EP3612563A1 - Multispecific molecules and uses thereof - Google Patents
Multispecific molecules and uses thereofInfo
- Publication number
- EP3612563A1 EP3612563A1 EP18723168.3A EP18723168A EP3612563A1 EP 3612563 A1 EP3612563 A1 EP 3612563A1 EP 18723168 A EP18723168 A EP 18723168A EP 3612563 A1 EP3612563 A1 EP 3612563A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- antibody
- seq
- molecule
- multispecific molecule
- ccr2
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3061—Blood cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2893—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD52
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- Multispecific molecules targeting tumor associated macrophages TAMs
- myeloid derived suppressor cells MDSCs
- the disclosure relates, inter alia, to novel multispecific molecules comprising: (i) a first immunosuppressive myeloid cell (IMC) binding moiety (e.g., a first tumor associated macrophage (TAM) binding moiety; or a first myeloid derived suppressor cell (MDSC) binding moiety) (e.g., an antibody molecule); and (ii) a second IMC binding moiety (e.g., a first TAM binding moiety; or a second MDSC binding moiety) (e.g., an antibody molecule), wherein the first and the second IMC (e.g., TAM or MDSC) binding moieties are different.
- IMC immunosuppressive myeloid cell
- TAM tumor associated macrophage
- MDSC myeloid derived suppressor cell
- multispecific molecules disclosed herein are expected to deplete TAMs and/or MDSCs. Accordingly, provided herein are, inter alia, multispecific molecules (e.g., multispecific antibody molecules) that include the aforesaid moieties, nucleic acids encoding the same, methods of producing the aforesaid molecules, and methods of treating a cancer using the aforesaid molecules.
- multispecific molecules e.g., multispecific antibody molecules
- isolated multispecific e.g., a bispecific, molecules, comprising: (i) a first immunosuppressive myeloid cell (IMC) binding moiety (e.g., a first tumor associated macrophage (TAM) binding moiety; or a first myeloid derived suppressor cell (MDSC) binding moiety) (e.g., an antibody molecule); and (ii) a second IMC binding moiety (e.g., a second TAM binding moiety; or a second MDSC binding moiety) (e.g., an antibody molecule), wherein the first and the second IMC (e.g., TAM or MDSC) binding moieties are different.
- IMC immunosuppressive myeloid cell
- TAM tumor associated macrophage
- MDSC myeloid derived suppressor cell
- first and the second IMC (e.g., TAM or MDSC) binding moieties bind to different epitopes. In some embodiments, the first and the second IMC (e.g., TAM or MDSC) binding moieties bind to different antigens.
- the first IMC binding moiety is a first MDSC binding moiety; and the second IMC binding moiety is a second MDSC binding moiety. In some embodiments, the first IMC binding moiety is a first TAM binding moiety; and the second IMC binding moiety is a second TAM binding moiety.
- the first TAM binding moiety binds to CSFIR, CCR2, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-Ll; and the second TAM binding moiety binds to CCR2, CSFIR, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-Ll .
- the first TAM binding moiety binds to CSFIR, CCR2, CXCR2, or PD-Ll (e.g., human CSFIR, CCR2, CXCR2, or PD-Ll) and the second TAM binding moiety binds to CCR2, CSFIR, CXCR2, or PD-Ll (e.g., human CCR2, CSFIR, CXCR2, or PD-Ll).
- the first TAM binding moiety binds to CSFIR and the second TAM binding moiety binds to CCR2.
- the first TAM binding moiety binds to CSFIR and the second TAM binding moiety binds to CXCR2.
- the first TAM binding moiety binds to CCR2 and the second TAM binding moiety binds to CXCR2. In some embodiments, the first TAM binding moiety binds to CSFIR and the second TAM binding moiety binds to PD-Ll. In some embodiments, the first TAM binding moiety binds to CCR2 and the second TAM binding moiety binds to PD-Ll. In some embodiments, the first TAM binding moiety binds to CXCR2 and the second TAM binding moiety binds to PD-Ll.
- the first TAM binding moiety binds to CSFIR, CCR2, CXCR2, or PD-Ll with a dissociation constant of less than about 10 nM, and more typically, 10 - 100 pM; and the second TAM binding moiety binds to CCR2, CSFIR, CXCR2, or PD-Ll with a dissociation constant of less than about 10 nM, and more typically, 10 - 100 pM.
- the first TAM binding moiety binds to a conformational or a linear epitope on CSF1R, CCR2, CXCR2, or PD-L1; and the second TAM binding moiety binds to a conformational or a linear epitope on CCR2, CSF1R, CXCR2, or PD-L1.
- the multispecific molecule comprises at least two non-contiguous polypeptide chains.
- the first IMC binding moiety comprises a first anti- IMC antibody molecule and/or the second IMC binding moiety comprises a second anti-IMC antibody molecule.
- the first anti-IMC antibody molecule and the second anti-IMC antibody molecule are, independently, a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv, a scFv, a single domain antibody, or a diabody (dAb)).
- a full antibody e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
- an antigen-binding fragment e.g., a Fab, F(ab')2, Fv,
- the first anti-IMC antibody molecule and/or the second anti-IMC antibody molecule comprises a heavy chain constant region chosen from IgGl, IgG2, IgG3, or IgG4, or a fragment thereof.
- the first anti-IMC antibody molecule and/or the second anti-IMC antibody molecule comprises a light chain constant region chosen from the light chain constant regions of kappa or lambda, or a fragment thereof.
- the first anti-IMC antibody molecule comprises a kappa light chain constant region, or a fragment thereof
- the second anti-IMC antibody molecule comprises a lambda light chain constant region, or a fragment thereof.
- the first anti-IMC antibody molecule comprises a lambda light chain constant region, or a fragment thereof
- the second anti-IMC antibody molecule comprises a kappa light chain constant region, or a fragment thereof.
- the first anti-IMC antibody molecule and the second anti-IMC antibody molecule have a common light chain variable region.
- the multispecific molecule further comprises a heavy chain constant region (e.g., an Fc region) chosen from the heavy chain constant regions of IgGl, IgG2, and IgG4, more particularly, the heavy chain constant region of human IgGl, IgG2 or IgG4.
- the heavy chain constant region e.g., an Fc region
- the heavy chain constant region is linked to, e.g., covalently linked to, one or both of the first anti-IMC antibody molecule and the second anti- IMC antibody molecule.
- the heavy chain constant region e.g., an Fc region
- the heavy chain constant region is altered, e.g., mutated, to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function.
- an interface of a first and second heavy chain constant regions e.g., Fc region
- the dimerization of the heavy chain constant region is enhanced by providing an Fc interface of a first and a second Fc region with one or more of: a paired cavity-protuberance ("knob-in-a hole"), an electrostatic interaction, or a strand-exchange, such that a greater ratio of heteromultimenhomomultimer forms, e.g., relative to a non-engineered interface.
- the heavy chain constant region (e.g., Fc region) comprises an amino acid substitution at a position chosen from one or more of 347, 349, 350, 351, 366, 368, 370, 392, 394, 395, 397, 398, 399, 405, 407, or 409, e.g., of the Fc region of human IgGl, numbered based on the Eu numbering system.
- the heavy chain constant region (e.g., Fc region) comprises an amino acid substitution chosen from: T366S, L368A, or Y407V (e.g., corresponding to a cavity or hole), or T366W (e.g.,
- the heavy chain constant region (e.g., an Fc region) comprises one or more mutations that increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function, relative to a naturally-existing heavy chain constant region.
- the first anti- IMC antibody molecule comprises a first heavy chain constant region (e.g., a first Fc region) and the second anti-IMC antibody molecule comprises a second heavy chain constant region (e.g., a second Fc region), wherein the first heavy chain constant region comprises one or more mutations that increase heterodimerization of the first heavy chain constant region and the second heavy chain constant region, relative to a naturally-existing heavy chain constant region, and/or wherein the second heavy chain constant region comprises one or more mutations that increase heterodimerization of the second heavy chain constant region and the first heavy chain constant region, relative to a naturally-existing heavy chain constant region.
- the first heavy chain constant region comprises one or more mutations that increase heterodimerization of the first heavy chain constant region and the second heavy chain constant region, relative to a naturally-existing heavy chain constant region
- the second heavy chain constant region comprises one or more mutations that increase heterodimerization of the second heavy chain constant region and the first heavy chain constant region, relative to a naturally-existing
- the first and the second heavy chain constant regions comprise one or more of: a paired cavity-protuberance ("knob-in-a hole"), an electrostatic interaction, or a strand-exchange, such that a greater ratio of
- the first and/or second heavy chain constant region (e.g., a first and/or second Fc region, e.g., a first and/or second IgGl Fc region) comprises an amino acid substitution at a position chosen from one or more of 347, 349, 350, 351, 366, 368, 370, 392, 394, 395, 397, 398, 399, 405, 407, or 409, numbered based on the Eu numbering system.
- the first and/or second heavy chain constant region (e.g., a first and/or second Fc region, e.g., a first and/or second IgGl Fc region) comprises an amino acid
- the multispecific molecule further comprises a linker, e.g., a linker between one or more of: the first anti-IMC antibody molecule and the second anti-IMC antibody molecule, the first anti-IMC antibody molecule and the heavy chain constant region (e.g., the Fc region), or the second anti-IMC antibody molecule and the heavy chain constant region.
- the linker is chosen from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker.
- the linker is a peptide linker.
- the peptide linker comprises Gly and Ser.
- the heavy chain constant region e.g., Fc region
- ADCC antibody dependent cellular cytotoxicity
- the first or the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 48, SEQ ID NO: 66, or SEQ ID NO: 69, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative
- substitutions from a CDR of SEQ ID NO: 48, SEQ ID NO: 66, or SEQ ID NO: 69; and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 50, SEQ ID NO: 67, or SEQ ID NO: 70, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. ,
- the antibody molecule that binds to CSF1R comprises the heavy chain variable region sequence of: SEQ ID NO: 48, SEQ ID NO: 66, or SEQ ID NO: 69, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- the first or the second TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 44, SEQ ID NO: 54, SEQ ID NO: 59, SEQ ID NO: 62, SEQ ID NO: 64, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 44, SEQ ID NO: 54, SEQ ID NO: 59, SEQ ID NO: 62, SEQ ID NO: 64 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 45, SEQ ID NO: 57, SEQ ID NO: 60, SEQ ID NO: 63, SEQ ID NO: 65, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the antibody molecule that binds to CCR2 comprises the heavy chain variable region sequence of: SEQ ID NO: 44, SEQ ID NO: 54, SEQ ID NO: 59, SEQ ID NO: 62, SEQ ID NO: 64, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 44, SEQ ID NO: 54, SEQ ID NO: 59, SEQ ID NO: 62, SEQ ID NO: 64 and/or comprises the light chain variable region sequence of: SEQ ID NO: 45, SEQ ID NO: 57, SEQ ID NO: 60, SEQ ID NO: 63, SEQ ID NO: 65, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 44, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 44 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 45, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 48, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 48 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 50, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 50.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 54, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 54 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 57, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 66, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. ,
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 66 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 67, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 67.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 54, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 54 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 57, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 69, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 69 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 70, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 70.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 59, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 59 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 60, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 66, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 66 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 67, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 67.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 59, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 59 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 60, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 69, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 69 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 70, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 70,
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 62, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 62 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 63, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 66, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 66 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 67, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 67,
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 62, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 62 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 63, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 69, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 69 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 70, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 70.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 64, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 64 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 65, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 66, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 66 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 67, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 67.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 64, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 64 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 65, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 69, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 69 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 70, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) from a CDR of SEQ ID NO: 70.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 44, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 44 and/or comprises the light chain variable region sequence of: SEQ ID NO: 45, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 48, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 48 and/or comprises the light chain variable region sequence of: SEQ ID NO: 50, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 50.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 54, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 54 and/or comprises the light chain variable region sequence of: SEQ ID NO: 57, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 66, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 66 and/or comprises the light chain variable region sequence of: SEQ ID NO: 67, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 67,
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 54, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 54 and/or comprises the light chain variable region sequence of: SEQ ID NO: 57, or a an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 69, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 69 and/or comprises the light chain variable region sequence of: SEQ ID NO: 70, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 70.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 59, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 59 and/or comprises the light chain variable region sequence of: SEQ ID NO: 60, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 66, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 66 and/or comprises the light chain variable region sequence of: SEQ ID NO: 67, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 67.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 59, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 59 and/or comprises the light chain variable region sequence of: SEQ ID NO: 60, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 69, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 69 and/or comprises the light chain variable region sequence of: SEQ ID NO: 70, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 70
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 62, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 62 and/or comprises the light chain variable region sequence of: SEQ ID NO: 63, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 66, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 66 and/or comprises the light chain variable region sequence of: SEQ ID NO: 67, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 67,
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 62, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 62 and/or comprises the light chain variable region sequence of: SEQ ID NO: 63, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 69, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 69 and/or comprises the light chain variable region sequence of: SEQ ID NO: 70, an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 70.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 64, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 64 and/or comprises the light chain variable region sequence of: SEQ ID NO: 65, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 66, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 66 and/or comprises the light chain variable region sequence of: SEQ ID NO: 67, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 67.
- the first TAM binding moiety is an antibody molecule that binds to CCR2 and comprises the heavy chain variable region sequence of: SEQ ID NO: 64, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 64 and/or comprises the light chain variable region sequence of: SEQ ID NO: 65, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- the second TAM binding moiety is an antibody molecule that binds to CSF1R and comprises the heavy chain variable region sequence of: SEQ ID NO: 69, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- amino acid sequence of SEQ ID NO: 69 and/or comprises the light chain variable region sequence of: SEQ ID NO: 70, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g. , substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 70.
- the first or the second TAM binding moiety is an antibody molecule that binds to PD-L1 and comprises one, two, or three CDRs from the heavy chain variable region sequence of: SEQ ID NO: 109, SEQ ID NO: 111, or SEQ ID NO: 113, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- substitutions, deletions, or insertions e.g., conservative substitutions
- a CDR of SEQ ID NO: 109, SEQ ID NO: 111, or SEQ ID NO: 113 and/or comprises one, two, or three CDRs from the light chain variable region sequence of: SEQ ID NO: 110, SEQ ID NO: 112, or SEQ ID NO: 114, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g.
- the antibody molecule that binds to PD-L1 comprises the heavy chain variable region sequence of: SEQ ID NO: 109, SEQ ID NO: 111, or SEQ ID NO: 113, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 109, SEQ ID NO: 111, or SEQ ID NO:
- SEQ ID NO: 110 comprises the light chain variable region sequence of: SEQ ID NO: 110, SEQ ID NO: 112, or SEQ ID NO: 114, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 110, SEQ ID NO: 112, or SEQ ID NO:
- the first IMC binding moiety binds to a first antigen (e.g., CSFIR, CCR2, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-L1) monovalently
- a first antigen e.g., CSFIR, CCR2, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-L1
- a second antigen e.g., CCR2, CSFIR, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-L1 monovalently, wherein the first antigen is different from the second antigen.
- the multispecific molecule binds to a first antigen (e.g., CSFIR, CCR2, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-L1) monovalently, and/or (ii) the multispecific molecule binds to a second antigen (e.g., CCR2, CSFIR, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-L1) monovalently, wherein the first antigen is different from the second antigen.
- a first antigen e.g., CSFIR, CCR2, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD52, folate receptor beta, or PD-L1
- a second antigen e.g., CCR2, CSFIR, CXCR2, CD86, CD163, CX3CR1, MARCO, CD204, CD
- the multispecific molecule inhibits a first antigen in the presence of a second antigen, optionally wherein the multispecific molecule reduces an activity of the first antigen in a cell, e.g., by at least 40, 50, 60, 70, 80, or 90%, when the cell expresses both the first antigen and the second antigen on the cell surface, and/or (ii) the multispecific molecule does not inhibit or does not substantially inhibit the first antigen in the absence of the second antigen, optionally wherein the multispecific molecule does not reduce an activity of the first antigen, or does not reduce an activity of the first antigen by more than 2, 4, 6, 8, 10, or 15%, when the cell expresses the first antigen but not the second antigen on the cell surface.
- the multispecific molecule inhibits a second antigen in the presence of a first antigen, optionally wherein the multispecific molecule reduces an activity of the second antigen in a cell, e.g., by at least 40, 50, 60, 70, 80, or 90%, when the cell expresses both the first antigen and the second antigen on the cell surface, and/or (ii) the multispecific molecule does not inhibit or does not substantially inhibit the second antigen in the absence of the first antigen, optionally wherein the multispecific molecule does not reduce an activity of the second antigen, or does not reduce an activity of the second antigen by more than 2, 4, 6, 8, 10, or 15%, when the cell expresses the second antigen but not the first antigen on the cell surface.
- the multispecific molecule further comprises one or more additional binding moieties (e.g., a third binding moiety, a fourth binding moiety, (e.g., a trispecific or a tetraspecific molecule). In some embodiments, the multispecific molecule further comprises one or more additional binding moieties (e.g., a third binding moiety, a fourth binding moiety, (e.g., a trispecific or a tetraspecific molecule). In some embodiments, the multispecific molecule comprises a third TAM binding moiety (e.g., an antibody molecule), wherein the third TAM binding moiety is different from the first and the second TAM binding moieties. In some embodiments, the first TAM binding moiety binds to human CSF1R, the second TAM binding moiety binds to human CCR2, and the third TAM binding moiety binds to CXCR2.
- additional binding moieties e.g., a third binding moiety, a fourth binding moiety, (e.
- the multispecific molecule comprises a third binding moiety (e.g., antibody molecule) that is a tumor targeting moiety.
- the tumor targeting moiety binds to PD-L1, mesothelin, CD47, gangloside 2 (GD2), prostate stem cell antigen (PSCA), prostate specific membrane antigen (PMSA), pro state- specific antigen (PSA), carcinoembryonic antigen (CEA), Ron Kinase, c-Met, Immature laminin receptor, TAG-72, BING-4, Calcium-activated chloride channel 2, Cyclin-B l, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, SAP-1, Survivin, NY-ESO-l/LAGE-1, PRAME, SSX-2, Melan- A/MART- 1 , Gpl00/pmell7, Tyrosinase, TRP-1/-2, MC1R, ⁇ -catenin, BRCAl/2, CD
- the multispecific molecule is a bispecific molecule comprising a first and a second non-contiguous polypeptides, wherein: (i) the first polypeptide includes, e.g., in the N- to C-orientation, the first TAM binding moiety (e.g., an antibody molecule (e.g., a first portion of a first antigen domain, e.g., a first VH-CH1 of a Fab molecule)), that binds to, e.g., a first TAM antigen, e.g., CSFIR, CCR2, CXCR2, or PD-Ll, connected, optionally via a linker to, a first domain that promotes association between the first and the second polypeptide (e.g., a first immunoglobulin constant domain (e.g., a first Fc molecule as described herein); (ii) the second polypeptide includes, e.g., in the N- to C-orientation,
- the multispecific molecule is a bispecific molecule, wherein:
- the first TAM binding moiety (e.g., a binding moiety that binds to a first TAM antigen, e.g., CSFIR, CCR2, or CXCR2) comprises a first and a second non-contiguous polypeptides, and
- the second TAM binding moiety (e.g., a binding moiety that binds to a second TAM antigen, e.g., CSFIR, CCR2, or CXCR2) comprises a third and a fourth non-contiguous polypeptides, wherein:
- the first polypeptide comprises, e.g., in the N- to C-orientation, a first VH, a first CHI, connected, optionally via a linker, to a first domain (e.g., a first Fc region) that promotes association between the first and the third polypeptides,
- the second polypeptide comprises, e.g., in the N- to C-orientation, a first VL and a first CL,
- the third polypeptide comprises, e.g., in the N- to C-orientation, a second VH, a second CHI, connected, optionally via a linker, to a second domain (e.g., a second Fc region) that promotes association between the first and the third polypeptides
- the fourth polypeptide comprises, e.g., in the N- to C-orientation, a second VL and a second CL.
- the first and the second domains e.g., the first and the second Fc regions
- the invention provides an isolated multispecific, e.g., a bispecific, molecule, comprising (i) an anti-CSFIR binding moiety (e.g., an anti-CSFIR antibody molecule); and (ii) an anti-CCR2 binding moiety (e.g., an anti-CCR2 antibody molecule).
- an anti-CSFIR binding moiety e.g., an anti-CSFIR antibody molecule
- an anti-CCR2 binding moiety e.g., an anti-CCR2 antibody molecule
- the anti-CSFlR/anti-CCR2 multispecific molecule may preferentially bind to a CSFlR-positive, CCR2-positive cell relative to a CSFlR-positve, CCR2- negative cell, or a CSFlR-negative, CCR2-positive cell.
- exemplary CSFlR-positive, CCR2- positive cell include, but are not limited to, tumor-associated macrophages (TAMs) and myeloid derived suppressor cells (MDSCs).
- TAMs tumor-associated macrophages
- MDSCs myeloid derived suppressor cells
- Exemplary CSFlR-positive, CCR2-negative cells include, but are not limited to, tissue-resident macrophages (e.g., Kupffer cells), and Langerhans cells.
- Exemplary CSFlR-negative, CCR2-positive cells include, but are not limited to, T cells (e.g., activated T cells, e.g., activated CD4+ and/or CD8+ T cells), NK cells, and neutrophils.
- T cells e.g., activated T cells, e.g., activated CD4+ and/or CD8+ T cells
- NK cells e.g., activated CD4+ and/or CD8+ T cells
- neutrophils e.g., neutrophils.
- the anti-CSFlR/anti-CCR2 multispecific molecule may preferentially bind to CSFlR-positive, CCR2-positive cells (e.g., pro-tumorigenic TAMs or MDSCs) relative to CSFlR-positve, CCR2-negative cells (e.g., tissue-resident macrophages (e.g., Kupffer cells), or Langerhans cells), or CSFlR-negative, CCR2-positive cells (e.g., activated T cells or NK cells).
- CCR2-positive cells e.g., pro-tumorigenic TAMs or MDSCs
- CCR2-negative cells e.g., tissue-resident macrophages (e.g., Kupffer cells), or Langerhans cells
- CSFlR-negative, CCR2-positive cells e.g., activated T cells or NK cells.
- the anti-CSFlR/anti-CCR2 multispecific molecule when it binds to a target cell, may induce antibody-dependent cellular cytotoxicity (ADCC) or complement- dependent cytotoxicity (CDC) of the target cell.
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement- dependent cytotoxicity
- the anti-CSFlR/anti- CCR2 multispecific molecule may preferentially bind to and reduce the number of
- immunosuppressive myeloid cells in the tumor microenvironment e.g., TAMs or MDSCs
- sparing homeostatic myeloid cells e.g., tissue-resident macrophages (e.g., Kupffer cells)
- other anti-tumor immune cells e.g., activated T cells and NK cells. Depletion of homeostatic myeloid cells may be partially responsible for adverse events in patients receiving anti-CSFIR antibody therapies.
- the multispecific molecule has one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or more) of the following properties: (i) the multispecific molecule preferentially binds to a CSFlR-positive, CCR2-positive cell relative to a CSFlR-positve, CCR2-negative cell, or a CSFlR-negative, CCR2-positive cell, e.g., the binding of the multispecific molecule to the CSFlR-positive, CCR2-positive cell is at least 2, 4, 6, 8, 10, 15, 20, or 25-fold stronger than the binding of the multispecific molecule to the CSFlR-positve, CCR2-negative cell, or the CSFlR-negative, CCR2-positive cell, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in
- the multispecific molecule preferentially binds to a CSFlR-positive, CCR2-positive cell relative to a CSFlR-positve, CCR2-negative cell, e.g., the EC50 of the multispecific molecule for binding to a CSFlR-positive, CCR2-positive cell is no more than 60, 50, 40, 30, 20, or 10 % of the EC50 of the multispecific molecule for binding to a CSFlR-positve, CCR2- negative cell, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 2 with respect to FIG. 1;
- the multispecific molecule preferentially binds to a CSFlR-positive, CCR2-positive cell relative to a CSFlR-negative, CCR2-positive cell, e.g., the EC50 of the multispecific molecule for binding to a CSFlR-positive, CCR2-positive cell is no more than 50, 40, 30, 20, 10, or 5% of the EC50 of the multispecific molecule for binding to a CSFlR-negative, CCR2- positive cell, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 2 with respect to FIG. 1;
- the multispecific molecule preferentially binds to tumor-associated macrophages (TAMs) or myeloid derived suppressor cells (MDSCs) relative to T cells, NK cells, neutrophils, tissue-resident macrophages (e.g., Kupffer cells), or Langerhans cells, e.g., the binding of the multispecific molecule to TAMs or MDSCs is at least 2, 4, 6, 8, 10, 15, 20, or 25-fold stronger than the binding of the multispecific molecule to T cells, NK cells, neutrophils, tissue-resident macrophages (e.g., Kupffer cells), or Langerhans cells, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 6 with respect to FIG. 5;
- TAMs tumor-associated macrophages
- MDSCs myeloid derived suppressor cells
- the multispecific molecule inhibits monocyte migration, e.g., monocyte
- chemoattractant protein 1 (MCPl)-induced monocyte migration e.g., reduces MCPl-induced monocyte migration by at least 40, 50, 60, or 70%, e.g., as measured using a transwell plate migration assay, e.g., as measured using methods described in Example 3 with respect to FIG.
- the multispecific molecule inhibits the proliferation of macrophages, e.g., bone marrow-derived macrophages, e.g., CSF-l-induced proliferation of bone marrow -derived macrophages, e.g., reduces CSF-l-induced proliferation of bone marrow-derived macrophages by at least 50, 60, 70, or 80%, e.g., as measured using a cell proliferation MTT assay, e.g., as measured using methods described in Example 4 with respect to FIG. 3B;
- macrophages e.g., bone marrow-derived macrophages
- CSF-l-induced proliferation of bone marrow -derived macrophages e.g., reduces CSF-l-induced proliferation of bone marrow-derived macrophages by at least 50, 60, 70, or 80%, e.g., as measured using a cell proliferation MTT assay, e.g., as measured using methods described in Example 4 with respect to
- the multispecific molecule does not inhibit or does not substantially inhibit the differentiation of monocytes, e.g., bone marrow-derived monocytes, e.g., CSF-l-induced differentiation of bone marrow -derived monocytes, e.g., does not reduce CSF-l-induced differentiation of bone marrow -derived monocytes by more than 2, 4, 6, 8, or 10%, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 5 with respect to FIG. 4;
- monocytes e.g., bone marrow-derived monocytes, e.g., CSF-l-induced differentiation of bone marrow -derived monocytes, e.g., does not reduce CSF-l-induced differentiation of bone marrow -derived monocytes by more than 2, 4, 6, 8, or 10%, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 5 with respect to FIG
- the multispecific molecule depletes suppressive myeloid cells, e.g., TAMs or MDSCs, e.g., reduces the number of suppressive myeloid cells, e.g., TAMs or MDSCs, by at least 80, 85, 90, 95, 99, or 99.5%, in vivo, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 7 with respect to FIG. 6;
- the multispecific molecule does not deplete or does not substantially deplete tissue- resident macrophages, e.g., Kupffer cells, e.g., does not reduce the number of tissue-resident macrophages, e.g., Kupffer cells, by more than 4, 6, 8, 10, or 15%, in vivo, e.g., as measured using an immunohistochemistry analysis, e.g., as measured using methods described in Example 8 with respect to FIGs. 7B and 7D;
- the multispecific molecule does not inhibit or does not substantially inhibit CSF-1 dependent cell survival of CSFlR-positive, CCR2-negative cells, e.g., does not reduce CSF-1 dependent cell survival of CSFlR-positive, CCR2-negative cells by more than 5, 10, or 15%, e.g., as measured using a cell viability MTT assay, e.g., as measured using methods described in Example 9 with respect to FIG. 8A;
- the multispecific molecule increases CD8+ T cell tumor infiltration in vivo, e.g., increases % CD8+ T cells in CD3+ T cells in tumor by at least 1.5, 2, or 2.5-fold, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 10 with respect to FIG. 9;
- the multispecific molecule reduces Treg frequency in tumor in vivo, e.g., reduces Treg frequency in tumor by at least 15, 20, 25, or 30%, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 11 with respect to FIG. 10A;
- the multispecific molecule increases the CD8+ T cell/Treg ratio in tumor in vivo, e.g., increases the CD8+ T cell/Treg ratio in tumor by at least 2.5, 3, 3.5, 4, or 4.5-fold, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in
- the multispecific molecule reduces tumor growth and/or increases survival of a tumor-bearing animal, e.g., as measured using methods described in Example 12 with respect to FIGs. HA and 11B.
- the multispecific molecule preferentially binds to a CSF1R- positive, CCR2-positive cell relative to a CSFlR-positve, CCR2-negative cell, or a CSFlR- negative, CCR2-positive cell, e.g., the binding of the multispecific molecule to the CSF1R- positive, CCR2-positive cell is at least 2, 4, 6, 8, 10, 15, 20, or 25-fold stronger than the binding of the multispecific molecule to the CSFlR-positve, CCR2-negative cell, or the CSFlR-negative, CCR2-positive cell, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 2 with respect to FIG. 1.
- the multispecific molecule preferentially binds to a CSF1R- positive, CCR2-positive cell relative to a CSFlR-positve, CCR2-negative cell, e.g., the EC50 of the multispecific molecule for binding to a CSFlR-positive, CCR2-positive cell is no more than 60, 50, 40, 30, 20, or 10 % of the EC50 of the multispecific molecule for binding to a CSFlR- positve, CCR2-negative cell, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 2 with respect to FIG. 1.
- the multispecific molecule preferentially binds to a CSF1R- positive, CCR2-positive cell relative to a CSFlR-negative, CCR2-positive cell, e.g., the EC50 of the multispecific molecule for binding to a CSFlR-positive, CCR2-positive cell is no more than 50, 40, 30, 20, 10, or 5% of the EC50 of the multispecific molecule for binding to a CSFlR- negative, CCR2-positive cell, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 2 with respect to FIG. 1.
- the multispecific molecule preferentially binds to tumor- associated macrophages (TAMs) or myeloid derived suppressor cells (MDSCs) relative to T cells, NK cells, neutrophils, tissue-resident macrophages (e.g., Kupffer cells), or Langerhans cells, e.g., the binding of the multispecific molecule to TAMs or MDSCs is at least 2, 4, 6, 8, 10, 15, 20, or 25-fold stronger than the binding of the multispecific molecule to T cells, NK cells, neutrophils, tissue-resident macrophages (e.g., Kupffer cells), or Langerhans cells, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in
- the multispecific molecule inhibits monocyte migration, e.g., monocyte chemoattractant protein 1 (MCP1) -induced monocyte migration, e.g., reduces MCP1- induced monocyte migration by at least 40, 50, 60, or 70%, e.g., as measured using a transwell plate migration assay, e.g., as measured using methods described in Example 3 with respect to FIG. 2.
- monocyte migration e.g., monocyte chemoattractant protein 1 (MCP1) -induced monocyte migration
- MCP1-induced monocyte migration e.g., reduces MCP1- induced monocyte migration by at least 40, 50, 60, or 70%, e.g., as measured using a transwell plate migration assay, e.g., as measured using methods described in Example 3 with respect to FIG. 2.
- MCP1 monocyte chemoattractant protein 1
- the multispecific molecule inhibits the proliferation of
- macrophages e.g., bone marrow-derived macrophages, e.g., CSF-l-induced proliferation of bone marrow-derived macrophages, e.g., reduces CSF-l-induced proliferation of bone marrow- derived macrophages by at least 50, 60, 70, or 80%, e.g., as measured using a cell proliferation MTT assay, e.g., as measured using methods described in Example 4 with respect to FIG. 3B.
- the multispecific molecule does not inhibit or does not
- substantially inhibit the differentiation of monocytes e.g., bone marrow-derived monocytes, e.g., CSF-l-induced differentiation of bone marrow-derived monocytes, e.g., does not reduce CSF-l- induced differentiation of bone marrow-derived monocytes by more than 2, 4, 6, 8, or 10%, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 5 with respect to FIG. 4.
- the multispecific molecule depletes suppressive myeloid cells, e.g., TAMs or MDSCs, e.g., reduces the number of suppressive myeloid cells, e.g., TAMs or MDSCs, by at least 80, 85, 90, 95, 99, or 99.5%, in vivo, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 7 with respect to FIG. 6.
- the multispecific molecule does not deplete or does not substantially deplete tissue-resident macrophages, e.g., Kupffer cells, e.g., does not reduce the number of tissue-resident macrophages, e.g., Kupffer cells, by more than 4, 6, 8, 10, or 15%, in vivo, e.g., as measured using an immunohistochemistry analysis, e.g., as measured using methods described in Example 8 with respect to FIGs. 7B and 7D.
- the multispecific molecule does not inhibit or does not substantially inhibit CSF-1 dependent cell survival of CSFlR-positive, CCR2-negative cells, e.g., does not reduce CSF-1 dependent cell survival of CSFlR-positive, CCR2-negative cells by more than 5, 10, or 15%, e.g., as measured using a cell viability MTT assay, e.g., as measured using methods described in Example 9 with respect to FIG. 8A.
- the multispecific molecule increases CD8+ T cell tumor infiltration in vivo, e.g., increases % CD8+ T cells in CD3+ T cells in tumor by at least 1.5, 2, or 2.5-fold, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 10 with respect to FIG. 9.
- the multispecific molecule reduces Treg frequency in tumor in vivo, e.g., reduces Treg frequency in tumor by at least 15, 20, 25, or 30%, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 11 with respect to FIG. 10A.
- the multispecific molecule increases the CD8+ T cell/Treg ratio in tumor in vivo, e.g., increases the CD8+ T cell/Treg ratio in tumor by at least 2.5, 3, 3.5, 4, or 4.5- fold, e.g., as measured using a flow cytometry analysis, e.g., as measured using methods described in Example 11 with respect to FIG. 10B.
- the multispecific molecule reduces tumor growth and/or increases survival of a tumor-bearing animal, e.g., as measured using methods described in Example 12 with respect to FIGs. 11 A and 1 IB.
- the anti-CSFIR binding moiety and the anti-CCR2 binding moiety are, independently, a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv, a scFv, a single domain antibody, or a diabody (dAb)).
- the anti-CSFIR binding moiety and/or the anti-CCR2 binding moiety comprises a heavy chain constant region chosen from IgGl, IgG2, IgG3, or IgG4, or a fragment thereof.
- the anti-CSFIR binding moiety and/or the anti-CCR2 binding moiety comprises a heavy chain constant region that can mediate antibody-dependent cellular cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC).
- the anti-CSFIR binding moiety comprises a first heavy chain constant region (e.g., a first Fc region) and the anti-CCR2 binding moiety comprises a second heavy chain constant region (e.g., a second Fc region), wherein the first heavy chain constant region comprises one or more mutations that increase heterodimerization of the first heavy chain constant region and the second heavy chain constant region, relative to a naturally-existing heavy chain constant region, and/or wherein the second heavy chain constant region comprises one or more mutations that increase heterodimerization of the second heavy chain constant region and the first heavy chain constant region, relative to a naturally-existing heavy chain constant region.
- the anti-CSFIR binding moiety and/or the anti-CCR2 binding moiety comprises a light chain constant region chosen from the light chain constant regions of kappa or lambda, or a fragment thereof.
- the anti-CSFIR binding moiety comprises a kappa light chain constant region, or a fragment thereof, and the anti-CCR2 binding moiety comprises a lambda light chain constant region, or a fragment thereof.
- the anti-CSFIR binding moiety comprises a lambda light chain constant region, or a fragment thereof, and the anti-CCR2 binding moiety comprises a kappa light chain constant region, or a fragment thereof.
- the anti-CSFIR binding moiety and the anti-CCR2 binding moiety have a common light chain variable region.
- the multispecific molecule further comprises a heavy chain constant region (e.g., an Fc region) chosen from the heavy chain constant regions of IgGl, IgG2, and IgG4, more particularly, the heavy chain constant region of human IgGl, IgG2 or IgG4.
- the multispecific molecule further comprises a heavy chain constant region that can mediate antibody-dependent cellular cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC).
- the multispecific molecule comprises an anti-CSFIR antibody molecule and an anti-CCR2 antibody molecule, wherein:
- the anti-CSFIR antibody molecule comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first light chain variable region (VL) and a first light chain constant region (CL), and the second polypeptide comprises a first heavy chain variable region (VH), a first heavy chain constant region 1 (CHI), and optionally, a first CH2 and a first CH3, and (ii) the anti-CCR2 antibody molecule comprises a third polypeptide and a fourth polypeptide, wherein the third polypeptide comprises a second VL and a second CL, and the fourth polypeptide comprises a second VH, a second CHI, and optionally, a second CH2 and a second CH3.
- the anti-CSFIR antibody molecule binds to CSFIR
- the multispecific molecule binds to CSFIR monovalently, and/or binds to CCR2 monovalently. In some embodiments, the multispecific molecule binds to CSFIR monovalently, and binds to CCR2 monovalently.
- the multispecific molecule inhibits CSFIR in the presence of CCR2, optionally wherein the multispecific molecule reduces an activity of CSFIR (e.g., CSFIR signaling, e.g., CSFl-induced CSFIR signaling) in a cell, e.g., by at least 40, 50, 60, 70, 80, or 90%, when the cell expresses both CSFIR and CCR2 on the cell surface, and/or
- CSFIR e.g., CSFIR signaling, e.g., CSFl-induced CSFIR signaling
- the multispecific molecule does not inhibit or does not substantially inhibit CSFIR in the absence of CCR2, optionally wherein the multispecific molecule does not reduce an activity of CSFIR (e.g., CSFIR signaling, e.g., CSFl-induced CSFIR signaling), or does not reduce an activity of CSFIR by more than 2, 4, 6, 8, 10, or 15%, when the cell expresses CSFIR but not CCR2 on the cell surface.
- CSFIR e.g., CSFIR signaling, e.g., CSFl-induced CSFIR signaling
- the multispecific molecule inhibits CCR2 in the presence of CSFIR, optionally wherein the multispecific molecule reduces an activity of CCR2 in a cell, e.g., by at least 40, 50, 60, 70, 80, or 90%, when the cell expresses both CCR2 and CSFIR on the cell surface, and/or
- the multispecific molecule does not inhibit or does not substantially inhibit CCR2 in the absence of CSFIR, optionally wherein the multispecific molecule does not reduce an activity of CCR2, or does not reduce an activity of CCR2 by more than 2, 4, 6, 8, 10, or 15%, when the cell expresses CCR2 but not CSFIR on the cell surface.
- this invention provides an isolated multispecific, e.g., a bispecific, molecule, comprising: (i) a first binding moiety that binds to a molecule that mediates the trafficking of monocytes, e.g., inflammatory monocytes, e.g., Ly6C Hl CCR2+ CXBCRl 1 ⁇ inflammatory monocytes, optionally wherein the first binding moiety binds to CCR2; and
- a second binding moiety that binds to a molecule that mediates the maturation and/or survival of monocytes and/or macrophages at an inflamed tissue, optionally wherein the second binding moiety binds to CSF1R.
- this invention provides an isolated multispecific, e.g., a bispecific, molecule, comprising:
- a second binding moiety that reduces maturation and/or survival of monocytes and/or macrophages in the tumor microenvironment, optionally wherein the second binding moiety binds to and/or inhibits CSF1R.
- this invention provides an isolated multispecific, e.g., a bispecific, molecule, comprising (i) an anti-CSFIR binding moiety (e.g., an anti-CSFIR antibody molecule); and (ii) an anti-PD-Ll binding moiety (e.g., an anti-PD-Ll antibody molecule).
- an anti-CSFIR binding moiety e.g., an anti-CSFIR antibody molecule
- an anti-PD-Ll binding moiety e.g., an anti-PD-Ll antibody molecule
- the multispecific molecule further comprises one or more additional binding moieties (e.g., a third binding moiety, a fourth binding moiety, (e.g., a trispecific or a tetraspecific molecule), optionally wherein the third binding moiety is a third IMC binding moiety or a tumor targeting moiety.
- the tumor targeting moiety is a tumor targeting moiety disclosed in
- WO2017165464 e.g., pages 108-118 of WO2017165464, herein incorporated by reference in its entirety.
- the multispecific molecule further comprises an immune cell engager chosen from a T cell engager, an NK cell engager, a B cell engager, a dendritic cell engager, or a macrophage cell engager.
- the immune cell engager is an immune cell engager disclosed in WO2017165464, e.g., pages 119-131 of WO2017165464, herein incorporated by reference in its entirety.
- the immune cell engager binds to and activates an immune cell, e.g., an effector cell.
- the immune cell engager binds to, but does not activate, an immune cell, e.g., an effector cell.
- the immune cell engager is a T cell engager, e.g., a T cell engager that mediates binding to and activation of a T cell, or a T cell engager that mediates binding to but not activation of a T cell.
- the T cell engager binds to CD3, TCRa, TCRp, TCRy, TCRC, ICOS, CD28, CD27, HVEM, LIGHT, CD40, 4-1BB, OX40, DR3, GITR, CD30, TIMl, SLAM, CD2, or CD226, e.g., the T cell engager is an anti-CD3 antibody molecule.
- the immune cell engager is an NK cell engager, e.g., an NK cell engager that mediates binding to and activation of an NK cell, or an NK cell engager that mediates binding to but not activation of an NK cell.
- the NK cell engager is chosen from an antibody molecule, e.g., an antigen binding domain, or ligand that binds to (e.g., activates): NKp30, NKp40, NKp44, NKp46, NKG2D, DNAM1, DAP10, CD16 (e.g., CD16a, CD16b, or both), CRT AM, CD27, PSGL1, CD96, CD100 (SEMA4D), NKp80, CD244 (also known as SLAMF4 or 2B4), SLAMF6, SLAMF7, KIR2DS2, KIR2DS4, KIR3DS 1, KIR2DS3, KIR2DS5, KIR2DS 1, CD94, NKG2C, NKG2E, or CD160.
- an antibody molecule e.g., an antigen binding domain, or ligand that binds to (e.g., activates): NKp30, NKp40, NKp44, NKp46, NKG2
- the immune cell engager is a B cell engager, e.g., a CD40L, an OX40L, or a CD70 ligand, or an antibody molecule that binds to OX40, CD40 or CD70.
- a B cell engager e.g., a CD40L, an OX40L, or a CD70 ligand, or an antibody molecule that binds to OX40, CD40 or CD70.
- the immune cell engager is a macrophage cell engager, e.g., a CD2 agonist; a CD40L; an OX40L; an antibody molecule that binds to OX40, CD40 or CD70; an agonist of a Toll-like receptor (TLR) (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4) or a TLR9 agonist); CD47; or a STING agonist.
- TLR Toll-like receptor
- the immune cell engager is a dendritic cell engager, e.g., a CD2 agonist, an OX40 antibody, an OX40L, 4 IBB agonist, a Toll-like receptor agonist or a fragment thereof (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4)), CD47 agonist, or a STING agonist.
- a dendritic cell engager e.g., a CD2 agonist, an OX40 antibody, an OX40L, 4 IBB agonist, a Toll-like receptor agonist or a fragment thereof (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4)), CD47 agonist, or a STING agonist.
- the multispecific molecule further comprises a cytokine molecule.
- the cytokine molecule is chosen from interleukin-2 (IL-2), interleukin-7 (IL-7), interleukin-12 (IL-12), interleukin-15 (IL-15), interleukin-18 (IL-18), interleukin-21 (IL-21), or interferon gamma, or a fragment or variant thereof, or a combination of any of the aforesaid cytokines.
- the cytokine molecule is a cytokine molecule disclosed in WO2017165464, e.g., pages 108-118 of WO2017165464, herein incorporated by reference in its entirety.
- the multispecific molecule further comprises a stromal modifying moiety.
- the stromal modifying moiety causes one or more of: decreases the level or production of a stromal or extracellular matrix (ECM) component; decreases tumor fibrosis; increases interstitial tumor transport; improves tumor perfusion; expands the tumor microvasculature; decreases interstitial fluid pressure (IFP) in a tumor; or decreases or enhances penetration or diffusion of an agent, e.g., a cancer therapeutic or a cellular therapy, into a tumor or tumor vasculature.
- ECM stromal or extracellular matrix
- IFP interstitial fluid pressure
- the stromal modifying moiety is a stromal modifying moiety disclosed in
- WO2017165464 e.g., pages 131-136 of WO2017165464, herein incorporated by reference in its entirety.
- nucleic acid molecules encoding the multispecific molecule (e.g., antibody) of any one of the preceding claims.
- nucleic acid molecules which comprises the nucleotide sequence encoding any of the multispecific molecules described herein, or a nucleotide sequence substantially homologous thereto (e.g., at least 95% to 99.9% identical thereto).
- vectors e.g., expression vectors, comprising one or more of the nucleic acid molecules described herein.
- cells e.g., host cells, comprising the nucleic acid molecule described herein or the vector described herein.
- methods of making, e.g., producing, the multispecific molecules described herein comprising culturing the cell, e.g., the host cell, described herein, under suitable conditions, e.g., conditions suitable for gene expression and/or heterodimerization .
- compositions comprising the multispecific molecule described herein and a pharmaceutically acceptable carrier, excipient, or stabilizer.
- methods of treating a hyperproliferative disorder, a cancer, a fibrotic disorder or condition, an inflammatory disorder or condition, or an autoimmune disorder are provided herein.
- the disorder is a hyperproliferative disorder, e.g., a
- the hyperproliferative connective tissue disorder e.g., a hyperproliferative fibrotic disease
- the fibrotic (e.g., hyperproliferative fibrotic) disease is multisystemic or organ- specific.
- Exemplary fibrotic diseases include, but are not limited to, multisystemic (e.g., systemic sclerosis, multifocal fibrosclerosis, sclerodermatous graft-versus-host disease in bone marrow transplant recipients, nephrogenic systemic fibrosis, scleroderma), and organ-specific disorders (e.g., fibrosis of the lung, liver, heart, kidney, pancreas, skin and other organs).
- the fibrotic disease is chosen from liver fibrosis (e.g., liver cirrhosis, NASH, and other conditions described herein), pulmonary fibrosis (e.g., IPF), renal fibrosis, or fibrosis of the bone marrow (e.g., myelofibrosis).
- liver fibrosis e.g., liver cirrhosis, NASH, and other conditions described herein
- pulmonary fibrosis e.g., IPF
- renal fibrosis e.g., or fibrosis of the bone marrow (e.g., myelofibrosis).
- provided herein are methods of treating a cancer in a subject, comprising administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to treat the cancer.
- a cancer in a subject comprising administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to reduce the number of TAMs (e.g., the number of TAMs in or near a tumor in the subject), inhibit the proliferation of TAMs (e.g., the proliferation of TAMs in or near a tumor in the subject), or reduce or inhibit macrophage infiltration into a tumor in the subject.
- the number of TAMs e.g., the number of TAMs in or near a tumor in the subject
- the proliferation of TAMs e.g., the proliferation of TAMs in or near a tumor in the subject
- macrophage infiltration into a tumor in the subject e.g., macrophage infiltration into a tumor in the subject.
- provided herein are methods of treating a cancer in a subject by reducing a portion of a population of TAMs, comprising administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to inhibit or deplete a portion of the population of TAMs.
- kits for reducing the proliferation of a portion of a population of TAMs in a subject comprising, administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to reduce the proliferation of a portion of the population of TAMs.
- kits for inhibiting or depleting a portion of a population of TAMs in a subject having a cancer comprising administering to the subject the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to reduce the number of tumor infiltrating macrophages, inhibit the proliferation of tumor infiltrating macrophages, or reduce macrophage infiltration into a tumor.
- the cancer is a solid tumor cancer or a metastatic lesion.
- the solid tumor cancer is one or more of pancreatic cancer (e.g., pancreatic adenocarcinoma), breast cancer, colorectal cancer, lung cancer (e.g., small or non-small cell lung cancer), skin cancer (e.g., melanoma), ovarian cancer, liver cancer, or brain cancer (e.g., glioma).
- the cancer is characterized as containing TAMs, is associated with the presence of TAMs, TAMs are in and/or form part of the cancer (e.g., tumor), or TAMs have been detected in or near the solid tumor.
- the methods further comprise identifying the presence of TAMs in or near the cancer (e.g., tumor) in the subject.
- the TAMs express CXCR2 and CCR2, CCR2 and CSF1R, CSF1R and CXCR2, or CCR2, CXCR2, and CSF1R.
- the methods further comprise administering a second therapeutic treatment.
- the second therapeutic treatment comprises a therapeutic agent (e.g., a chemotherapeutic agent, a biologic agent, hormonal therapy), radiation, or surgery.
- the therapeutic agent is selected from: a chemotherapeutic agent, or a biologic agent.
- the therapeutic agent is a checkpoint inhibitor.
- the check point inhibitor is selected from the group consisting of an anti-CTLA4 antibody, an anti-PDl antibody (e.g., Nivolumab, Pembrolizumab or Pidilizumab), an anti-PD- Ll antibody, an anti-PD-L2 antibody, an anti-TIM3 antibody, an anti-LAG3 antibody, an anti- CD 160 antibody, an anti-2B4 antibody, an anti-CD80 antibody, an anti-CD86 antibody, an anti- B7-H3 (CD276) antibody, an anti-B7-H4 (VTCN1) antibody, an anti-HVEM (TNFRSF14 or CD270) antibody, an anti-BTLA antibody, an anti-KIR antibody, an anti-MHC class I antibody, an anti-MHC class II antibody, an anti-GAL9 antibody, an anti- VISTA antibody, an anti-BTLA antibody, an anti-TIGIT antibody, an anti-LAIRl antibody, and an anti-A2aR antibody.
- an anti-CTLA4 antibody e.g.
- kits for treating a cancer in a subject comprising administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to reduce the number of MDSCs (e.g., the number of MDSCs in or near a tumor in the subject), inhibit the proliferation of MDSCs (e.g., the number of MDSCs in or near a tumor in the subject), or reduce or inhibit MDSC infiltration into a tumor in the subject.
- the number of MDSCs e.g., the number of MDSCs in or near a tumor in the subject
- the proliferation of MDSCs e.g., the number of MDSCs in or near a tumor in the subject
- provided herein are methods of treating a cancer in a subject by reducing a portion of a population of MDSCs, comprising administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to inhibit or deplete a portion of the population of MDSCs.
- kits for reducing the proliferation of a portion of a population of MDSCs in a subject comprising, administering to the subject in need thereof the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to reduce the proliferation of a portion of the population of MDSCs.
- kits for inhibiting or depleting a portion of a population of MDSCs in a subject having a cancer comprising administering to the subject the multispecific molecule described herein, wherein the multispecific molecule is administered in an amount effective to reduce the number of MDSCs, inhibit the proliferation of MDSCs, or reduce MDSC infiltration into a tumor.
- the cancer is a solid tumor cancer or a metastatic lesion.
- the solid tumor cancer is one or more of pancreatic cancer (e.g., pancreatic adenocarcinoma), breast cancer, colorectal cancer, lung cancer (e.g., small or non-small cell lung cancer), skin cancer (e.g., melanoma), ovarian cancer, liver cancer, or brain cancer (e.g., glioma).
- the cancer is characterized as containing MDSCs, is associated with the presence of MDSCs, MDSCs are in and/or form part of the cancer (e.g., tumor), or MDSCs have been detected in or near the solid tumor.
- the methods further comprise identifying the presence of MDSCs in or near the cancer (e.g., tumor) in the subject.
- the methods further comprise administering a second therapeutic treatment.
- the second therapeutic treatment comprises a therapeutic agent (e.g., a chemotherapeutic agent, a biologic agent, hormonal therapy), radiation, or surgery.
- the therapeutic agent is selected from: a chemotherapeutic agent, or a biologic agent.
- the therapeutic agent is a checkpoint inhibitor.
- the check point inhibitor is selected from the group consisting of an anti-CTLA4 antibody, an anti-PDl antibody (e.g., Nivolumab, Pembrolizumab or Pidilizumab), an anti-PD- Ll antibody, an anti-PD-L2 antibody, an anti-TIM3 antibody, an anti-LAG3 antibody, an anti- CD 160 antibody, an anti-2B4 antibody, an anti-CD80 antibody, an anti-CD86 antibody, an anti- B7-H3 (CD276) antibody, an anti-B7-H4 (VTCN1) antibody, an anti-HVEM (TNFRSF14 or CD270) antibody, an anti-BTLA antibody, an anti-KIR antibody, an anti-MHC class I antibody, an anti-MHC class II antibody, an anti-GAL9 antibody, an anti- VISTA antibody, an anti-BTLA antibody, an anti-TIGIT antibody, an anti-LAIRl antibody, and an anti-A2aR antibody.
- an anti-CTLA4 antibody e.g.
- fibrotic disease or disorder in a subject in need thereof, comprising administering to the subject an effective amount of a multispecific molecule disclosed herein, thereby treating the fibrotic disease or disorder.
- the fibrotic disease or disorder is a fibrotic disease or disorder of the lung, the liver, the heart or vasculature, the kidney, the pancreas, the skin, the gastrointestinal tract, the bone marrow or a hematopoietic tissue, the nervous system, the eye, or a combination thereof.
- the fibrotic disease or disorder is lung fibrosis (e.g., Idiopathic pulmonary fibrosis (IPF)) or liver fibrosis (e.g., Nonalcoholic steatohepatitis (NASH)).
- lung fibrosis e.g., Idiopathic pulmonary fibrosis (IPF)
- liver fibrosis e.g., Nonalcoholic steatohepatitis (NASH)
- treatment of a fibrotic condition includes reducing or inhibiting one or more of: formation or deposition of tissue fibrosis; reducing the size, cellularity (e.g., fibroblast or immune cell numbers), composition; or cellular content, of a fibrotic lesion;
- reducing the collagen or hydroxyproline content, of a fibrotic lesion reducing expression or activity of a fibrogenic protein; reducing fibrosis associated with an inflammatory response; decreasing weight loss associated with fibrosis; or increasing survival.
- the fibrotic disease or disorder is primary fibrosis. In one embodiment, the fibrotic disease or disorder is idiopathic. In other embodiments, the fibrotic disease or disorder is associated with (e.g., is secondary to) a disease (e.g., an infectious disease, an inflammatory disease, an autoimmune disease, a malignant or cancerous disease, and/or a connective disease); a toxin; an insult (e.g., an environmental hazard (e.g., asbestos, coal dust, polycyclic aromatic hydrocarbons), cigarette smoking, a wound); a medical treatment (e.g., surgical incision, chemotherapy or radiation), or a combination thereof.
- a disease e.g., an infectious disease, an inflammatory disease, an autoimmune disease, a malignant or cancerous disease, and/or a connective disease
- a toxin e.g., an infectious disease, an inflammatory disease, an autoimmune disease, a malignant or cancerous disease, and/or a connective disease
- liver disease or disorder in a subject in need thereof, comprising administering to the subject an effective amount of a multispecific molecule disclosed herein, thereby treating the liver disease or disorder.
- the liver disease or disorder is a fibrotic disorder or connective tissue disorder affecting the function or physiology of the liver.
- the fibrotic disorder or connective tissue disorder can be systemic (affecting the whole body), multi-organ, or organ- specific (e.g., liver-specific).
- liver fibrosis hepatic fibrosis
- liver cirrhosis any disorder associated with accumulation of extracellular matrix proteins, e.g., collagen, in the liver, liver scarring, and/or abnormal hepatic vasculature.
- the liver disease or disorder is liver cirrhosis.
- Liver cirrhosis is considered to be an end stage of liver fibrosis, involving regenerative nodules (as a result of repair processes), and is typically accompanied with the distortion of the hepatic vasculature.
- the liver disease or disorder is a liver cancer.
- liver cancers include, but are not limited to, hepatocellular carcinoma (HCC), primary liver cell carcinoma, hepatoma, fibrolamellar carcinoma, focal nodular hyperplasia, cholangio sarcoma, intrahepatic bile duct cancer, angiosarcoma or hemangio sarcoma, hepatic adenoma, hepatic hemangiomas, hepatic hamartoma, hepatoblastoma, infantile hemangioendothelialoma, mixed tumors of the liver, tumors of mesenchymal tissue, and sarcoma of the liver.
- HCC hepatocellular carcinoma
- primary liver cell carcinoma hepatoma
- fibrolamellar carcinoma focal nodular hyperplasia
- cholangio sarcoma intrahepatic bile duct cancer
- angiosarcoma or hemangio sarcoma intrahepatic bile
- Liver cancers can also be associated with metastasis of non-liver cancers, such as breast cancer, colorectal cancer, esophageal cancer, kidney or renal cancer, lung cancer, ovarian cancer, pancreatic cancer, rectal cancer, skin cancer (e.g., melanoma), gastric or stomach cancer (including gastrointestinal cancer), and uterine cancer.
- the liver disease or disorder is HCC.
- the liver disease or disorder is caused by one or more insults including, but not limited to, liver inflammation or damage; viral (e.g., chronic viral) infection (e.g., hepatitis B, hepatitis C virus, hepatitis A virus, hepatitis D virus (hepatitis delta virus), hepatitis E virus, Epstein-Barr adenovirus, or cytomegalovirus; or parasitic infection, such as schistosomiasis); alcoholism; fatty liver disease; metabolic disorders (e.g., hemachromatosis, diabetes, obesity, hypertension, dyslipidemia, galactosemia, or glycogen storage disease); autoimmune disorders (e.g., autoimmune hepatitis (AIH), autoimmune liver disease, lupoid hepatitis, systemic lupus erythematosus, primary biliary cirrhosis (PBC), scleroderma, or systemic scerlos
- viral
- liver disorders e.g., steatohepatitis, primary sclerosing cholangitis (PSC), ulcerative colitis, Crohn's disease, inflammatory bowel disease
- PSC primary sclerosing cholangitis
- inherited or congenital liver disease e.g., Wilson's disease, Gilbert's disease, Byler syndrome, Greenland-Eskimo familial cholestasis, Zellweger's syndrome, Alagilles syndrome (ALGS), progressive familial intrahepatic cholestasis (PFIC), alpha 1-antitrypsin deficiency, cystic fibrosis, Indian childhood cirrhosis, or hereditary hemochromatosis
- liver injury e.g., drug toxicity, alcoholism, ischemia, malnutrition, or physical trauma.
- the liver disease or disorder is fatty liver (or FLD), alcoholic liver disease, non-alcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), alcoholic steatohepatitis, simple steatosis, Reye's syndrome, and any disorder associated with abnormal retention of lipids in liver cells.
- FLD fatty liver
- NAFLD non-alcoholic fatty liver disease
- NASH nonalcoholic steatohepatitis
- alcoholic steatohepatitis simple steatosis
- Reye's syndrome and any disorder associated with abnormal retention of lipids in liver cells.
- inflammatory disorder or condition in a subject in need thereof, comprising administering to the subject an effective amount of a multispecific molecule disclosed herein, thereby treating the inflammatory disorder or condition.
- the inflammatory disorder or condition is an inflammatory disorder or condition in the kidney.
- the inflammatory disorder or condition is Lupus nephritis.
- FIG. 1 In vitro binding of increasing concentrations of UniTI-01 to transiently transfected ExpiCHO cells expressing mCCR2 (circles), mCSFIR (squares), or both mCCR2 and mCSFIR (triangles), as determined by flow analysis. In FIG. 1, percent fluorescence (%) is plotted against antibody concentrations tested.
- FIG. 2 Effect of increasing concentrations of isotype control (mIgG2a), anti-mouse CCR2 monoclonal antibody (aCCR2) or UniTI-01 on MCP-1 -dependent cell migration of bone marrow-derived monocytes in a trans-well cell culture system.
- isotype control mIgG2a
- aCCR2 anti-mouse CCR2 monoclonal antibody
- UniTI-01 on MCP-1 -dependent cell migration of bone marrow-derived monocytes in a trans-well cell culture system.
- FIGs. 3A and 3B Effect of increasing concentrations of UniTI-01, anti-mouse CSF1R monoclonal antibody (aCSFIR), or isotype control (mIgG2a) on mCSF-1 -dependent
- FIG. 3 A is a pair of flow cytometry plots showing the staining of bone marrow cells with an anti- CCR2 antibody and an anti-CSFIR antibody at day 0 or day 4 of cell culture in the presence of mCSFl.
- FIG. 3B % proliferation is plotted for each condition tested. All antibodies were tested at 15 ⁇ g/ml.
- FIG. 4 Effect of UniTI-01, anti-mouse CSF1R monoclonal antibody (aCSFIR), or isotype control (mIgG2a) on mCSF-1 -dependent differentiation and proliferation of bone marrow-derived monocytes. All antibodies were tested at 15 ⁇ g/ml.
- FIG. 5 In vitro binding of increasing concentrations of UniTI-01 to primary intratumoral M-MDSCs and M2-like macrophages, as determined by flow analysis.
- FIG. 5 is a panel of histograms showing staining of CD206+ macrophages, M-MDSCs, neutrophils, or CD3+ T cells using UniTI-01.
- FIG. 6 Effect of in vivo administration of UniTI-01 on intratumoral myeloid cell populations in EMT6 and MC38 syngeneic tumor models.
- FIGs. 7A-7D Effect of in vivo administration of UniTI-01 on Kupffer cells in EMT6 syngeneic tumor model.
- FIGs. 7A and 7B are immunohistochemistry graphs of tumor and liver tissues, respectively, stained with the antibody F4/80.
- FIGs. 7C and 7D are graphs showing % F4/80 positive area for tumor and liver tissues, respectively.
- FIGs. 8A and 8B Effect of UniTI-01 on CSF-1 dependent cell survival in CCR2- negative NFS-60 cells in vitro.
- FIG. 8A cell viability is plotted against the antibody concentrations tested for the anti-CCR2/anti-CSFlR bispecific antibody UniTI-01, a bivalent monospecific anti-CSFIR antibody (aCSFIR), or a monovalent monospecific anti-CSFIR antibody (mono-aCSFIR).
- FIG. 8B is a pair of flow cytometry plots showing the staining of NFS-60 cells with an anti-CCR2 antibody and an anti-CSFIR antibody, or the staining of NFS- 60 cells with an isotype control antibody.
- FIG. 9 Effect of in vivo administration of UniTI-01 on CD8+ T cell infiltration in the tumor of EMT6 model.
- FIG. 9 is a graph showing % CD8+ T cells in CD3+ T cells in tumors under indicated treatments.
- FIGs. 10A and 10B Effect of in vivo administration of UniTI-01 on Treg frequency in the tumor of MC38 model.
- FIG. 10A is a graph showing % FOXP3+ cells in CD4+ T cells in tumors under indicated treatments.
- FIG. 10B the CD8+ T cell/Treg ratio in tumors is plotted for each treatment.
- FIGs. 11A and 11B UniTI-01 shows antitumor efficacy, tumor regressions and enhanced survival when treated in combination with anti-PDLl antibody in EMT6 tumor model.
- FIG. 11 A is a panel of graphs showing tumor volumes for each treatment.
- FIG. 1 IB is a graph showing percent survival under indicated treatments.
- TAMs originate from circulating monocytes and their recruitment into tumors is driven by tumor-derived chemotactic factors. TAMs can promote tumor cell proliferation and metastasis by causing such responses as inhibition of B and T cell activation, inhibition of tumor- associated antigen presentation, inhibition of cytotoxic granule release, increased angiogenesis, and secretion a wide range of growth and proangiogenic factors (see e.g., Liu et al Cellular &
- the term "variant" of a parent sequence refers to a sequence that has a substantially identical amino acid sequence to the parent sequence, or a fragment thereof. In some embodiments, the variant is a functional variant.
- the articles “a” and “an” refer to one or more than one, e.g. , to at least one, of the grammatical object of the article.
- the use of the words “a” or “an” when used in conjunction with the term “comprising” herein may mean “one,” but it is also consistent with the meaning of "one or more,” “at least one,” and “one or more than one.”
- Antibody molecule refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable region sequence.
- An antibody molecule encompasses antibodies (e.g., full-length antibodies) and antibody fragments.
- an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain.
- a full-length antibody is an immunoglobulin (Ig) molecule (e.g., an IgG antibody) that is naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes).
- Ig immunoglobulin
- an antibody molecule refers to an immunologically active, antigen-binding portion of an immunoglobulin molecule, such as an antibody fragment.
- An antibody fragment e.g., functional fragment, is a portion of an antibody, e.g., Fab, Fab', F(ab') 2 , F(ab) 2 , variable fragment (Fv), domain antibody (dAb), or single chain variable fragment (scFv).
- a functional antibody fragment binds to the same antigen as that recognized by the intact (e.g., full-length) antibody.
- antibody fragment or “functional fragment” also include isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins").
- an antibody fragment does not include portions of antibodies without antigen binding activity, such as Fc fragments or single amino acid residues.
- Exemplary antibody molecules include full length antibodies and antibody fragments, e.g., dAb (domain antibody), single chain, Fab, Fab', and F(ab') 2 fragments, and single chain variable fragments (scFvs).
- an "immunoglobulin variable region sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable region.
- the sequence may include all or part of the amino acid sequence of a naturally-occurring variable region.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- an antibody molecule is monospecific, e.g., it comprises binding specificity for a single epitope.
- an antibody molecule is multispecific, e.g., it comprises a plurality of immunoglobulin variable region sequences, where a first immunoglobulin variable region sequence has binding specificity for a first epitope and a second immunoglobulin variable region sequence has binding specificity for a second epitope.
- an antibody molecule is a bispecific antibody molecule. "Bispecific antibody molecule" as used herein refers to an antibody molecule that has specificity for more than one (e.g., two, three, four, or more) epitope and/or antigen.
- Antigen refers to a molecule that can provoke an immune response, e.g., involving activation of certain immune cells and/or antibody generation.
- an antigen can be synthesized or can be derived from a biological sample, e.g., a tissue sample, a tumor sample, a cell, or a fluid with other biological components.
- a tumor antigen or interchangeably, a “cancer antigen” includes any molecule present on, or associated with, a cancer, e.g., a cancer cell or a tumor microenvironment that can provoke an immune response.
- an "immune cell antigen” includes any molecule present on, or associated with, an immune cell that can provoke an immune response.
- the "antigen-binding site,” or “binding portion” of an antibody molecule refers to the part of an antibody molecule, e.g., an immunoglobulin (Ig) molecule, that participates in antigen binding.
- the antigen binding site is formed by amino acid residues of the variable (V) regions of the heavy (H) and light (L) chains.
- V variable regions of the heavy and light chains
- hypervariable regions Three highly divergent stretches within the variable regions of the heavy and light chains, referred to as hypervariable regions, are disposed between more conserved flanking stretches called “framework regions,” (FRs).
- FRs are amino acid sequences that are naturally found between, and adjacent to, hypervariable regions in immunoglobulins.
- the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface, which is complementary to the three-dimensional surface of a bound antigen.
- the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions," or "CDRs.”
- the framework region and CDRs have been defined and described, e.g., in Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia, C. et al.
- variable chain e.g., variable heavy chain and variable light chain
- cancer as used herein can encompass all types of oncogenic processes and/or cancerous growths.
- cancer includes primary tumors as well as metastatic tissues or malignantly transformed cells, tissues, or organs.
- cancer includes primary tumors as well as metastatic tissues or malignantly transformed cells, tissues, or organs.
- cancer includes relapsed and/or resistant cancer.
- cancer includes relapsed and/or resistant cancer.
- cancer includes relapsed and/or resistant cancer.
- cancer and tumor can be used interchangeably. For example, both terms encompass solid and liquid tumors.
- cancer or tumor includes premalignant, as well as malignant cancers and tumors.
- compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- nucleotide sequence in the context of nucleotide sequence, the term "substantially identical" is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- the sequences are aligned for optimal comparison purposes (e.g. , gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and
- Gapped BLAST can be utilized as described in Altschul et ah, (1997) Nucleic Acids Res. 25:3389-3402.
- the default parameters of the respective programs ⁇ e.g., XBLAST and NBLAST) can be used. See http://www.ncbi.nlm.nih.gov.
- molecules of the present invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
- amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
- exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
- amino acid includes both the D- or L- optical isomers and peptidomimetics.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- polymers of amino acids of any length may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non- amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- nucleic acid refers to any organic acid sequence.
- nucleotide sequence refers to any organic acid sequence.
- polynucleotide sequence and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single- stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
- isolated refers to material that is removed from its original or native environment (e.g. , the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- immunosuppressive myeloid cell generally refers to a cell of myeloid lineage that promotes immunosuppression (e.g., in a tumor microenvironment) (e.g., by inhibiting T cell activation, inhibiting T cell viability, promoting T regulatory cell induction and recruitment).
- Immunosuppressive myeloid cells include, e.g., tumor associated macrophages (TAMs) and myeloid derived suppressor cells (MDSCs).
- tumor associated macrophage generally refers to a macrophage that exists in the microenvironment of a cancer, for example, a tumor.
- reducing TAMs generally refers to decreasing the number of TAMs. Reducing includes decreasing the number of TAMs in a tumor or near a tumor (e.g., as compared to the number of TAMs prior to administration of a multispecific molecule described herein (e.g., prior to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more administrations of a multispecific molecule described herein).
- Reducing includes decreasing any number of TAMs (e.g., 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 100%, all, or substantially) (e.g., as compared to the number of TAMs prior to administration of a multispecific molecule described herein (e.g., prior to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more administrations of a
- MDSC myeloid derived suppressor cell
- M-MDSCs monocytic-MDSCs
- PMN-MDSCs Polymorphonuclear MDSCs
- Immature MDSCs are associated with expression of CD117 and CD34 and no expression of LIN and HLA-DR. See e.g., Ugel et al. (2015) JCI Vol 125 (9), page 3365.
- a CSFlR-positive, CCR2-positive cell refers to a cell expressing both CSF1R and CCR2 on the cell surface.
- a CSFlR-positve, CCR2- negative cell refers to a cell expressing CSF1R, but not CCR2 on the cell surface.
- a CSFlR-negative, CCR2-positive cell refers to a cell expressing CCR2, but not CSF1R on the cell surface.
- a binding moiety e.g., an antibody molecule
- binds to a target monovalently when the binding moiety, e.g., the antibody molecule, binds to a single epitope on the target.
- the binding moiety comprises only one antigen binding domain to the target.
- one molecule of the binding moiety can only bind to one molecule of the target.
- a binding moiety binds to a target bivalently, when the binding moiety, e.g., the antibody molecule, binds to two epitopes on the target.
- the two epitopes are identical.
- the two epitopes are different.
- the binding moiety comprises two antigen binding domains to the target.
- one molecule of the binding moiety can bind to two molecules of the target.
- TAM targeting antigens of the present disclosure include, e.g., CSF1R, CCR2, CXCR2, CD68, CD163, CX3CR1, MARCO, CD204, CD52, and folate receptor beta.
- Exemplary amino acid sequences of TAM targeting antigens are provided herein.
- CSF1R also known as Macrophage colony- stimulating factor 1 receptor
- CSF1R is a tyrosine- protein kinase that acts as cell-surface receptor for CSFl and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes.
- CSF1R promotes the release of pro-inflammatory chemokines in response to IL34 and CSFl, and thereby plays an important role in innate immunity and in inflammatory processes.
- Exemplary CSF1R immature amino acid sequences are provided in SEQ ID NOs: 87 and 88.
- CSF1R immature amino acid sequence isoform 2 (identifier: P07333-2):
- CCR2 (also known as C-C chemokine receptor type 2) is a G protein coupled receptor for the CCL2, CCL7 and CCL13 chemokines.
- CCR2 is known to function in the recruitment of monocytes/macrophages and T cells.
- CCR2 is expressed is expressed on monocytes and a small subpopulation of T cells and exhibits an almost identical expression pattern in mice and humans (Mack et al. J Immunol 2001; 166:4697-4704).
- Exemplary CCR2 amino acid sequences are provided in SEQ ID NOs: 89 and 90.
- CCR2 amino acid sequence isoform A (Identifier: P41597-1): MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN MLVVLILINCKKLKCLTDIYLLNLAI SDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY HIGYFGGIFFI ILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGI IFTK CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI NP I IYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKS I GRAPEASLQDKEGA SEQ ID NO: 89
- CXCR2 (also known as interleukin-8 receptor) is the G protein coupled receptor for IL8 which is a neutrophil chemotactic factor. Binding of IL8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol- calcium second messenger system. CXCR2 binds to IL-8 with high affinity, and also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. CXCR2 is expressed at high levels on circulating neutrophils and is critical for directing their migration to sites of inflammation (J Clin Invest. 2012; 122(9):3127-3144). An exemplary CXCR2 amino acid sequence is provided in SEQ ID NO: 91.
- Exemplary antibodies binding TAM antigens are provided throughout the specification and below. Exemplary anti-CSFIR antibodies are described herein as well as in
- CCR2 antibodies are described herein as well as in WO2013192596A2;
- WO2010021697A2 WO2001057226A1 ; and WO 1997031949A1, all of which are herein incorporated by reference in their entirety.
- Exemplary CXCR2 antibodies are described in WO2014170317A1 and US20160060347 (see e.g., a) SEQ ID NO: 14 (light chain) and SEQ ID NO: 15 (heavy chain); b) SEQ ID NO: 24 (light chain) and SEQ ID NO: 25 (heavy chain); c) SEQ ID NO: 34 (light chain) and SEQ ID NO: 35 (heavy chain); d) SEQ ID NO: 44 (light chain) and SEQ ID NO: 45 (heavy chain); e) SEQ ID NO: 54 (light chain) and SEQ ID NO: 55 (heavy chain); f) SEQ ID NO: 64 (light chain) and SEQ ID NO: 65 (heavy chain); g) SEQ ID NO: 74 (light chain) and SEQ ID NO: 75 (heavy chain); h
- Exemplary anti-CD163 antibodies are provided in US20120258107 (see e.g., MAC2158, MAC2- 48), herein incorporated by reference in its entirety.
- Exemplary anti-CD52 antibodies are described in US20050152898, herein incorporated by reference in its entirety.
- Exemplary anti- folate antibodies are described in US9522196, herein incorporated by reference in its entirety.
- Exemplary anti-CD52 antibodies are described in US20050152898, herein incorporated by reference in its entirety.
- Exemplary anti-MARCO antibodies are described in WO2016196612, herein incorporated by reference in its entirety.
- the multispecific molecule comprises an antibody molecule that binds to a first tumor associated macrophage (TAM) antigen; and an antibody molecule that binds to a second TAM antigen.
- TAM tumor associated macrophage
- the first and/or second TAM antigen is, e.g., a mammalian, e.g., a human.
- the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, on the TAM antigen.
- the multispecific molecule comprises an antibody molecule that binds to a first myeloid derived suppressor cell (MDSC) antigen; and an antibody molecule that binds to a second MDSC antigen.
- MDSC myeloid derived suppressor cell
- the first and/or second MDSC antigen is, e.g., a mammalian, e.g., a human.
- the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, on the MDSC antigen.
- an antibody molecule is a monospecific antibody molecule and binds a single epitope.
- a monospecific antibody molecule having a plurality of immunoglobulin variable region sequences, each of which binds the same epitope.
- an antibody molecule is a multispecific antibody molecule, e.g. , it comprises a plurality of immunoglobulin variable region sequences, wherein a first
- a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable region.
- a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable region sequence which has binding specificity for a first epitope and a second immunoglobulin variable region sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g. , the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- the first and second epitopes are on different antigens, e.g.
- a bispecific antibody molecule comprises a heavy chain variable region sequence and a light chain variable region sequence which have binding specificity for a first epitope and a heavy chain variable region sequence and a light chain variable region sequence which have binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a scFv or a Fab, or fragment thereof, have binding specificity for a first epitope and a scFv or a Fab, or fragment thereof, have binding specificity for a second epitope.
- an antibody molecule comprises a diabody, and a single-chain molecule, as well as an antigen-binding fragment of an antibody (e.g., Fab, F(ab') 2 , and Fv).
- an antibody molecule can include a heavy (H) chain variable region sequence
- an antibody molecule comprises or consists of a heavy chain and a light chain (referred to herein as a half antibody.
- an antibody molecule includes two heavy (H) chain variable region sequences and two light (L) chain variable region sequence, thereby forming two antigen binding sites, such as Fab, Fab', F(ab') 2 , Fc, Fd, Fd', Fv, single chain antibodies (scFv for example), single variable region antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g.
- humanized antibodies which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g. , IgGl, IgG2, IgG3, and IgG4) of antibodies.
- the a preparation of antibody molecules can be monoclonal or polyclonal.
- An antibody molecule can also be a human, humanized, CDR- grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgGl, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- immunoglobulin Ig is used interchangeably with the term "antibody” herein.
- antigen-binding fragments of an antibody molecule include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable region; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- Antibody molecules include intact molecules as well as functional fragments thereof. Constant regions of the antibody molecules can be altered, e.g., mutated, to modify the properties of the antibody ⁇ e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- Antibody molecules can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example.
- variable region derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
- CDR complementarity determining regions
- FR framework regions
- the extent of the framework region and CDRs has been precisely defined by a number of methods (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242;
- CDR complementarity determining region
- the CDR amino acid residues in the heavy chain variable region (VH) are numbered 31-35 (HCDRl), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable region (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDRl), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
- Each VH and VL typically includes three CDRs and four FRs, arranged from amino- terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the antibody molecule can be a polyclonal or a monoclonal antibody.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
- Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No. 5,223,409; Kang et al. International
- the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human
- a non-human antibody e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- the non-human antibody is a rodent (mouse or rat antibody).
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al.
- An antibody molecule can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibody molecules generated in a non- human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- an "effectively human” protein is a protein that does substantially not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA human anti-murine antibody
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et ⁇ 1. Cancer Immunol.
- Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Patent No. 4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240: 1041-1043); Liu et al.
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding to the antigen.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is a naturally- occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
- Consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody molecule can be humanized by methods known in the art (see e.g.,
- Humanized or CDR-grafted antibody molecules can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced.
- CDR-grafting or CDR substitution wherein one, two, or all CDRs of an immunoglobulin chain can be replaced.
- U.S. Patent 5,225,539 Jones et al. 1986 Nature 321 :552-525; Verhoeyan et al. 1988 Science 239: 1534; Beidler et al. 1988 J. Immunol. 141 :4053-4060; Winter US 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A, filed on March 26, 1987; Winter US
- humanized antibody molecules in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in US 5,585,089, e.g. , columns 12-16 of US 5,585,089, e.g., columns 12-16 of US 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 Al, published on December 23, 1992.
- the antibody molecule can be a single chain antibody.
- a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the ⁇ e.g., human) heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the ⁇ e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody ⁇ e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has: effector function; and can fix complement.
- the antibody does not; recruit effector cells; or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the CI component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue ⁇ see e.g., EP 388,151 Al, U.S. Pat. No. 5,624,821 and U.S. Pat. No. 5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- an antibody molecule can be derivatized or linked to another functional molecule ⁇ e.g., another peptide or protein).
- a "derivatized" antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
- an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a strep tavidin core region or a polyhistidine tag).
- another antibody e.g., a bispecific antibody or a diabody
- detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a strep tavidin core region or a polyhistidine tag).
- One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- an appropriate spacer e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester
- homobifunctional e.g., disuccinimidyl suberate
- multispecific antibody molecules can comprise more than one antigen- binding site, where different sites are specific for different antigens. In embodiments, multispecific antibody molecules can bind more than one (e.g., two or more) epitopes on the same antigen. In embodiments, multispecific antibody molecules comprise an antigen-binding site specific for a target cell (e.g., cancer cell) and a different antigen-binding site specific for an immune effector cell. In one embodiment, the multispecific antibody molecule is a bispecific antibody molecule.
- Bispecific antibody molecules can be classified into five different structural groups: (i) bispecific immunoglobulin G (BsIgG); (ii) IgG appended with an additional antigen- binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates.
- BsIgG is a format that is monovalent for each antigen.
- Exemplary BsIgG formats include but are not limited to crossMab, DAF (two-in-one), DAF (four- in-one), DutaMab, DT-IgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair, Fab-arm exchange,
- BsIgGs include catumaxomab (Fresenius Biotech, Trion Pharma, Neopharm), which contains an anti-CD3 arm and an anti-EpCAM arm; and ertumaxomab (Neovii Biotech, Fresenius Biotech), which targets CD3 and HER2.
- BsIgG comprises heavy chains that are engineered for heterodimerization.
- heavy chains can be engineered for heterodimerization using a "knobs-into-holes" strategy, a SEED platform, a common heavy chain (e.g., in ⁇ -bodies), and use of heterodimeric Fc regions.
- Strategies that have been used to avoid heavy chain pairing of homodimers in BsIgG include knobs-in-holes, duobody, azymetric, charge pair, HA-TF, SEEDbody, and differential protein A affinity. See Id.
- BsIgG can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly into a BsIgG.
- BsIgG can also be produced by expression of the
- BsIgG can be purified using affinity
- IgG appended with an additional antigen-binding moiety is another format of bispecific antibody molecules.
- monospecific IgG can be engineered to have bispecificity by appending an additional antigen -binding unit onto the monospecific IgG, e.g., at the N- or C- terminus of either the heavy or light chain.
- additional antigen-binding units include single domain antibodies (e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable regions (e.g., single chain variable fragments or variable fragments). See Id.
- Examples of appended IgG formats include dual variable domain IgG (DVD-Ig), IgG(H)-scFv, scFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG(L,H)-Fv, IgG(H)-V, V(H)-IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, zybody, and DVI-IgG (four- in-one). See Spiess et al. Mol.
- IgG-scFv An example of an IgG-scFv is MM- 141 (Merrimack Pharmaceuticals), which binds IGF-1R and HER3.
- DVD-Ig examples include ABT-981 (Abb Vie), which binds IL- la and IL- ⁇ ; and ABT-122 (Abb Vie), which binds TNF and IL- 17A.
- Bispecific antibody fragments are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region.
- bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell.
- Exemplary bispecific antibody fragments include but are not limited to nanobody, nanobody- HAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CH3, Diabody-CH3, triple body, miniantibody, minibody, TriBi minibody, scFv-CH3 KIH, Fab-scFv, scFv-CH-CL-scFv, F(ab')2, F(ab')2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody. See Id.
- the BiTE format comprises tandem scFvs, where the component scFvs bind to CD3 on T cells and a surface antigen on cancer cells
- Bispecific fusion proteins include antibody fragments linked to other proteins, e.g., to add additional specificity and/or functionality.
- An example of a bispecific fusion protein is an immTAC, which comprises an anti-CD3 scFv linked to an affinity-matured T-cell receptor that recognizes HLA-presented peptides.
- the dock-and-lock (DNL) method can be used to generate bispecific antibody molecules with higher valency.
- fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments. See Id.
- chemical conjugation e.g., chemical conjugation of antibodies and/or antibody fragments
- An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof.
- the conjugation improves the serum half-life of the low molecular weight drug.
- An exemplary CovX-body is CVX-241 (NCT01004822), which comprises an antibody conjugated to two short peptides inhibiting either VEGF or Ang2. See Id.
- the antibody molecules can be produced by recombinant expression, e.g., of at least one or more component, in a host system.
- exemplary host systems include eukaryotic cells (e.g., mammalian cells, e.g., CHO cells, or insect cells, e.g., SF9 or S2 cells) and prokaryotic cells (e.g., E. coli).
- Bispecific antibody molecules can be produced by separate expression of the components in different host cells and subsequent purification/assembly. Alternatively, the antibody molecules can be produced by expression of the components in a single host cell.
- affinity tags can be used for purification, e.g., histidine-containing tag, myc tag, or streptavidin tag.
- a multispecific antibody molecule comprising a CSF1R binding moiety.
- the CSF1R binding moiety comprises an anti-CSFIR antibody molecule.
- Exemplary anti-CSFIR antibody molecule sequences are described in WO2009026303A1; WO2011123381A1; WO2016207312A1; WO2016106180A1;
- the CSFIR binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of emactuzumab, or a sequence substantially identical thereto (e.g., at least 95% identical thereto, e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the CSFIR binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of cabiralizumab, or a sequence substantially identical thereto (e.g., ., at least 95% identical thereto, e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the CSFIR binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of AMG820, or a sequence substantially identical thereto (e.g., ., at least 95% identical thereto, e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the CSFIR binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of IMC-CS4, or a sequence substantially identical thereto (e.g., ., at least 95% identical thereto, e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the CSFIR binding moiety comprises a VH or VL amino acid sequence disclosed in Table 8, a CDR of a VH or VL amino acid sequence disclosed in Table 8, or a sequence substantially identical thereto.
- a multispecific antibody molecule comprising a CCR2 binding moiety.
- Exemplary CCR2 antibodies are described herein as well as in
- the CCR2 binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of plozalizumab, or a sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the CCR2 binding moiety comprises a VH or VL amino acid sequence disclosed in Table 9, a CDR of a VH or VL amino acid sequence disclosed in Table 9, or a sequence substantially identical thereto.
- a multispecific antibody molecule comprising a PD-Ll binding moiety.
- the PD-Ll binding moiety comprises an anti-PD-Ll antibody molecule.
- Exemplary anti-PD-Ll antibody molecule sequences are described in WO2013079174, WO 2010077634, WO2007/005874, and US20120039906, all of which are herein incorporated by reference in their entirety.
- the PD-Ll binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of durvalumab, or a sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the PD-Ll binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of atezolizumab, or a sequence substantially identical thereto (e.g., at least 95% identical thereto, e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the PD-Ll binding moiety comprises the CDR (e.g., one, two, three, four, five, or all six CDRs), VH, VL, heavy chain, or light chain sequences of avelumab, or a sequence substantially identical thereto (e.g., at least 95% identical thereto, e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
- the PD-Ll binding moiety comprises a VH or VL amino acid sequence disclosed in Table 10, a CDR of a VH or VL amino acid sequence disclosed in Table 10, or a sequence substantially identical thereto.
- the antibody molecule is a CDR-grafted scaffold domain.
- the scaffold domain is based on a fibronectin domain, e.g., fibronectin type III domain.
- the overall fold of the fibronectin type III (Fn3) domain is closely related to that of the smallest functional antibody fragment, the variable region of the antibody heavy chain. There are three loops at the end of Fn3; the positions of BC, DE and FG loops approximately correspond to those of CDR1, 2 and 3 of the VH domain of an antibody.
- Fn3 does not have disulfide bonds; and therefore Fn3 is stable under reducing conditions, unlike antibodies and their fragments (see, e.g., WO 98/56915; WO 01/64942; WO 00/34784).
- An Fn3 domain can be modified (e.g., using CDRs or hypervariable loops described herein) or varied, e.g., to select domains that bind to an antigen/marker/cell described herein.
- a scaffold domain e.g., a folded domain
- an antibody e.g., a "minibody” scaffold created by deleting three beta strands from a heavy chain variable region of a monoclonal antibody (see, e.g., Tramontano et al., 1994, J Mol. Recognit. 7:9; and Martin et al., 1994, EMBO J. 13:5303-5309).
- the "minibody” can be used to present two hypervariable loops.
- the scaffold domain is a V-like domain (see, e.g., Coia et al.
- WO 99/45110 or a domain derived from tendamistatin, which is a 74 residue, six-strand beta sheet sandwich held together by two disulfide bonds (see, e.g., McConnell and Hoess, 1995, J Mol. Biol. 250:460).
- the loops of tendamistatin can be modified (e.g., using CDRs or hypervariable loops) or varied, e.g., to select domains that bind to a marker/antigen/cell described herein.
- Another exemplary scaffold domain is a beta-sandwich structure derived from the extracellular domain of CTLA-4 (see, e.g., WO 00/60070).
- exemplary scaffold domains include but are not limited to T-cell receptors; MHC proteins; extracellular domains (e.g., fibronectin Type III repeats, EGF repeats); protease inhibitors (e.g., Kunitz domains, ecotin, BPTI, and so forth); TPR repeats; trifoil structures; zinc finger domains; DNA-binding proteins; particularly monomeric DNA binding proteins; RNA binding proteins; enzymes, e.g., proteases (particularly inactivated proteases), RNase;
- chaperones e.g., thioredoxin, and heat shock proteins
- intracellular signaling domains such as SH2 and SH3 domains
- a scaffold domain is evaluated and chosen, e.g., by one or more of the following criteria: (1) amino acid sequence, (2) sequences of several homologous domains, (3) 3- dimensional structure, and/or (4) stability data over a range of pH, temperature, salinity, organic solvent, oxidant concentration.
- the scaffold domain is a small, stable protein domain, e.g., a protein of less than 100, 70, 50, 40 or 30 amino acids.
- the domain may include one or more disulfide bonds or may chelate a metal, e.g., zinc.
- Exemplary structures of the multifunctional molecules defined herein are described below. Exemplary structures are further described in: Weidle U et al. (2013) The Intriguing Options of Multispecific Antibody Formats for Treatment of Cancer. Cancer Genomics & Proteomics 10: 1-18 (2013); and Spiess C et al. (2015) Alternative molecular formats and therapeutic applications for bispecific antibodies. Molecular Immunology 67: 95-106; the full contents of each of which is incorporated by reference herein).
- Heterodimerized bispecific antibodies are based on the natural IgG structure, wherein the two binding arms recognize different antigens.
- IgG derived formats that enable defined monovalent (and simultaneous) antigen binding are generated by forced heavy chain
- Forced heavy chain heterodimerization can be obtained using, e.g., knob- in-hole OR strand exchange engineered domains (SEED).
- SEED knob- in-hole OR strand exchange engineered domains
- Knob-in-Hole as described in US 5,731,116, US 7,476,724 and Ridgway, J. et al. (1996) Prot. Engineering 9(7): 617-621, broadly involves: (1) mutating the CH3 domain of one or both antibodies to promote heterodimerization; and (2) combining the mutated antibodies under conditions that promote heterodimerization.
- “Knobs” or “protuberances” are typically created by replacing a small amino acid in a parental antibody with a larger amino acid (e.g., T366Y or T366W); "Holes” or “cavities” are created by replacing a larger residue in a parental antibody with a smaller amino acid (e.g., Y407T, T366S, L368A and/or Y407V), numbered based on the Eu numbering system.
- SEED Strand Exchange Engineered Domains
- SEED is based on sequence exchanges between IgGl and IgA to create non-identical chains which heterodimerize preferentially. Alternating sequences from human IgA and IgG in the SEED CH3 domains generate two asymmetric but complementary domains, designated AG and GA. The SEED design allows efficient generation of AG/GA heterodimers, while disfavoring homodimerization of AG and GA SEED CH3 domains.
- Light chain mispairing must be avoided to generate homogenous preparations of bispecific IgGs.
- One way to achieve this is through the use of the common light chain principle, i.e. combining two binders that share one light chain but still have separate specificities.
- Another option is the CrossMab technology which avoids non-specific L chain mispairing by exchanging CHI and CL domains in the Fab of one half of the bispecific antibody. Such crossover variants retain binding specificity and affinity, but make the two arms so different that L chain mispairing is prevented.
- a variety of formats can be generated which contain additional binding entities attached to the N or C terminus of antibodies. These fusions with single chain or disulfide stabilized Fvs or Fabs result in the generation of tetravalent molecules with bivalent binding specificity for each antigen. Combinations of scFvs and scFabs with IgGs enable the production of molecules which can recognize three or more different antigens.
- Antibody-Fab fusions are bispecific antibodies comprising a traditional antibody to a first target and a Fab to a second target fused to the C terminus of the antibody heavy chain.
- Antibody fusions can be produced by (1) engineering the DNA sequence of the target fusion, and (2) transfecting the target DNA into a suitable host cell to express the fusion protein. It seems like the antibody-scFv fusion may be linked by a (Gly)-Ser linker between the C-terminus of the CH3 domain and the N-terminus of the scFv, as described by Coloma, J. et al. (1997) Nature Biotech 15: 159.
- Antibody-scFv Fusions are bispecific antibodies comprising a traditional antibody and a scFv of unique specificity fused to the C terminus of the antibody heavy chain.
- the scFv can be fused to the C terminus through the Heavy Chain of the scFv either directly or through a linker peptide.
- Antibody fusions can be produced by (1) engineering the DNA sequence of the target fusion, and (2) transfecting the target DNA into a suitable host cell to express the fusion protein. It seems like the antibody-scFv fusion may be linked by a (Gly)-Ser linker between the C- terminus of the CH3 domain and the N-terminus of the scFv, as described by Coloma, J. et al. (1997) Nature Biotech 15: 159.
- VD dual variable domain immunoglobulin
- Fc-containing entities also known as mini-antibodies
- Fc-containing entities can be generated by fusing scFv to the C-termini of constant heavy region domain 3 (CH3-scFv) and/or to the hinge region (scFv- hinge-Fc) of an antibody with a different specificity.
- Trivalent entities can also be made which have disulfide stabilized variable regions (without peptide linker) fused to the C-terminus of CH3 domains of IgGs.
- Fc-less bispecifics are characterized by generally having smaller size than Fc-containing entities.
- Common bispecific of this class include Fab-scFv2 and Fab-scFv molecules.
- This class also includes, e.g., BiTEs (bispecific T-cell engagers), diabodies, TandAbs (tetravalent tandem antibodies), and DARTs (dual affinity retargeting molecules).
- BiTEs are created by fusing two scFvs via a flexible linker peptide.
- Diabodies consist of two VH and two VL domains from two different antibodies. Interaction only with complementary domains on another chain is achieved by attaching domains with short linker peptides which permits pairing only with VH and VL domains.
- VH of the first binder linked to the VL of the second binder is co-expressed with the VH of the second antibody linked to VL of the first antibody.
- TandAbs molecules are generated by functional dimerization of a protein consisting of four antibody variable H- and L-chains in an orientation that prevents intramolecular pairing.
- DARTs are entities that are stabilized by disulfide bonds which apply a similar design concept to that of diabodies.
- Multispecific molecules e.g., multispecific antibody molecules
- multispecific antibody molecules that include the lambda light chain polypeptide and a kappa light chain polypeptides
- Methods for generating bispecific antibody molecules comprising the lambda light chain polypeptide and a kappa light chain polypeptides are disclosed in PCT/US2017/53053 filed on September 22, 2017, incorporated herein by reference in its entirety.
- the multispecific molecules include a multispecific antibody molecule, e.g., an antibody molecule comprising two binding specificities, e.g., a bispecific antibody molecule.
- the multispecific antibody molecule includes:
- LLCPl lambda light chain polypeptide 1
- HCP1 heavy chain polypeptide 1
- KLCP2 kappa light chain polypeptide 2
- HCP2 heavy chain polypeptide 2
- Lambda light chain polypeptide 1 refers to a polypeptide comprising sufficient light chain (LC) sequence, such that when combined with a cognate heavy chain variable region, can mediate specific binding to its epitope and complex with an HCP1. In an embodiment it comprises all or a fragment of a CHI region. In an embodiment, an LLCPl comprises LC-CDRl, LC-CDR2, LC-CDR3, FRl, FR2, FR3, FR4, and CHI, or sufficient sequence therefrom to mediate specific binding of its epitope and complex with an HCP1.
- LLCPl together with its HCP1, provide specificity for a first epitope (while KLCP2, together with its HCP2, provide specificity for a second epitope). As described elsewhere herein, LLCPl has a higher affinity for HCP1 than for HCP2.
- KLCP2 Kappa light chain polypeptide 2
- LC sufficient light chain
- a KLCP2 comprises LC-CDRl, LC-CDR2, LC-CDR3, FRl, FR2, FR3, FR4, and CHI, or sufficient sequence therefrom to mediate specific binding of its epitope and complex with an HCP2.
- KLCP2, together with its HCP2 provide specificity for a second epitope (while LLCPl, together with its HCP1, provide specificity for a first epitope).
- Heavy chain polypeptide 1 refers to a polypeptide comprising sufficient heavy chain (HC) sequence, e.g., HC variable region sequence, such that when combined with a cognate LLCPl, can mediate specific binding to its epitope and complex with an HCPl. In an embodiments it comprises all or a fragment of a CHlregion. In an embodiment, it comprises all or a fragment of a CH2 and/or CH3 region.
- HC sufficient heavy chain
- an HCPl comprises HC-CDRl, HC-CDR2, HC-CDR3, FRl, FR2, FR3, FR4, CHI, CH2, and CH3, or sufficient sequence therefrom to: (i) mediate specific binding of its epitope and complex with an LLCP1, (ii) to complex preferentially, as described herein to LLCP1 as opposed to KLCP2; and (iii) to complex preferentially, as described herein, to an HCP2, as opposed to another molecule of HCPl.
- HCPl, together with its LLCP1 provide specificity for a first epitope (while KLCP2, together with its HCP2, provide specificity for a second epitope).
- Heavy chain polypeptide 2 refers to a polypeptide comprising sufficient heavy chain (HC) sequence, e.g., HC variable region sequence, such that when combined with a cognate LLCP1, can mediate specific binding to its epitope and complex with an HCPl. In an embodiments it comprises all or a fragment of a CHlregion. In an embodiments it comprises all or a fragment of a CH2 and/or CH3 region.
- HC sufficient heavy chain
- an HCPl comprises HC-CDRl, HC-CDR2, HC-CDR3, FRl, FR2, FR3, FR4, CHI, CH2, and CH3, or sufficient sequence therefrom to: (i) mediate specific binding of its epitope and complex with an KLCP2, (ii) to complex preferentially, as described herein to KLCP2 as opposed to LLCP1; and (iii) to complex preferentially, as described herein, to an HCPl, as opposed to another molecule of HCP2.
- HCP2, together with its KLCP2 provide specificity for a second epitope (while LLCP1, together with its HCPl, provide specificity for a first epitope).
- LLCP1 has a higher affinity for HCPl than for HCP2;
- KLCP2 has a higher affinity for HCP2 than for HCPl.
- the affinity of LLCP1 for HCPl is sufficiently greater than its affinity for HCP2, such that under preselected conditions, e.g., in aqueous buffer, e.g., at pH 7, in saline, e.g., at pH 7, or under physiological conditions, at least 75%, 80, 90, 95, 98, 99, 99.5, or 99.9 % of the multispecific antibody molecule molecules have a LLCPlcomplexed, or interfaced with, a HCPl.
- the HCPl has a greater affinity for HCP2, than for a second molecule of HCPl; and/or the HCP2 has a greater affinity for HCPl, than for a second molecule of HCP2.
- the affinity of HCPl for HCP2 is sufficiently greater than its affinity for a second molecule of HCPl, such that under preselected conditions, e.g., in aqueous buffer, e.g., at pH 7, in saline, e.g., at pH 7, or under physiological conditions, at least 75%, 80, 90, 95, 98, 99 99.5 or 99.9 % of the multispecific antibody molecule molecules have a HCPlcomplexed, or interfaced with, a HCP2.
- a method for making, or producing, a multispecific antibody molecule includes:
- a first heavy chain polypeptide e.g., a heavy chain polypeptide comprising one, two, three or all of a first heavy chain variable region (first VH), a first CHI, a first heavy chain constant region (e.g., a first CH2, a first CH3, or both)
- first VH first heavy chain variable region
- first CHI first heavy chain constant region
- first CH2 first CH2, a first CH3, or both
- a second heavy chain polypeptide e.g., a heavy chain polypeptide comprising one, two, three or all of a second heavy chain variable region (second VH), a second CHI, a second heavy chain constant region (e.g., a second CH2, a second CH3, or both)
- second VH second heavy chain variable region
- second CHI second heavy chain variable region
- second CH2 second CH3, or both
- a lambda chain polypeptide e.g., a lambda light variable region (VIA), a lambda light constant chain (VIA), or both
- VA lambda light variable region
- VIA lambda light constant chain
- a kappa chain polypeptide e.g., a lambda light variable region (VLK), a lambda light constant chain (VLK), or both
- VLK lambda light variable region
- VLK lambda light constant chain
- the first and second heavy chain polypeptides form an Fc interface that enhances heterodimerization.
- (i)-(iv) e.g., nucleic acid encoding (i)-(iv)
- a single cell e.g., a single mammalian cell, e.g., a CHO cell.
- (i)-(iv) are expressed in the cell.
- (i)-(iv) e.g., nucleic acid encoding (i)-(iv)
- are introduced in different cells e.g., different mammalian cells, e.g., two or more CHO cell.
- (i)-(iv) are expressed in the cells.
- the method further comprises purifying a cell-expressed antibody molecule, e.g., using a lambda- and/or- kappa-specific purification, e.g., affinity
- the method further comprises evaluating the cell-expressed
- the purified cell-expressed multispecific antibody molecule can be analyzed by techniques known in the art, include mass spectrometry.
- the purified cell-expressed antibody molecule is cleaved, e.g., digested with papain to yield the Fab moieties and evaluated using mass spectrometry.
- the method produces correctly paired kappa/lambda multispecific, e.g., bispecific, antibody molecules in a high yield, e.g., at least 75%, 80, 90, 95, 98, 99 99.5 or 99.9 %.
- the multispecific, e.g., a bispecific, antibody molecule that includes:
- a first heavy chain polypeptide e.g., a heavy chain polypeptide comprising one, two, three or all of a first heavy chain variable region (first VH), a first CHI, a first heavy chain constant region (e.g., a first CH2, a first CH3, or both)), e.g., wherein the HCP1 binds to a first epitope;
- HCP2 a second heavy chain polypeptide
- second VH second heavy chain variable region
- second CHI second heavy chain constant region
- HCP2 binds to a second epitope
- LLCPl lambda light chain polypeptide
- VL1 lambda light variable region
- VL1 lambda light constant chain
- KLCP2 kappa light chain polypeptide
- VLk lambda light variable region
- VLk lambda light constant chain
- the first and second heavy chain polypeptides form an Fc interface that enhances heterodimerization.
- the multispecific antibody molecule has a first binding specificity that includes a hybrid VLl-CLl heterodimerized to a first heavy chain variable region connected to the Fc constant, CH2-CH3 domain (having a knob modification) and a second binding specificity that includes a hybrid VLk-CLk heterodimerized to a second heavy chain variable region connected to the Fc constant, CH2-CH3 domain (having a hole
- Multispecific molecules comprising non-contiguous polypeptides
- the multispecific molecule is not a single polypeptide chain.
- the antibody molecule includes two, complete heavy chains and two, complete light chains.
- the multispecific molecules having at least two or at least three non-contiguous polypeptide chains include a first and second heavy chain constant regions (e.g., a first and second Fc region) in at least two non-contiguous polypeptide chains, e.g., as described herein.
- the multispecific molecule is a bispecific or bifunctional molecule, wherein the first and second polypeptides (i) and (ii) are non-contiguous, e.g., are two separate polypeptide chains.
- the first and second polypeptides (i) and (ii) include a paired amino acid substitution at a position chosen from one or more of 347, 349, 350, 351, 366, 368, 370, 392, 394, 395, 397, 398, 399, 405, 407, or 409, e.g., of the Fc region of human IgGl, numbered based on the Eu numbering system.
- the first heavy chain constant region (e.g., the first Fc region) can include an amino acid substitution chosen from: T366S, L368A, or Y407V (e.g., corresponding to a cavity or hole), and the second heavy chain constant region (e.g., the second Fc region) includes a T366W (e.g., corresponding to a protuberance or knob), numbered based on the Eu numbering system.
- the first and second polypeptides are a first and second member of a heterodimeric first and second Fc region.
- the first polypeptide has the following configuration from N-to-C:
- a first portion of a first antigen domain e.g., a first VH-CH1 of a Fab molecule, that binds to a first antigen, e.g., CSF1R, connected, optionally via a linker to, the first heavy chain constant region (e.g., the CH2 connected to the CH3 region) (e.g., a first Fc region);
- a first portion of a second antigen domain e.g., a second VH-CH1 of a Fab molecule, that binds to a second antigen, e.g., CCR2 or CXCR2, connected, optionally via a linker to, the second heavy chain constant region (e.g., the CH2 connected to the CH3 region) (e.g., a first Fc region);
- the third polypeptide has the following configuration from N-to-C: a second portion of the first antigen domain, e.g., a first VL-
- VL-CL of the Fab where the VL is of lambda subtype and binds to a second antigen, e.g., a cancer antigen, e.g., CCR2 or CXCR2 (e.g., the same antigen bound by the second VH-CH1).
- a cancer antigen e.g., CCR2 or CXCR2 (e.g., the same antigen bound by the second VH-CH1).
- the first heavy chain constant region (e.g., the first CH2-CH3 region) includes a protuberance or knob, e.g., as described herein.
- the second heavy chain constant region (e.g., the second CH2-CH3 region) includes a cavity or hole.
- the first and second heavy chain constant regions promote heterodimerization of the bispecific molecule.
- the invention also features nucleic acids comprising nucleotide sequences that encode heavy and light chain variable regions and CDRs or hypervariable loops of the antibody molecules, as described herein.
- the invention features a first and second nucleic acid encoding heavy and light chain variable regions, respectively, of an antibody molecule chosen from one or more of the antibody molecules disclosed herein.
- the nucleic acid can comprise a nucleotide sequence as set forth in the tables herein, or a sequence substantially identical thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in the tables herein.
- the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a heavy chain variable region having an amino acid sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one or more substitutions, e.g. , conserved substitutions).
- the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a light chain variable region having an amino acid sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one or more substitutions, e.g. , conserved substitutions).
- the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs or hypervariable loops from heavy and light chain variable regions having an amino acid sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one or more substitutions, e.g. , conserved substitutions).
- the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a heavy chain variable region having the nucleotide sequence as set forth in the tables herein, a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a sequence substantially homologous thereto e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein.
- the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a light chain variable region having the nucleotide sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs or hypervariable loops from heavy and light chain variable regions having the nucleotide sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- the application features host cells and vectors containing the nucleic acids described herein.
- the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail herein below.
- vectors comprising the nucleotide sequences encoding an antibody molecule described herein.
- the vectors comprise nucleotides encoding an antibody molecule described herein.
- the vectors comprise the nucleotide sequences described herein.
- the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC).
- vectors utilize DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and
- cells which have stably integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow for the selection of transfected host cells.
- the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
- the selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as
- transcriptional promoters e.g., promoters, and termination signals.
- the expression vectors may be transfected or introduced into an appropriate host cell.
- Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques.
- protoplast fusion the cells are grown in media and screened for the appropriate activity.
- Methods and conditions for culturing the resulting transfected cells and for recovering the antibody molecule produced are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
- the application features host cells and vectors containing the nucleic acids described herein.
- the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell.
- the host cell can be a eukaryotic cell, e.g. , a mammalian cell, an insect cell, a yeast cell, or a prokaryotic cell, e.g. , E. coli.
- the mammalian cell can be a cultured cell or a cell line.
- Exemplary mammalian cells include lymphocytic cell lines (e.g., NSO), Chinese hamster ovary cells (CHO), COS cells, oocyte cells, and cells from a transgenic animal, e.g., mammary epithelial cell.
- lymphocytic cell lines e.g., NSO
- CHO Chinese hamster ovary cells
- COS cells e.g., COS cells
- oocyte cells e.g., oocyte cells
- cells from a transgenic animal e.g., mammary epithelial cell.
- the invention also provides host cells comprising a nucleic acid encoding an antibody molecule as described herein.
- the host cells are genetically engineered to comprise nucleic acids encoding the antibody molecule.
- the host cells are genetically engineered by using an expression cassette.
- expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences.
- Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
- the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
- Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
- Suitable insect cells include, but are not limited to, Sf9 cells.
- the multispecific molecule described herein alone or in combination with a second therapy or a second therapeutic agent, can be used to treat a hyperproliferative disorder, a cancer, or a fibrotic disorder.
- Methods described herein include treating a cancer in a subject by using a multispecific molecule described herein, e.g., using a pharmaceutical composition described herein. Also provided are methods for reducing or ameliorating a symptom of a cancer in a subject, as well as methods for inhibiting the growth of a cancer and/or killing one or more cancer cells. In embodiments, the methods described herein decrease the size of a tumor and/or decrease the number of cancer cells in a subject administered with a described herein or a pharmaceutical composition described herein.
- the cancer is a hematological cancer. In embodiments, the hematological cancer is a leukemia or a lymphoma.
- hematologic cancer refers to a tumor of the hematopoietic or lymphoid tissues, e.g., a tumor that affects blood, bone marrow, or lymph nodes.
- hematologic malignancies include, but are not limited to, leukemia (e.g., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), hairy cell leukemia, acute monocytic leukemia (AMoL), chronic myelomonocytic leukemia (CMML), juvenile
- lymphoma e.g., AIDS-related lymphoma, cutaneous T-cell lymphoma, Hodgkin lymphoma (e.g., classical Hodgkin lymphoma or nodular lymphocyte-predominant Hodgkin lymphoma), mycosis fungoides, non-Hodgkin lymphoma (e.g., B-cell non-Hodgkin lymphoma (e.g., Burkitt lymphoma, small lymphocytic lymphoma (CLL/SLL), diffuse large B-cell lymphoma, follicular lymphoma, immunoblastic large cell lymphoma, precursor B -lymphoblastic lymphoma, or mantle cell lymphoma) or T-cell non-Hodgkin lymphoma (mycosis fungoides, anaplastic large cell lymphom
- myelodysplastic syndrome or myelodysplastic/myeloproliferative neoplasm.
- the cancer is a solid cancer.
- Exemplary solid cancers include, but are not limited to, ovarian cancer, rectal cancer, stomach cancer, testicular cancer, cancer of the anal region, uterine cancer, colon cancer, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine, cancer of the esophagus, melanoma, Kaposi's sarcoma, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, brain stem glioma, pituitary adenoma, epidermoid cancer, carcinoma of the cervix squamous cell cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the vagina, sarcoma of soft tissue, cancer of the urethr
- the cancer is an epithelial, mesenchymal or hematologic malignancy.
- the cancer treated is a solid tumor (e.g., carcinoid, carcinoma or sarcoma), a soft tissue tumor (e.g., a heme malignancy), and a metastatic lesion, e.g., a metastatic lesion of any of the cancers disclosed herein.
- the cancer treated is a fibrotic or desmoplastic solid tumor, e.g., a tumor having one or more of: limited tumor perfusion, compressed blood vessels, fibrotic tumor interstitium, or increased interstitial fluid pressure.
- the solid tumor is chosen from one or more of pancreatic (e.g., pancreatic adenocarcinoma or pancreatic ductal adenocarcinoma), breast, colon, colorectal, lung (e.g., small cell lung cancer (SCLC) or non-small cell lung cancer (NSCLC)), skin, ovarian, liver cancer, esophageal cancer, endometrial cancer, gastric cancer, head and neck cancer, kidney, or prostate cancer.
