IL304365B2 (en) 2021-03-31 2025-04-01 Hanmi Pharmaceutical Co Ltd A novel conjugate of an IL2 immunostimulatory analog and method of preparation thereof
CN113603791A (zh) * 2021-08-11 2021-11-05 厦门目青股权投资合伙企业(有限合伙) 一种融合蛋白及其应用
CN119731199A (zh) * 2022-05-10 2025-03-28 艾佩斯瑞生物制药公司 工程化的白细胞介素-2受体β降低结合的激动剂
WO2025010341A2 (en) * 2023-07-05 2025-01-09 The Trustees Of Dartmouth College Cytokine hybrid proteins and methods related thereto

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4604377A (en) 1984-03-28 1986-08-05 Cetus Corporation Pharmaceutical compositions of microbially produced interleukin-2
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
ATE332368T1 (de) 1997-01-21 2006-07-15 Gen Hospital Corp Selektion von proteinen mittels rns-protein fusionen
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
PL209392B1 (pl) 1999-01-15 2011-08-31 Genentech Inc Przeciwciało, komórka gospodarza, sposób wytwarzania przeciwciała oraz zastosowanie przeciwciała
ES2248127T3 (es) 1999-10-04 2006-03-16 Medicago Inc. Metodo para regular la transcripcion de genes foraneos en presencia de nigtrogeno.
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2003059934A2 (en) 2001-12-21 2003-07-24 Human Genome Sciences, Inc. Albumin fusion proteins
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
US8388955B2 (en) 2003-03-03 2013-03-05 Xencor, Inc. Fc variants
HUE027902T2 (en) 2004-02-09 2016-11-28 Human Genome Sciences Inc Corp Service Company Albumin fusion proteins
AU2005304624B2 (en) 2004-11-12 2010-10-07 Xencor, Inc. Fc variants with altered binding to FcRn
AU2007271398B2 (en) * 2006-07-06 2013-06-20 Merck Patent Gmbh Compositions and methods for enhancing the efficacy of IL-2 mediated immune responses
CA2860170C (en) 2010-12-22 2022-06-14 The Board Of Trustees Of The Leland Stanford Junior University Superagonists and antagonists of interleukin-2
SG192673A1 (en) * 2011-02-10 2013-09-30 Roche Glycart Ag Mutant interleukin-2 polypeptides
WO2012119093A1 (en) 2011-03-03 2012-09-07 Board Of Trustees Of The Leland Stanford Junior University Superagonists and antagonists of interleukin-2
CN109535259A (zh) * 2012-12-05 2019-03-29 生控基因疫苗股份有限公司 用作诱发抗原特异性t细胞反应的免疫原性增强剂的融合蛋白
WO2015164815A1 (en) * 2014-04-24 2015-10-29 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
CN107207603A (zh) * 2015-02-03 2017-09-26 吉安特科技股份有限公司 趋化因子‑免疫球蛋白融合多肽,其组合物、制备方法以及用途
US11655452B2 (en) * 2015-06-25 2023-05-23 Icell Gene Therapeutics Inc. Chimeric antigen receptors (CARs), compositions and methods of use thereof
MX2021000801A (es) * 2018-07-24 2021-04-12 BioNTech SE Agonistas de il2.

Also Published As

Publication number Publication date
JP2026032136A (ja) 2026-02-25
WO2021030633A1 (en) 2021-02-18
JP2022544785A (ja) 2022-10-21
CA3147677A1 (en) 2021-02-18
AU2020329290A1 (en) 2022-03-24
CN114787182A (zh) 2022-07-22
US20230002466A1 (en) 2023-01-05
JP7783164B2 (ja) 2025-12-09
KR20220044534A (ko) 2022-04-08

Similar Documents

Publication Publication Date Title
JP7783164B2 (ja) 改変インターロイキン2受容体ベータアゴニスト
US11208459B2 (en) Constructs having a SIRP-alpha domain or variant thereof
JP7098725B2 (ja) 二重特異性2+1コントースボディ
US20230227584A1 (en) Bispecific antibodies comprising a modified c-terminal crossfab fragment
JP7148539B2 (ja) 免疫抱合体
JP6464255B2 (ja) 二重特異性t細胞活性化抗原結合分子
CN103492411B (zh) 突变体白介素-2多肽
JP2021528988A (ja) 新規の二重特異性アゴニスト4−1bb抗原結合分子
US20240376171A1 (en) Protease-activated polypeptides
JP2025500949A (ja) アゴニストltbr抗体及びそれらを含む二重特異性抗体
AU2021393752A1 (en) Ph-dependent mutant interleukin-2 polypeptides
AU2022387275A1 (en) Immunotherapeutic proteins comprising an fc region component with a mutation at position 429
US20250326813A1 (en) Engineered interleukin-2 receptor beta reduced-binding agonist
HK40076453A (en) Engineered interleukin-2 receptor beta agonists
HK40102926A (zh) 带电荷对的双特异性抗体及其应用
HK40078517A (en) 4-1bb and ox40 binding proteins and related compositions and methods, antibodies against 4-1bb, antibodies against ox40
HK1257372B (zh) 具有SIRP-α结构域或其变体的构建体

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20220303

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS