EP3555133A1 - Combinaison d'anticorps anti-cd303 et anti-her2 - Google Patents

Combinaison d'anticorps anti-cd303 et anti-her2

Info

Publication number
EP3555133A1
EP3555133A1 EP17826467.7A EP17826467A EP3555133A1 EP 3555133 A1 EP3555133 A1 EP 3555133A1 EP 17826467 A EP17826467 A EP 17826467A EP 3555133 A1 EP3555133 A1 EP 3555133A1
Authority
EP
European Patent Office
Prior art keywords
seq
imgt
antibody
her2
cdr2
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP17826467.7A
Other languages
German (de)
English (en)
Inventor
Abdessatar Sami Chtourou
Nathalie Fournier
Christophe De Romeuf
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
LFB SA
Original Assignee
LFB SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by LFB SA filed Critical LFB SA
Publication of EP3555133A1 publication Critical patent/EP3555133A1/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2851—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507—Comprising a combination of two or more separate antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/12—Immunoglobulins specific features characterized by their source of isolation or production isolated from milk
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41—Glycosylation, sialylation, or fucosylation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]

Definitions

  • the subject of the present invention is a novel combination of antibodies, in particular for the prevention or treatment of a HER2-positive cancer.
  • breast cancer is the leading cause of death for women between the ages of 35 and 65.
  • the most common breast cancers (95%) are adenocarcinomas, which develop from the epithelial cells of the mammary gland. We distinguish in situ cancers and invasive cancers.
  • the stage of breast cancer is an important prognostic factor. A lower stage generates less risk of recurrence of cancer (recurrence) and a more favorable prognosis. A higher stage gives rise to a higher risk of recurrence and a less favorable prognosis.
  • the most commonly used system for determining the stage of breast cancer is the TNM classification (Tumor, Nodes, and Metastases). The TNM classification takes into account:
  • lymph node involvement The most important stage-related factors are lymph node involvement and tumor size.
  • the size of the breast tumor increases the risk of recurrence:
  • a breast tumor that is less than 1 cm in size and has not spread to the lymph nodes provides the best prognosis.
  • Lymph node involvement is also an important prognostic factor for breast cancer, and independent of the size of the tumor. It is evaluated by the presence or absence of cancer in said ganglia, as well as by the number of nodes reached. If the lymph nodes are positive, it gives rise to a higher risk of recurrence and a less favorable prognosis than a breast cancer that has not spread to the lymph nodes (negative lymph nodes). In addition, breast cancer can also spread to the internal mammary lymph nodes without having reached the axillary lymph nodes. In this case, the risk of recurrence is high even if the axillary lymph nodes are negative. Finally, the higher the number of positive lymph nodes, the higher the risk of recurrence.
  • the International Union against Cancer uses the TNM system to describe the extent of breast cancer, and defines the following stages: Stage 0, Stage I, Stage II A and Stage B, Stage 111A to Stage C and stage IV .
  • the present invention thus relates to a pharmaceutical composition
  • a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle:
  • the present invention also relates to products containing:
  • the invention further relates to
  • At least one anti-HER2 antibody for use in the prevention or treatment of HER2-positive cancer in combination with at least one anti-CD303 antibody;
  • At least one anti-CD303 antibody for its use for the prevention or treatment of a HER2-positive cancer in combination with at least one anti-HER2 antibody.
  • the invention also relates to a method for treating a HER2-positive cancer, which comprises administering to a patient at least one anti-HER2 antibody and at least one anti-CD303 antibody.
  • the term "antibody” refers both to an immunoglobulin, fragments and derivatives of this immunoglobulin.
  • Immunoglobulins are well known to those skilled in the art and consist of an assembly of two dimers each consisting of a heavy chain and a light chain. The multimeric complex is assembled by the binding of a light chain and a heavy chain by a disulfide bridge between two cysteines, the two heavy chains being themselves also linked together by two disulfide bridges.
  • Each of the heavy chains and light chains consists of a constant region and a variable region. More precisely, each light chain consists of a variable region (V L ) and a constant region (C L ). Each heavy chain consists of a variable region (V H > and a constant region consisting of three constant domains Cm, C H 2 and C H 3. The domains C H 2 and C H 3 make up the domain Fc. Variable regions of the light chain and of the heavy chain consist of three domains determining the recognition of the antigen (CDR regions, ie Complementary Determining Regions) surrounded by four framework domains (FR or Framework regions).
  • CDR regions ie Complementary Determining Regions
  • Anti-CD303 antibodies a) and anti-HER2 b) can be monoclonal or polyclonal. Preferably, they are monoclonal antibodies.
  • the antibodies can be of several isotypes, depending on the nature of their constant region: the constant regions ⁇ , ⁇ , ⁇ , ⁇ and ⁇ correspond respectively to immunoglobulins IgG, IgA, IgM, IgE and IgD.
  • the anti-CD303 a) and anti-HER2 b) antibodies are of IgG isotype. Indeed, this isotype shows an ability to generate ADCC activity ("Antibody-Dependent Cellular Cytotoxicity", ie
  • the constant regions ⁇ comprise several subtypes: ⁇ 1, ⁇ 2, ⁇ 3, these three types of constant regions having the particularity of fixing the human complement, and ⁇ 4, thus creating the lgG1, IgG2, IgG3, and IgG4 sub-isotypes.
  • the anti-CD303 antibodies a) and anti-HER2 b) are IgG1 or IgG2 isotype, preferably IgG1.
  • the anti-CD303 a) and anti-HER2 b) antibodies are chosen from murine antibodies, chimeric antibodies, humanized antibodies and human antibodies.
  • the anti-CD303 antibody a) and / or the anti-HER2 b antibody is a chimeric antibody, and more preferably a chimeric antibody selected from a murine / human chimeric antibody or a human / macaque chimeric antibody.
  • the anti-CD303 antibody a) and / or the anti-HER2 antibody b) is a humanized antibody, in particular a chimeric antibody whose human and heavy chain constant region is of human origin.
  • chimeric antibody refers to an isolated antibody, in which the sequence of each light chain and / or heavy chain that constitutes it comprises or consists of a hybrid sequence derived from at least two distinct animals.
  • a chimeric antibody contains a wild-type light chain variable region and wild-type heavy chain variable region fused to the human light chain and heavy chain constant regions, respectively.
  • a chimeric antibody can be prepared using genetic recombination techniques well known to those skilled in the art.
  • humanized antibody refers to an antibody derived from an animal other than humans in which heavy chain and light chain sequences other than CDRs have been replaced by corresponding sequences of one or more antibodies. human origin. The antibody is therefore mainly composed of human sequences, but its specificity for the antigen conferred by the CDRs comes from another species. In addition, some of the residues of the skeleton segments (named FR) can be modified to maintain binding affinity (Jones et al., 1986, Verhoeyen et al., 1988, Riechmann et al., 1988).
  • humanized antibodies according to the invention may be prepared by techniques known to those skilled in the art such as “CDR grafting”, “resurfacing”, Superhumanization, "Human string content”, “FR libraries” technologies. “Guided selection”, “FR shuffling” and “Humaneering”, as summarized in the review of Almagro et al-2008.
  • the anti-CD303 antibody and / or the anti-HER2 antibody according to the invention may also be present in the form of an anti-CD303 antibody fragment and / or a fragment of anti-HER2 antibodies, respectively.
  • fragment refers in particular to Fab, F (ab) '2 or
  • Fab refers to an antibody fragment of molecular weight of about 50,000 Da and having antigen binding activity.
  • the Fab fragment consists of the entire light chain (VL + CL) and part of the heavy chain (VH + CH1). It can be obtained in particular by treating IgG with a protease, papain.
  • F (ab ') 2 refers to a fragment of about 100,000 Da and having antigen binding activity. It corresponds to the association by a disulfide bridge (hinge region) of two Fab fragments described above. It can be obtained by treating IgG with a protease, pepsin.
  • the term "Fd" corresponds to the portion of the heavy chain that is included in the Fab fragment.
  • the fragment Fd is thus formed of the VH and CH1 domains.
  • the anti-CD303 antibody and / or the anti-HER2 antibody according to the invention may also be present in the form of an anti-CD303 antibody derivative a) and / or a anti-HER2 antibody derivative b), respectively.
  • derivative refers in particular to scFv derivatives, and to scFv multimers, such as diabody, triabody or tetrabody.
  • ScFv single chain Fv
  • VH VL polypeptide synthesized using the genes encoding the VL and VH domains and a linker sequence.
  • ScFv includes CDRs maintained in an appropriate conformation, for example using genetic recombination techniques.
  • ScFv can also serve as basic modules for the development of multimeric structures (dimeric: “diabody”, trimeric: “triabody”, tetrameric: “tetrabody”).
  • diabody refers to a scFv dimer. This fragment dimer has the property of maintaining the double valence that the parent antibody possesses. Diabody is bivalent, mono or bispecific depending on whether it fixes two identical or different antigens.
  • triabody refers to the trivalent association of scFv. A triabody can thus fix three identical or different antigens.
  • tetrabody refers to the tetravalent association of scFv.
  • a tetrabody can fix four identical or different antigens.
  • HER2-positive cancer refers to a cancer comprising cells that present the HER2 protein on their surface. In particular, said cancer cells overexpress the HER2 protein.
  • HER2-positive cancer is, for example, cancer of the uterus, ovarian cancer, breast cancer or stomach cancer. Preferably, HER2-positive cancer is breast cancer.
  • breast cancer refers to cancer of the mammary glands, whether it is noninvasive (intracanal ductal carcinoma intracanal (CCIS)) or invasive.
  • CCIS intracanal ductal carcinoma intracanal
  • the present invention also relates to a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle, at least one anti-CD303 antibody, and at least one anti-HER2 antibody fragment or derivative.
  • the present invention also relates to products containing at least one anti-CD303 antibody, and at least one anti-HER2 antibody fragment or derivative, as combination products for simultaneous, separate or time-course use, for its use in the prevention or treatment of HER2-positive cancer.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle, at least one anti-CD303 antibody fragment, and at least one anti-HER2 antibody or one of its fragments or one of its derivatives.
  • the present invention also relates to products containing at least one anti-CD303 antibody fragment, and at least one anti-HER2 antibody or a fragment thereof or a derivative thereof, as combination products for a simultaneous use, separate or spread over time, for its use in the prevention or treatment of HER2-positive cancer.
  • the present invention also relates to a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle, at least one anti-CD303 antibody derivative, and at least one anti-HER2 antibody or one of its fragments or one of its derivatives.
  • the present invention also relates to products containing at least one anti-CD303 antibody derivative, and at least one anti-HER2 antibody or a fragment thereof or a derivative thereof, as combination products for one or more simultaneous use, separate or spread over time, for its use in the prevention or treatment of HER2-positive cancer.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle, at least one anti-HER2 antibody, and at least one anti-CD303 antibody fragment or derivative.
  • the present invention also relates to products containing at least one anti-HER2 antibody, and at least one anti-CD303 antibody fragment or derivative, as combination products for simultaneous, separate or time-course use, for its use in the prevention or treatment of HER2-positive cancer.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle, at least one anti-HER2 antibody fragment, and at least one anti-CD303 antibody or one of its fragments or one of its derivatives.
  • the present invention also relates to products containing at least one fragment of anti-HER2 antibody, and at least one anti-CD303 antibody or a fragment thereof or a derivative thereof, as combination products for a simultaneous use, separate or spread over time, for its use in the prevention or treatment of HER2-positive cancer.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle, at least one anti-HER2 antibody derivative, and at least one anti-CD303 antibody or one of its fragments or one of its derivatives.
  • the present invention also relates to products containing at least one anti-HER2 antibody derivative, and at least one anti-CD303 antibody or a fragment thereof or a derivative thereof, as combination products for a simultaneous use, separate or spread over time, for its use in the prevention or treatment of HER2-positive cancer.
  • the present invention thus relates to a pharmaceutical composition comprising, in a pharmaceutically acceptable vehicle:
  • pharmaceutically acceptable carrier is meant a non-toxic medium compatible with a biological system such as a cell, a cell culture, a tissue or an organism.
  • the invention also relates to products each containing one of the two aforementioned active agents a) and b), said active ingredients being combined for simultaneous, separate or time-based use, and in the prevention or treatment of cancer.
  • the anti-CD303 antibody is an antibody directed against the CD303 protein.
  • This protein also originally named BDCA-2, is specifically expressed on the surface of plasmacytoid dendritic cells, and is a type II protein belonging to type C lectins.
  • the human CD303 antigen is the C member of the 4 th type C lectin family (CLEC4 or "C-type lectin domain family 4, member C"). It is a 213 amino acid type II transmembrane glycoprotein (accessible in Uniprot: Q8WTT0), comprising a short cytoplasmic domain without obvious signaling motif (amino acids 1-21), a transmembrane region (amino acids 22- 44), and an extracellular domain (amino acids 45-213).
  • Plasmacytoid dendritic cells correspond to a subpopulation of dendritic cells, also called DC2.
  • Plasmacytoid dendritic cells are characterized by the Lin- (CD3-, CD19-, CD20-, CD14-, CD56-), HLA-DR +, CD1-1C-, CD123 + and CD45RA + markers. These cells have also been phenotypically characterized: they express the markers CD4, CD303 and BDCA-4. They are present in the lymphoid organs and are also circulating in the blood. They have the ability to secrete type I IFN in the presence of a viral infection.
  • tumor cells can promote the growth of tumor cells and their survival, in particular inducing an immunosuppressive environment in the tumor environment, for example by inducing the differentiation of regulatory T cells (Treg). So, these cells exhibit immunosuppressive and / or tumor tolerant properties.
  • immunosuppressive properties refers to the properties of dendritic cells to develop and maintain immunosuppression in the tumor environment.
  • tolerogenic properties means that plasmacytoid dendritic cells will not induce an immune response.
  • anti-CD303 antibodies according to the invention by virtue of their cytotoxic action, advantageously makes it possible to eliminate tumor-infiltrating plasmacytoid dendritic cells.
  • the immunosuppressive and / or tolerogenic properties with respect to the tumor are thus diminished, advantageously suppressed, which improves the antitumor immunity in situ.
  • the anti-CD303 antibody according to the invention is a monoclonal antibody directed against the ectodomain of the human CD303 antigen (SEQ ID NO: 69).
  • the anti-CD303 antibody according to the invention comprises heavy chains comprising three CDR-H (heavy chain CDR according to the IMGT nomenclature) having the following amino acid sequences, or sequences having at least 80% of identity with the following sequences, and light chains comprising three CDR-Ls (light chain CDRs according to the IMGT nomenclature) having the following amino acid sequences, or sequences having at least 80% identity with the following sequences:
  • CDR1 -H-family 1 SEQ ID NO: 1
  • CDR2-H-family 1 SEQ ID NO: 2
  • CDR3-H-family 1 SEQ ID NO: 3
  • CDR1 -L-family 1 SEQ ID NO: 4
  • CDR2-L-family 1 SEQ ID NO: 5
  • CDR3-L-family 1 SEQ ID NO: 6; or
  • CDR1 -H-family 2 SEQ ID NO: 7
  • CDR2-H-family 2 SEQ ID NO: 8
  • CDR3-H-family 2 SEQ ID NO: 9
  • CDR1-L-family 2 SEQ ID NO: 10
  • CDR2-L-family 2 SEQ ID NO: 1
  • CDR3-L-family 2 SEQ ID NO : 12.
  • the expression "at least 80% identity” means an identity of 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100%.
  • the percentages of identity to which reference is made in the context of the present invention are determined on the basis of an overall alignment of the sequences to be compared, that is to say on an alignment of the sequences taken in their entirety over any the length using any algorithm well known to those skilled in the art such as the Needleman and Wunsch-1970 algorithm.
  • the CDR or variable region of an antibody has an amino acid sequence of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97% , at least 98%, or at least 99% identity with a reference sequence, it may have insertions, deletions or substitutions relative to the reference sequence.
  • substitutions the substitution is preferably carried out by an "equivalent" amino acid, that is to say any amino acid whose structure is close to that of the original amino acid and is therefore unlikely to alter the biological activities of the antibody, or an amino acid whose structure differs but whose intrinsic properties are known to be equivalent to those of the original amino acid and not altering by the biological activities of the 'antibody.
  • Table 1 summarizes the amino acid sequences of the CDR-IMGTs of the two families of anti-CD303 antibodies that can be used according to the invention:
  • the anti-CD303 antibody according to the invention comprises three CDR-H (heavy chain CDR according to the IMGT nomenclature) having the following amino acid sequences, or sequences having at least 80% identity with the sequences. following, and three CDR-Ls (light chain CDR according to the IMGT nomenclature) with following amino acid sequences, or sequences having at least 80% identity with the following sequences:
  • CDR1 -H-122A2 SEQ ID NO: 13, CDR2-H-122A2: SEQ ID NO: 14, CDR3-H-122A2: SEQ ID NO: 15, CDR1 -L-122A2: SEQ ID NO: 16, CDR2-L-122A2: SEQ ID NO: 17, CDR3-L-122A2: SEQ ID NO: 18; ii) CDR1 -H-102E9: SEQ ID NO: 19, CDR2-H-102E9: SEQ ID NO: 20, CDR3-H-102E9: SEQ ID NO: 21, CDR1 -L-102E9: SEQ ID NO: 22, CDR2-L-102E9: SEQ ID NO: 23, CDR3-L-102E9: SEQ ID NO: 24; iii) CDR1 -H-104Cl2: SEQ ID NO: 25, CDR2-H-104Cl2: SEQ ID NO: 26, CDR3-H-104Cl2: SEQ ID NO: SEQ
  • CDR2-L-104C12 SEQ ID NO: 29, CDR3-L-104C12: SEQ ID NO: 30; iv) CDR1-H-1 14D1 1: SEQ ID NO: 31, CDR2-H-1 14D1 1: SEQ ID NO: 32, CDR3-H-1 14D1 1: SEQ ID NO: 33, CDR1 -L-1 14D1 1: SEQ ID NO: 34, CDR2-L-1 14D1 1: SEQ ID NO: 35, CDR3-L-1 14D1 1: SEQ ID NO: 36; or v) CDR1 -H-104E10: SEQ ID NO: 37, CDR2-H-104E10: SEQ ID NO: 38,
  • CDR3-H-104E10 SEQ ID NO: 39
  • CDR1 -L-104E10 SEQ ID NO: 40
  • CDR2-L-104E10 SEQ ID NO: 41
  • CDR3-L-104E10 SEQ ID NO: 42.
  • the anti-CD303 antibody according to the invention has heavy and light chains whose variable regions have the following amino acid sequences or sequences having at least 80% identity with the following sequences:
  • 122A2 antibody heavy chain: SEQ ID NO: 43, light chain: SEQ ID NO: 48,
  • 102E9 antibody heavy chain: SEQ ID NO: 44, light chain: SEQ ID NO: 49,
  • Antibody 104C12 heavy chain: SEQ ID NO: 45, light chain: SEQ ID NO: 50,
  • Antibody 1 14D1 1 heavy chain: SEQ ID NO: 46, light chain: SEQ ID NO: 51, or
  • Antibody 104E10 heavy chain: SEQ ID NO: 47, light chain:
  • VL-122A2 DGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLDQ
  • VL-1 14D1 1 TSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAE
  • VL-104E10 GTSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEA
  • the anti-CD303 antibody according to the invention has a human constant region, preferably a human constant region of IgG1 isotype.
  • GLSSPVTKSFNRGEC SEQ ID NO: 54
  • Table 3 Preferred human heavy and light chain constant region sequences SEQ ID NO: 53 and SEQ ID NO: 54.
  • the anti-CD303 antibody according to the invention advantageously comprises the heavy and light chains described in Table 4 below.
  • the anti-HER2 antibody is an antibody directed against the growth factor receptor for the human epidermis (Human Epidermal Growth Factor Receptor 2).
  • HER-2 also known as HER2 / neu or ErbB2
  • HER2 is a member of the epidermal growth factor receptor family.
  • HER2 is a plasma membrane-bound tyrosine kinase receptor that can dimerize with itself and with other members of the epidermal growth factor receptor family (HER1, HER2, HER3 and HER4). Dimerization, in turn, leads to the activation of various intracellular biological pathways.
  • HER2 is an oncogene that is overexpressed in a variety of cancers, including breast, ovarian, stomach and uterine cancers. Overexpression of HER2 in cancer (HER2-positive cancer or "HER2 + cancer”) is associated with a poor prognosis.
  • HER2 is the target of trastuzumab (Herceptin®), a monoclonal antibody that binds to the IV domain of the extracellular segment of the HER2 / neu receptor.
  • trastuzumab was approved by the FDA in 1998 and has been used for the treatment of HER2 + breast cancer and HER2 + gastric cancer.
  • the anti-HER2 antibody according to the invention can therefore be trastuzumab.
  • trastuzumab in its classical version is not therapeutically effective in a large number of patients with HER2 + cancers.
  • the anti-HER2 antibody according to the invention is trastuzumab highly galactosylated, optionally highly fucosylated.
  • Trastuzumab has the following heavy chain sequence SEQ ID NO: 65:
  • the anti-HER2 antibody is present in the form of an anti-HER2 monoclonal antibody composition, preferably in the form of a trastuzumab composition, said composition comprising glycan structures at the Fc glycosylation sites (Asn). 297 according to the US numbering) having a galactose content of more than 60%.
  • the EU numbering is generally used to designate a residue in an immunoglobulin heavy chain constant region (see US numbering reported in Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
  • the typical position of the glycosylated residue in an antibody is asparagine at position 297 ("Asn297") according to the EU numbering. It should be noted that one of the anti-HER2 monoclonal antibodies described herein may be partially or fully purified.
  • Anti-HER2 antibodies can be glycosylated with N-glycan at the Asn297 site of the heavy chain of the Fc region. Since the antibodies generally comprise two heavy chains, they have up to two N-glycans on the Fc region. A variety of oligosaccharide profiles have been observed at this level and generally, oligosaccharides found at this site include galactose, N-acetylglucosamine (GIcNAc), mannose, sialic acid, N-acetylneuraminic acid (NeuAc or NANA). ), N-glycolylneuraminic acid (NGNA) and fucose.
  • GIcNAc N-acetylglucosamine
  • NGNA N-glycolylneuraminic acid
  • fucose fucose
  • the N-glycans found on Asn297 generally have a common base structure consisting of an unbranched chain of a first N-acetylglucosamine (GIcNAc), which is attached to the asparagine of the antibody, a second GIcNAc that is attached to the first GIcNAc and a first mannose that is attached to the second GIcNAc.
  • GIcNAc N-acetylglucosamine
  • Two additional mannoses are attached to the first mannose of the GIcNAc-GIcNAc-mannose chain, to complete the core structure (or pentasaccharide core) and provide two "arms" for additional glycosylation.
  • the fucose residues can be attached to the first Asn297-linked GIcNAc.
  • the basic structure of both arms is also referred to as the "antenna".
  • the most common type of N-glucan units of the antibodies present in the plasma is of the complex type, ie composed of more than one type of monosaccharide.
  • several GIcNAc transferases bind the GIcNAc residues to the mannoses of the glycan nucleus, which can be extended by galactose, sialic acid and fucose residues. This glycosylation pattern is called the "complex" structure.
  • a second glycosylation pattern found on the "arms" of the N-glycan base structure is a "high mannose” motif, which is characterized by additional mannoses (either branched or unbranched).
  • a third glycosylation pattern is a hybrid structure in which one of the arms is replaced by the mannose while the other arm is complex.
  • a "galactosylated" anti-HER2 antibody refers to any anti-HER2 antibody that has at least one galactose monosaccharide in one of its N-glycans.
  • the galactosylated antibodies comprise antibodies wherein both N-glycans each have complex-like units on each of the N-glycan moieties, antibodies where both N-glycans have a single-arm complex motif pattern of N-glycans.
  • glycans antibodies that have a single N-glycan with complex-type units on each of the N-glycan arms, and antibodies that have a single N-glycan having a complex-type motif on only one of the N-glycan arms.
  • N-glycan patterns Galactosylated antibodies, which include at least one galactose monosaccharide, include the forms G1 (galactose), G1 F (galactose, fucose), G2 (two galactoses), and G2F (two galactoses, one fucose).
  • N-glycan which comprises at least one galactose monosaccharide may be sialylated or unsilylated.
  • N-glycans may also contain additional galactose residues, such as alpha-Gal, in one or more arms of the complex glycan unit, potentially resulting in N-glycan with four galactose moieties.
  • a “highly galactosylated” anti-HER2 antibody as used herein refers to an anti-HER2 antibody that comprises at least two galactose monosaccharides in the N-glycan moieties.