- pancreatic e.g., pancreatic adenocarcinoma or pancreatic ductal adenocarcinoma
- lung e.g., small cell lung cancer (SCLC) or non-small cell lung cancer (NSCLC)
- SCLC small cell lung cancer
- NSCLC non-small cell lung cancer
- cancer examples include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers are noted below and include: squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer, non- small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
- lung cancer including small-cell lung cancer, non- small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer
- cancer includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
- primary malignant cells or tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor
- secondary malignant cells or tumors e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor.
- cancers or malignancies include, but are not limited to: Acute
- Hypergammaglobulinemia Hypopharyngeal Cancer, Intestinal Cancers, Intraocular Melanoma, Islet Cell Carcinoma, Islet Cell Pancreatic Cancer, Kaposi's Sarcoma, Kidney Cancer, Laryngeal Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer, Lymphoproliferative
- the multispecific molecule as described above and herein, is used to treat a hyperproliferative disorder, e.g., a hyperpoliferative connective tissue disorder (e.g., a hyperproliferative fibrotic disease).
- a hyperproliferative disorder e.g., a hyperpoliferative connective tissue disorder (e.g., a hyperproliferative fibrotic disease).
- the hyperproliferative fibrotic disease is multisystemic or organ- specific.
- Exemplary hyperproliferative fibrotic diseases include, but are not limited to, multisystemic (e.g., systemic sclerosis, multifocal fibrosclerosis, sclerodermatous graft-versus-host disease in bone marrow transplant recipients, nephrogenic systemic fibrosis, scleroderma), and organ-specific disorders (e.g., fibrosis of the eye, lung, liver, heart, kidney, pancreas, skin and other organs).
- the disorder is chosen from liver cirrhosis or tuberculosis.
- the disorder is leprosy.
- the multispecific molecules are administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease. Appropriate dosages may be determined by clinical trials. For example, when “an effective amount” or "a therapeutic amount” is indicated, the precise amount of the pharmaceutical composition (or multispecific molecules) to be administered can be determined by a physician with consideration of individual differences in tumor size, extent of infection or metastasis, age, weight, and condition of the subject.
- the pharmaceutical composition described herein can be administered at a dosage of 10 4 to 10 9 cells/kg body weight, e.g., 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. In embodiments, the pharmaceutical composition described herein can be administered multiple times at these dosages. In embodiments, the pharmaceutical composition described herein can be administered using infusion techniques described in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988).
- the multispecific molecules or pharmaceutical composition is administered to the subject parenterally.
- the cells are administered to the subject intravenously, subcutaneously, intratumorally, intranodally, intramuscularly,
- the cells are administered, e.g., injected, directly into a tumor or lymph node.
- the cells are administered as an infusion (e.g., as described in Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988) or an intravenous push.
- the cells are administered as an injectable depot formulation.
- the subject is a mammal.
- the subject is a human, monkey, pig, dog, cat, cow, sheep, goat, rabbit, rat, or mouse.
- the subject is a human.
- the subject is a pediatric subject, e.g., less than 18 years of age, e.g., less than 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 or less years of age.
- the subject is an adult, e.g., at least 18 years of age, e.g., at least 19, 20, 21, 22, 23, 24, 25, 25-30, 30-35, 35- 40, 40-50, 50-60, 60-70, 70-80, or 80-90 years of age.
- This invention also provides methods of treating liver conditions or disorders using the multispecific molecules or pharmaceutical compositions described herein.
- liver disorder therapy refers to therapies or therapeutic agents used to treat or prevent a liver disorder described herein, and therefore encompasses liver cancer therapies and other liver disorder therapies, e.g., therapies for fibrotic liver disorders, fatty liver diseases, liver inflammation disorders, autoimmune liver diseases, and liver disorders induced by genetic diseases, alcoholism, drug toxicity, infection, or injury.
- liver cancers include: hepatocellular carcinoma (HCC), primary liver cell carcinoma, hepatoma, fibrolamellar carcinoma, focal nodular hyperplasia, cholangio sarcoma, intrahepatic bile duct cancer, angiosarcoma or hemangiosarcoma, hepatic adenoma, hepatic hemangiomas, hepatic hamartoma, hepatoblastoma, infantile hemangioendothelialoma, mixed tumors of the liver, tumors of mesenchymal tissue, sarcoma of the liver.
- HCC hepatocellular carcinoma
- primary liver cell carcinoma hepatoma
- fibrolamellar carcinoma focal nodular hyperplasia
- cholangio sarcoma intrahepatic bile duct cancer
- angiosarcoma or hemangiosarcoma intrahepatic bile duct cancer
- the liver disorder is a fibrotic disorder or connective tissue disorder affecting the function or physiology of the liver.
- the fibrotic disorder or connective tissue disorder can be systemic (affecting the whole body), multi-organ, or organ- specific (e.g., liver-specific).
- fibrotic liver disorders include liver fibrosis (hepatic fibrosis), liver cirrhosis, and any disorder associated with accumulation of extracellular matrix proteins, e.g., collagen, in the liver, liver scarring, and/or abnormal hepatic vasculature.
- Liver fibrosis is caused by liver inflammation or damage which triggers the accumulation of extracellular matrix proteins, including collagens, and scar tissue in the liver.
- Liver cirrhosis is the end stage of liver fibrosis, involves regenerative nodules (as a result of repair processes), and is accompanied with the distortion of the hepatic vasculature. Liver fibrotic disorders are most commonly caused by chronic viral infection (e.g., hepatitis B, hepatitis C), alcoholism, and fatty liver disease.
- fatty liver diseases include fatty liver (or FLD), alcoholic liver disease, nonalcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), alcoholic steatohepatitis, simple steatosis, Reye's syndrome, and any disorder associated with abnormal retention of lipids in liver cells.
- FLD fatty liver
- NAFLD nonalcoholic fatty liver disease
- NASH non-alcoholic steatohepatitis
- alcoholic steatohepatitis simple steatosis
- Reye's syndrome any disorder associated with abnormal retention of lipids in liver cells.
- the liver disease is NASH.
- Metabolic disorders can also affect the liver and cause liver damage.
- Examples of metabolic disorders of the liver or affecting the liver include hemachromatosis, diabetes, obesity, hypertension, dyslipidemia, galactosemia, and glycogen storage disease.
- Autoimmune disorders of the liver or affecting the liver can include systemic disorders or disorders that primarily affect an organ other than the liver, but with secondary effects to liver cells or liver function.
- autoimmune disorders include autoimmune hepatitis (AIH), autoimmune liver disease, lupoid hepatitis, systemic lupus erythematosus, primary biliary cirrhosis (PBC), scleroderma, and systemic scerlosis.
- the invention features a method of treating or preventing a fibrotic condition or disorder in a subject.
- the method includes administering the multispecific molecule, as a single agent or in combination with another agent or therapeutic modality, to a subject in need thereof, in an amount sufficient to decrease or inhibit the fibrotic condition in the subject.
- reducing fibrosis, or treatment of a fibrotic condition includes reducing or inhibiting one or more of: formation or deposition of tissue fibrosis; reducing the size, cellularity (e.g., fibroblast or immune cell numbers), composition; or cellular content, of a fibrotic lesion; reducing the collagen or hydroxyproline content, of a fibrotic lesion; reducing expression or activity of a fibrogenic protein; reducing fibrosis associated with an inflammatory response; decreasing weight loss associated with fibrosis; or increasing survival.
- tissue fibrosis includes reducing or inhibiting one or more of: formation or deposition of tissue fibrosis; reducing the size, cellularity (e.g., fibroblast or immune cell numbers), composition; or cellular content, of a fibrotic lesion; reducing the collagen or hydroxyproline content, of a fibrotic lesion; reducing expression or activity of a fibrogenic protein; reducing fibrosis associated with an inflammatory response; decreasing weight loss associated with fibro
- the fibrotic condition is primary fibrosis. In one embodiment, the fibrotic condition is idiopathic. In other embodiments, the fibrotic condition is associated with (e.g., is secondary to) a disease (e.g., an infectious disease, an inflammatory disease, an autoimmune disease, a malignant or cancerous disease, and/or a connective disease); a toxin; an insult (e.g., an environmental hazard (e.g., asbestos, coal dust, polycyclic aromatic
- hydrocarbons hydrocarbons
- cigarette smoking a wound
- a medical treatment e.g., surgical incision, chemotherapy or radiation
- the fibrotic condition is a fibrotic condition of the lung, a fibrotic condition of the liver (e.g., as described herein), a fibrotic condition of the heart or vasculature, a fibrotic condition of the kidney, a fibrotic condition of the skin, a fibrotic condition of the gastrointestinal tract, a fibrotic condition of the bone marrow or a hematopoietic tissue, a fibrotic condition of the nervous system, a fibrotic condition of the eye, or a combination thereof.
- a fibrotic condition of the lung a fibrotic condition of the liver (e.g., as described herein), a fibrotic condition of the heart or vasculature, a fibrotic condition of the kidney, a fibrotic condition of the skin, a fibrotic condition of the gastrointestinal tract, a fibrotic condition of the bone marrow or a hematopoietic tissue, a fibrotic condition of the nervous system, a fibrotic
- the fibrotic condition is a fibrotic condition of the lung. In certain embodiments, the fibrotic condition of the lung is chosen from one or more of:
- the fibrosis of the lung is secondary to a disease, a toxin, an insult, a medical treatment, or a combination thereof.
- the fibrosis of the lung can be associated with (e.g., secondary to) one or more of: a disease process such as asbestosis and silicosis; an occupational hazard; an environmental pollutant; cigarette smoking; an autoimmune connective tissue disorders (e.g., rheumatoid arthritis, scleroderma and systemic lupus erythematosus (SLE)); a connective tissue disorder such as sarcoidosis; an infectious disease, e.g., infection, particularly chronic infection; a medical treatment, including but not limited to, radiation therapy, and drug therapy, e.g., chemotherapy (e.g., treatment with as bleomycin, methotrexate, amiodarone, busulfan, and/or nitrofurantoin).
- the fibrotic condition of the lung treated with the methods of the invention is associated with (e.g., secondary to) a cancer treatment, e.g., treatment of a cancer (e.g., squamous cell carcinoma, testicular cancer, Hodgkin's disease with bleomycin).
- a cancer e.g., squamous cell carcinoma, testicular cancer, Hodgkin's disease with bleomycin.
- the fibrotic condition of the lung is associated with an autoimmune connective tissue disorder (e.g., scleroderma or lupus, e.g., SLE).
- Pulmonary fibrosis can occur as a secondary effect in disease processes such as asbestosis and silicosis, and is known to be more prevalent in certain occupations such as coal miner, ship workers and sand blasters where exposure to environmental pollutants is an occupational hazard (Green, FH et al. (2007) Toxicol Pathol. 35: 136-47).
- Other factors that contribute to pulmonary fibrosis include cigarette smoking, and autoimmune connective tissue disorders, like rheumatoid arthritis, scleroderma and systemic lupus erythematosus (SLE) (Leslie, KO et al. (2007) Semin Respir Crit Care Med. 28:369-78; Swigris, JJ et al. (2008) Chest.
- sarcoidosis can include pulmonary fibrosis as part of the disease (Paramothayan, S et al. (2008) Respir Med. 102: 1-9), and infectious diseases of the lung can cause fibrosis as a long term consequence of infection, particularly chronic infections.
- Pulmonary fibrosis can also be a side effect of certain medical treatments, particularly radiation therapy to the chest and certain medicines like bleomycin, methotrexate, amiodarone, busulfan, and nitrofurantoin (Catane, R et al. (1979) Int J Radiat Oncol Biol Phys. 5: 1513-8; Zisman, DA et al. (2001) Sarcoidosis Vase Diffuse Lung Dis. 18:243-52; Rakita, L et al. (1983) Am Heart J. 106:906-16; Twohig, KJ et al. (1990) Clin Chest Med. 11:31-54; and Witten CM. (1989) Arch Phys Med Rehabil.
- idiopathic pulmonary fibrosis can occur where no clear causal agent or disease can be identified. Genetic factors can play a significant role in these cases of pulmonary fibrosis (Steele, MP et al. (2007) Respiration 74:601- 8; Brass, DM et al. (2007) Proc Am Thorac Soc. 4:92-100 and du Bois RM. (2006) Semin Respir Crit Care Med. 27:581-8).
- pulmonary fibrosis includes, but is not limited to, pulmonary fibrosis associated with chronic obstructive pulmonary disease (COPD), acute respiratory distress syndrome, scleroderma, pleural fibrosis, chronic asthma, acute lung syndrome, amyloidosis, bronchopulmonary dysplasia, Caplan's disease, Dressler's syndrome, histiocytosis X, idiopathic pulmonary haemosiderosis, lymphangiomyomatosis, mitral valve stenosis, polymyositis, pulmonary edema, pulmonary hypertension (e.g., idiopathic pulmonary
- COPD chronic obstructive pulmonary disease
- COPD chronic obstructive pulmonary disease
- acute respiratory distress syndrome scleroderma
- pleural fibrosis chronic asthma
- acute lung syndrome amyloidosis
- bronchopulmonary dysplasia Caplan's disease
- Dressler's syndrome histiocytosis X
- IPH hypertension
- radiotherapy e.g., radiation induced fibrosis
- rheumatoid disease Shaver's disease, systemic lupus erythematosus, systemic sclerosis, tropical pulmonary eosinophilia, tuberous sclerosis, Weber-Christian disease, Wegener's granulomatosis, Whipple's disease, or exposure to toxins or irritants (e.g., pharmaceutical drugs such as amiodarone, bleomycin, busulphan, carmustine, chloramphenicol, hexamethonium, methotrexate,
- toxins or irritants e.g., pharmaceutical drugs such as amiodarone, bleomycin, busulphan, carmustine, chloramphenicol, hexamethonium, methotrexate,
- the pulmonary fibrosis is associated with an inflammatory disorder of the lung, e.g., asthma, and/or COPD.
- the fibrotic condition is a fibrotic condition of the liver.
- the fibrotic condition of the liver is chosen from one or more of: fatty liver disease, steatosis (e.g., nonalcoholic steatohepatitis (NASH), cholestatic liver disease (e.g., primary biliary cirrhosis (PBC)), cirrhosis, alcohol induced liver fibrosis, biliary duct injury, biliary fibrosis, or cholangiopathies.
- fatty liver disease e.g., nonalcoholic steatohepatitis (NASH), cholestatic liver disease (e.g., primary biliary cirrhosis (PBC)), cirrhosis, alcohol induced liver fibrosis, biliary duct injury, biliary fibrosis, or cholangiopathies.
- steatosis e.g., nonalcoholic steatohepatitis (NASH)
- hepatic or liver fibrosis includes, but is not limited to, hepatic fibrosis associated with alcoholism, viral infection, e.g., hepatitis (e.g., hepatitis C, B or D), autoimmune hepatitis, non-alcoholic fatty liver disease (NAFLD), progressive massive fibrosis, exposure to toxins or irritants (e.g., alcohol, pharmaceutical drugs and environmental toxins). Additional examples of liver conditions and disorders are provided in the Sections entitled "Liver Conditions or Disorders," provided herein.
- the fibrotic condition is a fibrotic condition of the kidney.
- the fibrotic condition of the kidney is chosen from one or more of: renal fibrosis (e.g., chronic kidney fibrosis), nephropathies associated with injury /fibrosis (e.g., chronic nephropathies associated with diabetes (e.g., diabetic nephropathy)), lupus, scleroderma of the kidney, glomerular nephritis, focal segmental glomerular sclerosis, IgA nephropathyrenal fibrosis associated with human chronic kidney disease (CKD), chronic progressive nephropathy
- renal fibrosis e.g., chronic kidney fibrosis
- nephropathies associated with injury /fibrosis e.g., chronic nephropathies associated with diabetes (e.g., diabetic nephropathy)
- lupus e.g., chronic nephropathies associated with diabetes (e.
- tubulointerstitial fibrosis tubulointerstitial fibrosis, ureteral obstruction, chronic uremia, chronic interstitial nephritis, radiation nephropathy, glomerulosclerosis, progressive glomerulonephrosis (PGN), endothelial/thrombotic microangiopathy injury, HIV-associated nephropathy, or fibrosis associated with exposure to a toxin, an irritant, or a chemotherapeutic agent.
- the fibrotic condition of the kidney is scleroderma of the kidney.
- the fibrotic condition of the kidney is transplant nephropathy, diabetic nephropathy, lupus nephritis, focal segmental glomerulosclerosis (FSGS), endothelial/thrombotic microangiopathy injury, scleroderma of the kidney, HIV-associated nephropathy (HIVVAN), or exposure to toxins, irritants, chemotherapeutic agents.
- FSGS focal segmental glomerulosclerosis
- HIV-associated nephropathy HIV-associated nephropathy
- the fibrotic condition is a fibrotic condition of the bone marrow or a hematopoietic tissue.
- the fibrotic condition of the bone marrow is an intrinsic feature of a chronic myeloproliferative neoplasm of the bone marrow, such as primary myelofibrosis (also referred to herein as agnogenic myeloid metaplasia or chronic idiopathic myelofibrosis).
- the bone marrow fibrosis is associated with (e.g., is secondary to) a malignant condition or a condition caused by a clonal proliferative disease.
- the bone marrow fibrosis is associated with a hematologic disorder (e.g., a hematologic disorder chosen from one or more of polycythemia vera, essential thrombocythemia, myelodysplasia, hairy cell leukemia, lymphoma (e.g., Hodgkin or non- Hodgkin lymphoma), multiple myeloma or chronic myelogeneous leukemia (CML)).
- a hematologic disorder e.g., a hematologic disorder chosen from one or more of polycythemia vera, essential thrombocythemia, myelodysplasia, hairy cell leukemia, lymphoma (e.g., Hodgkin or non- Hodgkin lymphoma), multiple myeloma or chronic myelogeneous leukemia (CML)).
- a hematologic disorder e.g., a hematologic disorder chosen from
- the bone marrow fibrosis is associated with (e.g., secondary to) a non-hematologic disorder (e.g., a non-hematologic disorder chosen from solid tumor metastasis to bone marrow, an autoimmune disorder (e.g., systemic lupus erythematosus, scleroderma, mixed connective tissue disorder, or polymyositis), an infection (e.g., tuberculosis or leprosy), or secondary hyperparathyroidism associated with vitamin D deficiency.
- the fibrotic condition is idiopathic or drug-induced myelofibrosis.
- the fibrotic condition of the bone marrow or hematopoietic tissue is associated with systemic lupus erythematosus or scleroderma.
- the fibrotic condition is associated with leprosy or tuberculosis. In certain embodiments, the fibrotic condition is a fibrotic condition of the bone marrow. In certain embodiments, the fibrotic condition of the bone marrow is myelofibrosis (e.g., primary myelofibrosis (PMF)), myeloid metaplasia, chronic idiopathic myelofibrosis, or primary myelofibrosis. In other embodiments, bone marrow fibrosis is associated with a hematologic disorder chosen from one or more of hairy cell leukemia, lymphoma, or multiple myeloma.
- myelofibrosis e.g., primary myelofibrosis (PMF)
- myeloid metaplasia e.g., chronic idiopathic myelofibrosis, or primary myelofibrosis.
- bone marrow fibrosis is associated with a hematologic
- the bone marrow fibrosis is associated with one or more myeloproliferative neoplasms (MPN) chosen from: essential thrombocythemia (ET),
- MPN myeloproliferative neoplasms
- ET essential thrombocythemia
- PV polycythemia vera
- mastocytosis chronic eosinophilic leukemia, chronic neutrophilic leukemia, or other MPN.
- the fibrotic condition is primary myelofibrosis.
- myelofibrosis (also referred to in the literature as idiopathic myeloid metaplasia, and Agnogenic myeloid metaplasia) is a clonal disorder of multipotent hematopoietic progenitor cells (reviewed in Abdel-Wahab, O. et al. (2009) Annu. Rev. Med. 60:233-45; Varicchio, L. et al. (2009) Expert Rev. Hematol. 2(3):315-334; Agrawal, M. et al. (2010) Cancer 1-15).
- PMF myelofibrosis
- the fibrotic condition is a fibrotic condition of the heart.
- the fibrotic condition of the heart is myocardial fibrosis (e.g., myocardial fibrosis associated with radiation myocarditis, a surgical procedure complication (e.g., myocardial post-operative fibrosis), infectious diseases (e.g., Chagas disease, bacterial, trichinosis or fungal myocarditis)); granulomatous, metabolic storage disorders (e.g.,
- the myocardial fibrosis is associated with an inflammatory disorder of cardiac tissue (e.g., myocardial sarcoidosis).
- the fibrotic condition is a fibrotic condition associated with a myocardial infarction. In some embodiments, the fibrotic
- condition is a fibrotic condition associated with congestive heart failure.
- the fibrotic condition is associated with an autoimmune disease selected from scleroderma or lupus, e.g., systemic lupus erythematosus.
- the fibrotic condition is systemic.
- the fibrotic condition is systemic sclerosis (e.g., limited systemic sclerosis, diffuse systemic sclerosis, or systemic sclerosis sine scleroderma), nephrogenic systemic fibrosis, cystic fibrosis, chronic graft vs. host disease, or atherosclerosis.
- the fibrotic condition is scleroderma.
- the scleroderma is localized, e.g., morphea or linear scleroderma.
- the condition is a systemic sclerosis, e.g., limited systemic sclerosis, diffuse systemic sclerosis, or systemic sclerosis sine scleroderma.
- the fibrotic condition affects a tissue chosen from one or more of muscle, tendon, cartilage, skin (e.g., skin epidermis or endodermis), cardiac tissue, vascular tissue (e.g., artery, vein), pancreatic tissue, lung tissue, liver tissue, kidney tissue, uterine tissue, ovarian tissue, neural tissue, testicular tissue, peritoneal tissue, colon, small intestine, biliary tract, gut, bone marrow, hematopoietic tissue, or eye (e.g., retinal) tissue.
- skin e.g., skin epidermis or endodermis
- cardiac tissue e.g., vascular tissue (e.g., artery, vein)
- pancreatic tissue e.g., lung tissue, liver tissue, kidney tissue, uterine tissue, ovarian tissue
- neural tissue e.g., testicular tissue, peritoneal tissue, colon, small intestine, biliary tract, gut, bone marrow,
- the fibrotic condition is a fibrotic condition of the eye.
- the fibrotic condition is glaucoma, macular degeneration (e.g., age-related macular degeneration), macular edema (e.g., diabetic macular edema), retinopathy (e.g., diabetic retinopathy), or dry eye disease.
- macular degeneration e.g., age-related macular degeneration
- macular edema e.g., diabetic macular edema
- retinopathy e.g., diabetic retinopathy
- dry eye disease e.g., diabetic retinopathy
- the fibrotic condition is a fibrotic condition of the skin.
- the fibrotic condition of the skin is chosen from one or more of: skin fibrosis (e.g., hypertrophic scarring, keloid), scleroderma, nephrogenic systemic fibrosis (e.g., resulting after exposure to gadolinium (which is frequently used as a contrast substance for MRIs) in patients with severe kidney failure), and keloid.
- the fibrotic condition is a fibrotic condition of the
- the fibrotic condition is chosen from one or more of: fibrosis associated with scleroderma; radiation induced gut fibrosis; fibrosis associated with a foregut inflammatory disorder such as Barrett's esophagus and chronic gastritis, and/or fibrosis associated with a hindgut inflammatory disorder, such as inflammatory bowel disease (IBD), ulcerative colitis and Crohn's disease.
- the fibrotic condition of the gastrointestinal tract is fibrosis associated with scleroderma.
- the fibrotic condition is a chronic fibrotic condition or disorder.
- the fibrotic condition is associated with an inflammatory condition or disorder.
- the fibrotic and/or inflammatory condition is osteomyelitis, e.g., chronic osteomyelitis.
- the fibrotic condition is an amyloidosis. In certain embodiments, the amyloidosis is associated with chronic osteomyelitis.
- the one or more compositions described herein is administered in combination with one or more other therapeutic agents.
- therapeutic agents include, but are not limited to, anti-fibrotics, corticosteroids, antiinflammatories, immunosuppressants, chemotherapeutic agents, anti-metabolites, and immunomodulators.
- adefovir dipivoxil candesartan, colchicine, combined ATG, mycophenolate mofetil, and tacrolimus, combined cyclosporine microemulsion and tacrolimus, elastometry, everolimus, FG-3019, Fuzheng Huayu, GI262570, glycyrrhizin (monoammonium glycyrrhizinate, glycine, L-cysteine monohydrochloride), interferon gamma- lb, irbesartan, losartan, oltipraz, ORAL IMPACT®, peginterferon alfa-2a, combined peginterferon alfa-2a and ribavirin, peginterferon alfa-2b (SCH 54031), combined peginterferon alpha-2b and
- tauroursodeoxycholic acid tauroursodeoxycholic acid, tocopherol, ursodiol, warfarin, and combinations thereof.
- the multispecific molecules disclosed herein can be used in combination with a second therapeutic agent or procedure.
- the multispecific molecule and the second therapeutic agent or procedure are administered/performed after a subject has been diagnosed with a cancer, e.g., before the cancer has been eliminated from the subject. In embodiments, the multispecific molecule and the second therapeutic agent or procedure are administered/performed
- combination therapy can lead to more effective treatment than monotherapy with either agent alone.
- the combination of the first and second treatment is more effective (e.g., leads to a greater reduction in symptoms and/or cancer cells) than the first or second treatment alone.
- the combination therapy permits use of a lower dose of the first or the second treatment compared to the dose of the first or second treatment normally required to achieve similar effects when administered as a monotherapy.
- the combination therapy has a partially additive effect, wholly additive effect, or greater than additive effect.
- the multispecific molecule is administered in combination with a therapy, e.g., a cancer therapy (e.g., one or more of anti-cancer agents, immunotherapy, photodynamic therapy (PDT), surgery and/or radiation).
- a cancer therapy e.g., one or more of anti-cancer agents, immunotherapy, photodynamic therapy (PDT), surgery and/or radiation.
- chemotherapeutic e.g., one or more of anti-cancer agents, immunotherapy, photodynamic therapy (PDT), surgery and/or radiation.
- chemotherapeutic agent and “anti-cancer agent” are used interchangeably herein.
- the administration of the multispecific molecule and the therapy e.g., the cancer therapy, can be sequential (with or without overlap) or simultaneous.
- Administration of the multispecific molecule can be continuous or intermittent during the course of therapy (e.g., cancer therapy).
- Certain therapies described herein can be used to treat cancers and non-cancerous diseases.
- PDT efficacy can be enhanced in cancerous and non-cancerous conditions (e.g., tuberculosis) using the methods and compositions described herein (reviewed in, e.g., Agostinis, P. et al. (2011) CA Cancer J. Clin. 61:250-281).
- the multispecific molecule is administered in combination with a low or small molecular weight chemotherapeutic agent.
- exemplary low or small molecular weight chemotherapeutic agents include, but not limited to, 13-cis-retinoic acid (isotretinoin, ACCUTANE®), 2-CdA (2-chlorodeoxyadenosine, cladribine, LEUSTATINTM), 5-azacitidine (azacitidine, VIDAZA®), 5-fluorouracil (5-FU, fluorouracil, ADRUCIL®), 6-mercaptopurine (6-MP, mercaptopurine, PURINETHOL®), 6-TG (6-thioguanine, thioguanine, THIOGUANINE TABLOID®), abraxane (paclitaxel protein-bound), actinomycin-D (dactinomycin,
- VESANOID® VESANOID®
- altretamine hexamethylmelamine, HMM, HEXALEN®
- amethopterin hexamethylmelamine, HMM, HEXALEN®
- KIDROLASE® BCNU (carmustine, BiCNU®), bendamustine (TREANDA®), bexarotene (TARGRETIN®), bleomycin (BLENOXANE®), busulfan (BUSULFEX®, MYLERAN®), calcium leucovorin (Citrovorum Factor, folinic acid, leucovorin), camptothecin-11 (CPT-11, irinotecan, CAMPTOSAR®), capecitabine (XELODA®), carboplatin (PARAPLATIN®), carmustine wafer (prolifeprospan 20 with carmustine implant, GLIADEL® wafer), CCI-779 (temsirolimus, TORISEL®), CCNU (lomustine, CeeNU), CDDP (cisplatin, PLATINOL®, PLATINOL-AQ®), chlorambucil (leukeran), cyclophosphamide (CYTOXAN®, NEOSAR®), daca
- FLUDARA® fluorouracil (cream)
- CARACTM EFUDEX®
- FLUOROPLEX® gemcitabine
- GEMZAR® gemcitabine
- hydroxyurea HYDREA®, DROXIATM, MYLOCELTM
- idarubicin idarubicin
- ZANOSAR® temozolomide
- TEMODAR® temozolomide
- VM-26 teniposide
- TESPA thiophosphoamide, thiotepa, TSPA, THIOPLEX®
- topotecan HYC AMTIN®
- vinblastine vinblastine sulfate, vincaleukoblastine, VLB, ALKABAN-AQ®, VELBAN®
- vinorelbine vinorelbine tartrate, NAVELBINE®
- vorinostat ZOLINZA®
- the multispecific molecule is administered in conjunction with a biologic.
- Biologies useful in the treatment of cancers are known in the art and a binding molecule of the invention may be administered, for example, in conjunction with such known biologies.
- the FDA has approved the following biologies for the treatment of breast cancer: HERCEPTIN® (trastuzumab, Genentech Inc., South San Francisco, Calif.; a humanized monoclonal antibody that has anti-tumor activity in HER2-positive breast cancer); FASLODEX® (fulvestrant, AstraZeneca Pharmaceuticals, LP, Wilmington, Del.; an estrogen- receptor antagonist used to treat breast cancer); ARIMIDEX® (anastrozole, AstraZeneca Pharmaceuticals, LP; a nonsteroidal aromatase inhibitor which blocks aromatase, an enzyme needed to make estrogen); Aromasin® (exemestane, Pfizer Inc., New York, N.Y.; an
- AVASTIN® bevacizumab, Genentech Inc.; the first FDA-approved therapy designed to inhibit angiogenesis
- ZEVALIN® ibritumomab tiuxetan, Biogen Stahl, Cambridge, Mass.; a radiolabeled monoclonal antibody currently approved for the treatment of B-cell lymphomas
- AVASTIN® avian avian
- ERBITUX® cetuximab, ImClone Systems Inc., New York, N.Y., and Bristol-Myers Squibb, New York, N.Y.
- EGFR epidermal growth factor receptor
- GLEEVEC® imatinib mesylate; a protein kinase inhibitor
- ERGAMISOL® levamisole hydrochloride, Janssen Pharmaceutica Products, LP, Titusville, N.J.; an immunomodulator approved by the FDA in 1990 as an adjuvant treatment in
- exemplary biologies include TARCEVA® (erlotinib HCL, OSI Pharmaceuticals Inc., Melville, N.Y.; a small molecule designed to target the human epidermal growth factor receptor 1 (HER1) pathway).
- TARCEVA® erlotinib HCL, OSI Pharmaceuticals Inc., Melville, N.Y.
- HER1 human epidermal growth factor receptor 1
- exemplary biologies include VELCADE® Velcade (bortezomib, Millennium Pharmaceuticals, Cambridge Mass.; a proteasome inhibitor). Additional biologies include THALIDOMID® (thalidomide, Clegene Corporation, Warren, N.J.; an immunomodulatory agent and appears to have multiple actions, including the ability to inhibit the growth and survival of myeloma cells and anti-angiogenesis).
- Additional exemplary cancer therapeutic antibodies include, but are not limited to, 3F8, abagovomab, adecatumumab, afutuzumab, alacizumab pegol, alemtuzumab (CAMPATH®, MABCAMPATH®), altumomab pentetate (HYBRI-CEAKER®), anatumomab mafenatox, anrukinzumab (IMA-638), apolizumab, arcitumomab (CEA-SCAN®), bavituximab,
- bectumomab (LYMPHOSCAN®), belimumab (BENLYSTA®, LYMPHOSTAT-B®), besilesomab (SCINTIMUN®), bevacizumab (AVASTIN®), bivatuzumab mertansine, blinatumomab, brentuximab vedotin, cantuzumab mertansine, capromab pendetide
- PROSTASCINT® catumaxomab (REMOVAB®), CC49, cetuximab (C225, ERBITUX®), citatuzumab reachingox, cixutumumab, clivatuzumab tetraxetan, conatumumab, dacetuzumab, denosumab (PROLIA®), detumomab, ecromeximab, edrecolomab (PANOREX®), elotuzumab, epitumomab cituxetan, epratuzumab, ertumaxomab (REXOMUN®), etaracizumab,
- MYLOTARG® girentuximab, glembatumumab vedotin, ibritumomab (ibritumomab tiuxetan, ZEVALIN®), igovomab (INDIMACIS-125®), intetumumab, inotuzumab ozogamicin, ipilimumab, iratumumab, labetuzumab (CEA-CIDE®), lexatumumab, lintuzumab,
- the multispecific molecule is administered in combination with a viral cancer therapeutic agent.
- viral cancer therapeutic agents include, but not limited to, vaccinia virus (vvDD-CDSR), carcinoembryonic antigen-expressing measles virus, recombinant vaccinia virus (TK-deletion plus GM-CSF), Seneca Valley virus-001, Newcastle virus, coxsackie virus A21, GL-ONC1, EBNA1 C-terminal/LMP2 chimeric protein-expressing recombinant modified vaccinia Ankara vaccine, carcinoembryonic antigen-expressing measles virus, G207 oncolytic virus, modified vaccinia virus Ankara vaccine expressing p53, OncoVEX GM-CSF modified herpes-simplex 1 virus, fowlpox virus vaccine vector, recombinant vaccinia prostate-specific antigen vaccine, human papillomavirus 16/18 LI virus-like particle/AS04 vaccine, MVA-EB
- the multispecific molecule is administered in combination with a nanopharmaceutical.
- exemplary cancer nanopharmaceuticals include, but not limited to, ABRAXANE® (paclitaxel bound albumin nanoparticles), CRLXlOl (CPT conjugated to a linear cyclodextrin-based polymer), CRLX288 (conjugating docetaxel to the biodegradable polymer poly (lactic-co-glycolic acid)), cytarabine liposomal (liposomal Ara-C, DEPOCYTTM), daunorubicin liposomal (DAUNOXOME®), doxorubicin liposomal (DOXIL®, CAELYX®), encapsulated-daunorubicin citrate liposome (DAUNOXOME®), and PEG anti-VEGF aptamer (MACUGEN®).
- ABRAXANE® paclitaxel bound albumin nanoparticles
- CRLXlOl
- the multispecific molecule is administered in combination with paclitaxel or a paclitaxel formulation, e.g., TAXOL®, protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAXOL®), protein-bound paclitaxel (e.g., TAX
- paclitaxel formulations include, but are not limited to, nanoparticle albumin-bound paclitaxel (ABRAXANE®, marketed by Abraxis Bioscience), docosahexaenoic acid bound-paclitaxel (DHA-paclitaxel, Taxoprexin, marketed by Protarga), polyglutamate bound-paclitaxel (PG-paclitaxel, paclitaxel poliglumex, CT-2103, XYOTAX, marketed by Cell Therapeutic), the tumor-activated prodrug (TAP), ANG105 (Angiopep-2 bound to three molecules of paclitaxel, marketed by ImmunoGen), paclitaxel-EC-1 (paclitaxel bound to the erbB2-recognizing peptide EC-1; see Li et al., Biopolymers (2007) 87:225-230), and glucose- conjugated paclitaxel (e.g., 2'-paclitaxel methyl 2-glu
- RNAi and antisense RNA agents for treating cancer include, but not limited to, CALAA-01, siG12D LODER (Local Drug EluteR), and ALN-VSP02.
- cancer therapeutic agents include, but not limited to, cytokines (e.g., aldesleukin (IL-2, Interleukin-2, PROLEUKIN®), alpha Interferon (IFN-alpha, Interferon alfa, INTRON® A (Interferon alfa-2b), ROFERON-A® (Interferon alfa-2a)), Epoetin alfa (PROCRIT®), filgrastim (G-CSF, Granulocyte - Colony Stimulating Factor, NEUPOGEN®), GM-CSF (Granulocyte Macrophage Colony Stimulating Factor, sargramostim, LEUKINETM), IL- 11 (Interleukin-11, oprelvekin, NEUMEGA®), Interferon alfa-2b (PEG conjugate) (PEG interferon, PEG- INTRONTM), and pegfilgrastim (NEULASTATM)), hormone therapy agents (e.g., cytokines (
- NPLATE® tamoxifen
- NOVALDEX® tamoxifen
- FRESTON® toremifene
- phospholipase A2 inhibitors e.g., anagrelide (AGRYLIN®)
- biologic response modifiers e.g., BCG
- target therapy agents e.g., bortezomib (VELCADE®), dasatinib (SPRYCELTM), denileukin diftitox (ONTAK®), erlotinib (TARCEVA®), everolimus (AFINITOR®), gefitinib (IRESSA®), imatinib mesylate (STI-571, GLEEVECTM), lapatinib (TYKERB®), sorafenib (NEXAVAR®), and SU11248 (sunitinib, SUTENT®)), immunomodulatory and antiangiogenic agents (e.g., CC-5013 (lenalidomide, REVLIMID®), and thalidomide (THALOMID®)), glucocorticosteroids (e.g., cortisone
- glucocorticosteroids e.g., cortisone
- hydrocortisone hydrocortisone sodium phosphate, hydrocortisone sodium succinate, ALA- CORT®, HYDROCORT ACETATE®, hydrocortone phosphate LANACORT®, SOLU- CORTEF®
- decadron decadron
- dexamethasone dexamethasone acetate, dexamethasone sodium phosphate
- DEXASONE® DEXASONE®
- DIODEX® HEXADROL®
- MAXIDEX® methylprednisolone
- methylprednisolone 6- methylprednisolone, methylprednisolone acetate, methylprednisolone sodium succinate
- the multispecific molecule is used in combination with a tyrosine kinase inhibitor (e.g., a receptor tyrosine kinase (RTK) inhibitor).
- a tyrosine kinase inhibitor include, but are not limited to, an epidermal growth factor (EGF) pathway inhibitor (e.g., an epidermal growth factor receptor (EGFR) inhibitor), a vascular endothelial growth factor (VEGF) pathway inhibitor (e.g., an antibody against VEGF, a VEGF trap, a vascular endothelial growth factor receptor (VEGFR) inhibitor (e.g., a VEGFR-1 inhibitor, a VEGFR-2 inhibitor, a VEGFR-3 inhibitor)), a platelet derived growth factor (PDGF) pathway inhibitor (e.g., a platelet derived growth factor receptor (PDGFR) inhibitor (e.g., a PDGFR- ⁇ inhibitor)), a RAF-1 inhibitor, a KIT inhibitor and
- the anti-cancer agent used in combination with the multispecific molecule is selected from the group consisting of: axitinib (AG013736), bosutinib (SKI-606), cediranib (RECENTINTM, AZD2171), dasatinib (SPRYCEL®, BMS-354825), erlotinib (TARCEVA®), gefitinib (IRESSA®), imatinib
- Selected tyrosine kinase inhibitors are chosen from sunitinib, erlotinib, gefitinib, or sorafenib. In one embodiment, the tyrosine kinase inhibitor is sunitinib.
- the multispecific molecule is administered in combination with one of more of: an anti-angiogenic agent, or a vascular targeting agent or a vascular disrupting agent.
- anti-angiogenic agents include, but are not limited to, VEGF inhibitors (e.g., anti- VEGF antibodies (e.g., bevacizumab); VEGF receptor inhibitors (e.g., itraconazole); inhibitors of cell proliferatin and/or migration of endothelial cells (e.g., carboxyamidotriazole, TNP-470); inhibitors of angiogenesis stimulators (e.g., suramin), among others.
- VEGF inhibitors e.g., anti- VEGF antibodies (e.g., bevacizumab); VEGF receptor inhibitors (e.g., itraconazole); inhibitors of cell proliferatin and/or migration of endothelial cells (e.g., carboxyamidotriazole, TNP-470); inhibitors
- VTA vascular-targeting agent
- VDA vascular disrupting agent
- VTAs can be small-molecule.
- Exemplary small-molecule VTAs include, but are not limited to, microtubule destabilizing drugs (e.g., combretastatin A-4 disodium phosphate (CA4P), ZD6126, AVE8062, Oxi 4503); and vadimezan (ASA404).
- microtubule destabilizing drugs e.g., combretastatin A-4 disodium phosphate (CA4P), ZD6126, AVE8062, Oxi 4503
- ASA404 vadimezan
- methods described herein comprise use of an immune checkpoint inhibitor in combination with the multispecific molecule.
- the methods can be used in a therapeutic protocol in vivo.
- an immune checkpoint inhibitor inhibits a checkpoint molecule.
- checkpoint molecules include but are not limited to CTLA4, PD1, PD-Ll, PD-L2, TIM3, LAG3, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM
- TNFRSF14 or CD270 TNFRSF14 or CD270
- BTLA KIR
- MHC class I MHC class II
- GAL9 GAL9
- VISTA BTLA
- TIGIT TIGIT
- LAIR1 LAIR1
- A2aR A2aR
- the immune checkpoint inhibitor is a PD-1 inhibitor, e.g., an anti-PD-1 antibody such as Nivolumab, Pembrolizumab or Pidilizumab.
- Nivolumab also called MDX- 1106, MDX- 1106-04, ONO-4538, or BMS-936558
- Pembrolizumab (also called Lambrolizumab, MK-3475, MK03475, SCH-900475 or KEYTRUDA®; Merck) is a humanized IgG4 monoclonal antibody that binds to PD-1. See, e.g., Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134-44, US 8,354,509 and WO2009/114335.
- Pidilizumab (also called CT-011 or Cure Tech) is a humanized IgGlk monoclonal antibody that binds to PD1. See, e.g., WO2009/101611.
- the inhibitor of PD-1 is an antibody molecule having a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence of Nivolumab, Pembrolizumab or
- Pidilizumab Additional anti-PDl antibodies, e.g., AMP 514 (Amplimmune), are described, e.g., in US 8,609,089, US 2010028330, and/or US 20120114649.
- AMP 514 Amplimmune
- the PD-1 inhibitor is an immunoadhesin, e.g., an immunoadhesin comprising an extracellular/PD- 1 binding portion of a PD-1 ligand (e.g., PD-Ll or PD-L2) that is fused to a constant region ⁇ e.g., an Fc region of a heavy chain).
- a PD-1 ligand e.g., PD-Ll or PD-L2
- the PD-1 inhibitor is AMP-224 (B7-DCIg, e.g., described in WO2011/066342and WO2010/027827), a PD-L2 Fc fusion soluble receptor that blocks the interaction between B7-H1 and PD-1.
- the immune checkpoint inhibitor is a PD-Ll inhibitor, e.g., an antibody molecule.
- the PD-Ll inhibitor is YW243.55.S70, MPDL3280A, MEDI- 4736, MSB-0010718C, or MDX-1105.
- the anti-PD-Ll antibody is MSB0010718C (also called A09-246-2; Merck Serono), which is a monoclonal antibody that binds to PD-Ll.
- Exemplary humanized anti-PD-Ll antibodies are described, e.g., in
- the PD-Ll inhibitor is an anti-PD-Ll antibody, e.g., YW243.55.S70.
- the YW243.55.S70 antibody is described, e.g., in WO 2010/077634.
- the PD-Ll inhibitor is MDX-1105 (also called BMS-936559), which is described, e.g., in WO2007/005874.
- the PD-Ll inhibitor is MDPL3280A (Genentech / Roche), which is a human Fc-optimized IgGl monoclonal antibody against PD-Ll. See, e.g., U.S.
- the inhibitor of PD-Ll is an antibody molecule having a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence of
- the immune checkpoint inhibitor is a PD-L2 inhibitor, e.g., AMP-224 (which is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD1 and B7- Hl. See, e.g., WO2010/027827 and WO2011/066342.
- AMP-224 which is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD1 and B7- Hl. See, e.g., WO2010/027827 and WO2011/066342.
- the immune checkpoint inhibitor is a LAG-3 inhibitor, e.g., an anti LAG-3 antibody molecule.
- the anti-LAG-3 antibody is BMS-986016 (also called BMS986016; Bristol-Myers Squibb). BMS-986016 and other humanized anti-LAG-3 antibodies are described, e.g., in US 2011/0150892, WO2010/019570, and WO2014/008218.
- the immune checkpoint inhibitor is a TIM-3 inhibitor, e.g., anti-TIM3 antibody molecule, e.g., described in U.S. Patent No.: 8,552,156, WO 2011/155607, EP 2581113 and U.S Publication No.: 2014/044728.
- the immune checkpoint inhibitor is a CTLA-4 inhibitor, e.g., anti- CTLA-4 antibody molecule.
- CTLA-4 inhibitor e.g., anti- CTLA-4 antibody molecule.
- Exemplary anti-CTLA4 antibodies include Tremelimumab (IgG2 monoclonal antibody from Pfizer, formerly known as ticilimumab, CP-675,206); and Ipilimumab (also called MDX-010, CAS No. 477202-00-9).
- Tremelimumab IgG2 monoclonal antibody from Pfizer, formerly known as ticilimumab, CP-675,206
- Ipilimumab also called MDX-010, CAS No. 477202-00-9
- Other exemplary anti-CTLA-4 antibodies are described, e.g., in U.S. Pat. No. 5,811,097.
- the DNA encoding the protein sequences was optimized for expression in Cricetulus griseus, synthesized, and cloned into the pcDNA3.4-TOPO (Life Technologies A14697) using Gateway cloning. All constructs contained an Ig Kappa leader sequence
- SEQ ID NO: 8 CL AGAGCTGACGCCGCTCCTACCGTGTCTATCTTCCCTCCAT
- TCC SEQ ID NO: ahCCR2 CAGGTGCAGCTGGTTCAGTCTGGCGCCGAAGTGAAGAAA 19 42G7 VH CCTGGCGCCTCTGTGAAGGTGTCCTGCAAGGCTTCCGGCT
- SEQ ID NO: 32 SEQ ID NO: 11 SEQ ID NO 12 SEQ ID NO: 13
- SEQ ID NO: 34 SEQ ID NO: 16 SEQ ID NO 12 SEQ ID NO: 13
- SEQ ID NO: 38 SEQ ID NO: 21 SEQ ID NO 12 SEQ ID NO: 13
- SEQ ID NO: 40 SEQ ID NO: 23 SEQ ID NO 12 SEQ ID NO: 25
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762487061P | 2017-04-19 | 2017-04-19 | |
| PCT/US2018/028315 WO2018195283A1 (en) | 2017-04-19 | 2018-04-19 | Multispecific molecules and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP3612563A1 true EP3612563A1 (en) | 2020-02-26 |
Family
ID=62117016
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP18723168.3A Withdrawn EP3612563A1 (en) | 2017-04-19 | 2018-04-19 | Multispecific molecules and uses thereof |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US12134654B2 (https=) |
| EP (1) | EP3612563A1 (https=) |
| JP (1) | JP2020517256A (https=) |
| CN (1) | CN110709422B (https=) |
| AU (1) | AU2018256406A1 (https=) |
| CA (1) | CA3058944A1 (https=) |
| WO (1) | WO2018195283A1 (https=) |
Families Citing this family (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK3297438T3 (da) | 2015-05-21 | 2022-01-17 | Chemocentryx Inc | Ccr2-modulatorer |
| CN109843327B (zh) | 2016-07-07 | 2022-05-13 | 小利兰·斯坦福大学托管委员会 | 抗体佐剂缀合物 |
| CN110709422B (zh) * | 2017-04-19 | 2023-12-26 | 马伦戈治疗公司 | 多特异性分子及其用途 |
| CA3293051A1 (en) | 2017-09-25 | 2026-03-02 | Chemocentryx, Inc. | Combination therapy using a chemokine receptor 2 (ccr2) antagonist and a pd-1/pd-l1 inhibitor |
| US20190269664A1 (en) | 2018-01-08 | 2019-09-05 | Chemocentryx, Inc. | Methods of treating solid tumors with ccr2 antagonists |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| CA3097369A1 (en) | 2018-04-17 | 2019-10-24 | Celldex Therapeutics, Inc. | Anti-cd27 and anti-pd-l1 antibodies and bispecific constructs |
| CA3105448A1 (en) | 2018-07-03 | 2020-01-09 | Elstar Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| CN113164777B (zh) * | 2018-09-27 | 2024-12-13 | 马伦戈治疗公司 | Csf1r/ccr2多特异性抗体 |
| WO2020089437A1 (en) * | 2018-10-31 | 2020-05-07 | Engmab Sàrl | Combination therapy |
| CN119039441A (zh) | 2019-02-21 | 2024-11-29 | 马伦戈治疗公司 | 与nkp30结合的抗体分子及其用途 |
| GB2599228B (en) | 2019-02-21 | 2024-02-07 | Marengo Therapeutics Inc | Multifunctional molecules that bind to T cell related cancer cells and uses thereof |
| WO2020190725A1 (en) | 2019-03-15 | 2020-09-24 | Bolt Biotherapeutics, Inc. | Immunoconjugates targeting her2 |
| WO2020232427A2 (en) * | 2019-05-16 | 2020-11-19 | Arch Oncology, Inc. | Therapeutic compositions and methods for treating cancer in combination with analogs of interleukin proteins |
| KR20220034117A (ko) * | 2019-06-14 | 2022-03-17 | 더 스크립스 리서치 인스티튜트 | 면역 관문 차단 이중특이성 분자 |
| CA3160636A1 (en) * | 2019-11-12 | 2021-05-20 | Abcentra, Llc | Methods and compositions for treating cancer |
| AU2020416273A1 (en) | 2020-01-03 | 2022-07-28 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| IL302390A (en) | 2020-11-09 | 2023-06-01 | Takeda Pharmaceuticals Co | Drug antibody conjugates |
| US11572407B2 (en) | 2020-11-18 | 2023-02-07 | Pionyr Immunotherapeutics, Inc. | Anti-MARCO antibodies and uses thereof |
| WO2025059413A1 (en) * | 2023-09-13 | 2025-03-20 | The Regents Of The University Of California | Targeting aire-expressing macrophages for tumor immunotherapy |
| CN117031044B (zh) * | 2023-10-07 | 2024-01-02 | 首都医科大学附属北京天坛医院 | 一种预测卒中相关性肺炎的生物标志物和试剂盒及诊断设备 |
| WO2025215252A1 (en) * | 2024-04-12 | 2025-10-16 | Ensocell Ltd | Therapeutic agents and methods for targeting myeloid cell subtypes |
| WO2025238157A1 (en) * | 2024-05-15 | 2025-11-20 | Katholieke Universiteit Leuven | Multispecific binding agent suitable for use in cancer immune therapy |
Family Cites Families (90)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| JPS6147500A (ja) | 1984-08-15 | 1986-03-07 | Res Dev Corp Of Japan | キメラモノクロ−ナル抗体及びその製造法 |
| EP0173494A3 (en) | 1984-08-27 | 1987-11-25 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by dna splicing and expression |
| GB8422238D0 (en) | 1984-09-03 | 1984-10-10 | Neuberger M S | Chimeric proteins |
| JPS61134325A (ja) | 1984-12-04 | 1986-06-21 | Teijin Ltd | ハイブリツド抗体遺伝子の発現方法 |
| DE3689123T2 (de) | 1985-11-01 | 1994-03-03 | Xoma Corp | Modulare einheit von antikörpergenen, daraus hergestellte antikörper und verwendung. |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| JP3101690B2 (ja) | 1987-03-18 | 2000-10-23 | エス・ビィ・2・インコーポレイテッド | 変性抗体の、または変性抗体に関する改良 |
| US5731116A (en) | 1989-05-17 | 1998-03-24 | Dai Nippon Printing Co., Ltd. | Electrostatic information recording medium and electrostatic information recording and reproducing method |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| EP0436597B1 (en) | 1988-09-02 | 1997-04-02 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| GB8905669D0 (en) | 1989-03-13 | 1989-04-26 | Celltech Ltd | Modified antibodies |
| WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
| DE69120146T2 (de) | 1990-01-12 | 1996-12-12 | Cell Genesys Inc | Erzeugung xenogener antikörper |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| DK0585287T3 (da) | 1990-07-10 | 2000-04-17 | Cambridge Antibody Tech | Fremgangsmåde til fremstilling af specifikke bindingsparelementer |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| DE69133557D1 (de) | 1990-08-29 | 2007-03-15 | Pharming Intellectual Pty Bv | Homologe rekombination in säugetier-zellen |
| ATE158021T1 (de) | 1990-08-29 | 1997-09-15 | Genpharm Int | Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper |
| CA2095633C (en) | 1990-12-03 | 2003-02-04 | Lisa J. Garrard | Enrichment method for variant proteins with altered binding properties |
| EP1820858B1 (en) | 1991-03-01 | 2009-08-12 | Dyax Corporation | Chimeric protein comprising micro-protein having two or more disulfide bonds and embodiments thereof |
| ATE414768T1 (de) | 1991-04-10 | 2008-12-15 | Scripps Research Inst | Bibliotheken heterodimerer rezeptoren mittels phagemiden |
| EP0519596B1 (en) | 1991-05-17 | 2005-02-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| DE4122599C2 (de) | 1991-07-08 | 1993-11-11 | Deutsches Krebsforsch | Phagemid zum Screenen von Antikörpern |
| DK1621554T4 (da) | 1992-08-21 | 2012-12-17 | Univ Bruxelles | Immunoglobuliner blottet for lette kæder |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| SE9600820D0 (sv) | 1996-03-01 | 1996-03-01 | Pharmacia Ab | Antibodies and their use |
| EP1958962A3 (en) | 1997-06-12 | 2013-05-01 | Novartis International Pharmaceutical Ltd. | Artificial antibody polypeptides |
| AUPP221098A0 (en) | 1998-03-06 | 1998-04-02 | Diatech Pty Ltd | V-like domain binding molecules |
| US6312689B1 (en) * | 1998-07-23 | 2001-11-06 | Millennium Pharmaceuticals, Inc. | Anti-CCR2 antibodies and methods of use therefor |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| DK1137941T4 (da) | 1998-12-10 | 2014-01-06 | Brystol Myers Squibb Company | Protein-scaffolds til antistof-mimetika og andre bindingsproteiner |
| WO2000060070A1 (en) | 1999-04-01 | 2000-10-12 | Innogenetics N.V. | A polypeptide structure for use as a scaffold |
| JP4398620B2 (ja) | 2000-02-03 | 2010-01-13 | ミレニアム・ファーマシューティカルズ・インコーポレイテッド | ヒト化抗ccr−2抗体およびその使用方法 |
| WO2001078653A2 (en) | 2000-04-14 | 2001-10-25 | Millennium Pharmaceuticals, Inc. | Graft rejection inhibition with ccr2 inhibitors |
| US20040009530A1 (en) | 2002-01-16 | 2004-01-15 | Wilson David S. | Engineered binding proteins |
| CN101899114A (zh) | 2002-12-23 | 2010-12-01 | 惠氏公司 | 抗pd-1抗体及其用途 |
| US7264806B2 (en) | 2003-11-01 | 2007-09-04 | Biovation Ltd. | Modified anti-CD52 antibody |
| US7501121B2 (en) | 2004-06-17 | 2009-03-10 | Wyeth | IL-13 binding agents |
| CA2575402A1 (en) | 2004-08-05 | 2006-02-09 | Genentech, Inc. | Humanized anti-cmet antagonists |
| DK2439273T3 (da) | 2005-05-09 | 2019-06-03 | Ono Pharmaceutical Co | Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika |
| PT1907424E (pt) | 2005-07-01 | 2015-10-09 | Squibb & Sons Llc | Anticorpos monoclonais humanos para o ligando 1 de morte programada (pd-l1) |
| DE102006015341A1 (de) | 2006-04-03 | 2007-10-04 | Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts | Behandlung von multipler Sklerose und/oder rheumatoider Arthritis |
| BR122017025062B8 (pt) | 2007-06-18 | 2021-07-27 | Merck Sharp & Dohme | anticorpo monoclonal ou fragmento de anticorpo para o receptor de morte programada humano pd-1, polinucleotídeo e composição compreendendo o referido anticorpo ou fragmento |
| PL2188313T3 (pl) | 2007-08-21 | 2018-04-30 | Amgen, Inc. | Białka wiążące ludzki antygen c-fms |
| CN101970499B (zh) | 2008-02-11 | 2014-12-31 | 治疗科技公司 | 用于肿瘤治疗的单克隆抗体 |
| EP2262837A4 (en) | 2008-03-12 | 2011-04-06 | Merck Sharp & Dohme | PD-1 BINDING PROTEINS |
| AR072999A1 (es) | 2008-08-11 | 2010-10-06 | Medarex Inc | Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos |
| RU2547595C2 (ru) | 2008-08-18 | 2015-04-10 | Пфайзер Инк | Антитела против ccr2 |
| JP2012500855A (ja) | 2008-08-25 | 2012-01-12 | アンプリミューン、インコーポレーテッド | Pd−1アンタゴニストおよび感染性疾患を処置するための方法 |
| AU2009288730B2 (en) | 2008-08-25 | 2013-06-20 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| EP3255060A1 (en) | 2008-12-09 | 2017-12-13 | F. Hoffmann-La Roche AG | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| JP5844159B2 (ja) | 2009-02-09 | 2016-01-13 | ユニヴェルシテ デクス−マルセイユUniversite D’Aix−Marseille | Pd−1抗体およびpd−l1抗体ならびにその使用 |
| IT1395574B1 (it) | 2009-09-14 | 2012-10-16 | Guala Dispensing Spa | Dispositivo di erogazione |
| GB0917044D0 (en) | 2009-09-29 | 2009-11-18 | Cytoguide As | Agents, uses and methods |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| ES2722300T3 (es) | 2009-12-10 | 2019-08-09 | Hoffmann La Roche | Anticuerpos que se unen preferentemente al dominio extracelular 4 de CSF1R y su uso |
| TWI622402B (zh) * | 2010-02-24 | 2018-05-01 | 免疫遺傳股份有限公司 | 葉酸受體1抗體類和免疫共軛物類及彼等之用途 |
| US9169323B2 (en) | 2010-03-05 | 2015-10-27 | Hoffmann-La Roche Inc. | Antibodies against human CSF-1R |
| CA3253628A1 (en) | 2010-03-05 | 2025-11-29 | The Johns Hopkins University | Compositions and methods for targeted immunomodulatory antibodies and fusion proteins |
| JP5989547B2 (ja) | 2010-03-05 | 2016-09-07 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | ヒトcsf−1rに対する抗体及びその使用 |
| AR080698A1 (es) | 2010-04-01 | 2012-05-02 | Imclone Llc | Anticuerpo o fragmento del mismo que especificamente enlaza la variante de csf -1r humano, composicion farmaceutica que lo comprende, su uso para la manufactura de un medicamento util para el tratamiento de cancer y metodo para determinar si un sujeto es candidato para tratamiento de cancer basado e |
| HRP20190047T1 (hr) | 2010-05-04 | 2019-02-22 | Five Prime Therapeutics, Inc. | Protutijela koja se vežu na csf1r |
| AU2011262758B8 (en) | 2010-06-11 | 2014-09-04 | Kyowa Kirin Co., Ltd. | Anti-tim-3 antibody |
| KR101764096B1 (ko) | 2011-11-28 | 2017-08-02 | 메르크 파텐트 게엠베하 | 항-pd-l1 항체 및 그의 용도 |
| RU2658603C2 (ru) | 2011-12-15 | 2018-06-21 | Ф.Хоффманн-Ля Рош Аг | Антитела против человеческого csf-1r и их применения |
| RU2670743C9 (ru) | 2012-05-11 | 2018-12-19 | Файв Прайм Терапьютикс, Инк. | Способы лечения состояний антителами, которые связывают рецептор колониестимулирующего фактора 1 (csf1r) |
| WO2013192596A2 (en) | 2012-06-22 | 2013-12-27 | Sorrento Therapeutics Inc. | Antigen binding proteins that bind ccr2 |
| UY34887A (es) | 2012-07-02 | 2013-12-31 | Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware | Optimización de anticuerpos que se fijan al gen de activación de linfocitos 3 (lag-3) y sus usos |
| CN107759690A (zh) | 2012-08-31 | 2018-03-06 | 戊瑞治疗有限公司 | 用结合群落刺激因子1受体(csf1r)的抗体治疗病状的方法 |
| US9522196B2 (en) | 2012-12-25 | 2016-12-20 | Kagoshima University | Antibody recognizing folate receptors α and β |
| US10858417B2 (en) * | 2013-03-15 | 2020-12-08 | Xencor, Inc. | Heterodimeric proteins |
| EP2986642A1 (en) | 2013-04-17 | 2016-02-24 | MorphoSys AG | Antibodies targeting specifically human cxcr2 |
| AR095882A1 (es) | 2013-04-22 | 2015-11-18 | Hoffmann La Roche | Terapia de combinación de anticuerpos contra csf-1r humano con un agonista de tlr9 |
| AR097584A1 (es) | 2013-09-12 | 2016-03-23 | Hoffmann La Roche | Terapia de combinación de anticuerpos contra el csf-1r humano y anticuerpos contra el pd-l1 humano |
| BR112016014952A2 (pt) | 2014-02-10 | 2017-09-19 | Merck Patent Gmbh | Inibição direcionada de tgfbeta |
| SG11201610672YA (en) | 2014-06-23 | 2017-01-27 | Five Prime Therapeutics Inc | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| EP3212670B1 (en) | 2014-10-29 | 2020-12-23 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| MX2017008218A (es) | 2014-12-22 | 2017-10-18 | Five Prime Therapeutics Inc | Anticuerpos anti-csf1r para tratar pvns. |
| AU2016249981B2 (en) * | 2015-04-13 | 2022-02-17 | Five Prime Therapeutics, Inc. | Combination therapy for cancer |
| EP3302558A4 (en) | 2015-06-01 | 2019-01-16 | The Rockefeller University | ANTI-TUMOR MEDIUM AND METHOD OF USE |
| EP3108897A1 (en) | 2015-06-24 | 2016-12-28 | F. Hoffmann-La Roche AG | Antibodies against human csf-1r for use in inducing lymphocytosis in lymphomas or leukemias |
| KR20180012873A (ko) | 2015-06-24 | 2018-02-06 | 에프. 호프만-라 로슈 아게 | 림프종 또는 백혈병에서 림프구증가증의 유도에 사용하기 위한 인간 csf-1r에 대한 항체 |
| WO2017091429A1 (en) | 2015-11-24 | 2017-06-01 | Eli Lilly And Company | Combination therapy for cancer |
| WO2017165464A1 (en) | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
| CN110709422B (zh) | 2017-04-19 | 2023-12-26 | 马伦戈治疗公司 | 多特异性分子及其用途 |
| EP3720881A1 (en) | 2017-12-08 | 2020-10-14 | Elstar Therapeutics, Inc. | Multispecific molecules and uses thereof |
| CN113164777B (zh) * | 2018-09-27 | 2024-12-13 | 马伦戈治疗公司 | Csf1r/ccr2多特异性抗体 |
-
2018
- 2018-04-19 CN CN201880037326.8A patent/CN110709422B/zh active Active
- 2018-04-19 JP JP2019556886A patent/JP2020517256A/ja active Pending
- 2018-04-19 CA CA3058944A patent/CA3058944A1/en active Pending
- 2018-04-19 AU AU2018256406A patent/AU2018256406A1/en not_active Abandoned
- 2018-04-19 EP EP18723168.3A patent/EP3612563A1/en not_active Withdrawn
- 2018-04-19 WO PCT/US2018/028315 patent/WO2018195283A1/en not_active Ceased
- 2018-04-19 US US16/605,936 patent/US12134654B2/en active Active
Non-Patent Citations (4)
| Title |
|---|
| MOUTIH RAFEI ET AL: "A MCP1 fusokine with CCR2-specific tumoricidal activity", MOLECULAR CANCER, BIOMED CENTRAL, LONDON, GB, vol. 10, no. 1, 24 September 2011 (2011-09-24), pages 121, XP021110637, ISSN: 1476-4598, DOI: 10.1186/1476-4598-10-121 * |
| NGAMBENJAWONG CHAYANON ET AL: "Progress in tumor-associated macrophage (TAM)-targeted therapeutics", ADVANCED DRUG DELIVERY REVIEWS, ELSEVIER, AMSTERDAM , NL, vol. 114, 25 April 2017 (2017-04-25), pages 206 - 221, XP085157395, ISSN: 0169-409X, DOI: 10.1016/J.ADDR.2017.04.010 * |
| See also references of WO2018195283A1 * |
| Y. ZHU ET AL: "CSF1/CSF1R Blockade Reprograms Tumor-Infiltrating Macrophages and Improves Response to T-cell Checkpoint Immunotherapy in Pancreatic Cancer Models", CANCER RESEARCH, vol. 74, no. 18, 31 July 2014 (2014-07-31), US, pages 5057 - 5069, XP055242334, ISSN: 0008-5472, DOI: 10.1158/0008-5472.CAN-13-3723 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US12134654B2 (en) | 2024-11-05 |
| WO2018195283A1 (en) | 2018-10-25 |
| US20200071417A1 (en) | 2020-03-05 |
| CN110709422A (zh) | 2020-01-17 |
| JP2020517256A (ja) | 2020-06-18 |
| CN110709422B (zh) | 2023-12-26 |
| CA3058944A1 (en) | 2018-10-25 |
| AU2018256406A1 (en) | 2019-10-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12134654B2 (en) | Multispecific molecules and uses thereof | |
| US12421323B2 (en) | Multispecific antibody molecules comprising lambda and kappa light chains | |
| JP7348899B2 (ja) | 多重特異性分子及びその使用 | |
| US20250333500A1 (en) | Multifunctional molecules that bind to t cell related cancer cells and uses thereof | |
| EP3615566B1 (en) | Multispecific molecules comprising a non-immunoglobulin heterodimerization domain and uses thereof | |
| JP2023100868A (ja) | 骨髄増殖性白血病(mpl)タンパク質に結合する多特異性分子およびその使用 | |
| JP7465272B2 (ja) | Csf1r/ccr2多特異性抗体 | |
| WO2019035938A1 (en) | MULTISPECIFIC MOLECULES BINDING TO BCMA AND USES THEREOF | |
| US20230333112A1 (en) | Methods of detecting trbc1 or trbc2 | |
| WO2022132929A2 (en) | Multispecific antibody molecules and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20191118 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| RAP3 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: MARENGO THERAPEUTICS, INC. |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| 17Q | First examination report despatched |
Effective date: 20230227 |
|
| P01 | Opt-out of the competence of the unified patent court (upc) registered |
Effective date: 20230621 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20251101 |