  • Highly galactosylated antibodies include antibodies wherein both N-glycans each have complex-like units on each of the N-glycan moieties, antibodies where both N-glycans have a complex-type motif on a single arm of the motifs.
  • the highly galactosylated anti-HER2 antibodies according to the invention correspond to the forms in which the N-glycans each comprise a galactose in the glycan unit (for example G1 or G1 F), in which at least one N-glycan comprises two galactoses. in the glycan unit (eg G2 or G2F) and in which 3 or 4 galactoses are in the glycan unit (for example: (i) an N-glycan with a G1 glycan unit and an N-glycan with a G2 glycan unit or G2F, or (ii) two N-glycans with G2 or G2F).
  • the N-glycans each comprise a galactose in the glycan unit (for example G1 or G1 F)
  • at least one N-glycan comprises two galactoses.
  • 3 or 4 galactoses are in the glycan unit (for example: (i) an N-g
  • the highly galactosylated anti-HER2 antibody comprises at least three galactose monosaccharides in the glycan units. In some embodiments, the highly galactosylated anti-HER2 antibody comprises at least four galactose monosaccharides in the glycan units.
  • the highly galactosylated anti-HER2 antibody composition according to the invention preferably comprises a population of anti-HER2 antibodies (preferably trastuzumab) in which the degree of galactosylation of the antibodies in the population is at least 60%, preferably at least 70%.
  • the highly galactosylated anti-HER2 antibody composition according to the invention comprises a highly galactosylated anti-HER2 (preferably trastuzumab) antibody population in which the level of fucosylation is in addition at least 50%, preferably at least 60%.
  • the composition of high-galactosylated anti-HER2 antibodies, optionally highly fucosylated, according to the invention is a trastuzumab composition produced in mammary epithelial cells of a non-human mammal, preferably in a transgenic non-human mammal.
  • the non-human mammal is selected from a goat, a sheep, a buffalo, a camel, a cow, a pig, a rabbit, a buffalo, a horse, a rat, a mouse and a llama.
  • trastuzumab can be produced by transgenic goats, more specifically produced in the milk of transgenic goats.
  • transgenic goats are obtained as follows: Trastuzumab-producing goats are generated using traditional microinjection techniques (see for example US 7,928,064).
  • the cDNAs encoding the heavy and light chains (SEQ ID NO: 67 and SEQ ID NO: 68) were ligated with the casein beta expression vector to yield BC2601 HC and LC BC2602 constructs.
  • the nucleic acid sequence encoding trastuzumab is under the control of a promoter facilitating the expression of trastuzumab in the mammary gland of goats.
  • the prokaryotic sequences are removed and the DNA is microinjected into pre-implantation embryos of the goat.
  • transgenic anti-HER2 antibodies as described in the patent application published under the number WO2014 / 125377 ("Highly Galactosylated Anti-HER2 Antibodies and Their Uses").
  • the anti-CD303 and anti-HER2 antibodies according to the invention may, each independently, be produced in a host cell, a transgenic non-human animal or a transgenic plant comprising at least one nucleic acid encoding such an antibody, its fragments or derivatives, or a vector containing such a nucleic acid.
  • the anti-CD303 antibody and / or the anti-HER2 antibody according to the invention are produced by transgenesis, in particular in a transgenic non-human animal or a transgenic plant.
  • the host cell may be of prokaryotic or eukaryotic origin, and may especially be chosen from bacterial cells, insect cells, plants, yeast or mammals.
  • the antibody according to the invention can then be produced by culturing the host cell under appropriate conditions.
  • a host cell according to the invention can in particular be obtained by transformation of a cell line by the expression vector (s) of the heavy and light chains of an antibody according to the invention, and separation of the different cellular clones. obtained.
  • the transformed cell line is preferably of eukaryotic origin, and may in particular be chosen from insect, plant, yeast or mammalian cells.
  • Cell lines suitable for the production of antibodies include the lines selected from: SP2 / 0; YB2 / 0; IR983F; human myeloma Namalwa; PERC6; the CHO lines, in particular CHO-K-1, CHO-Led O, CHO-Lec1, CHO-Lec13, CHO Pro-5, CHO dhfr-, or CHO line deleted for the two alleles coding for the FUT8 gene and / or the GMD gene; Wil-2; Jurkat; Vero; Molt -4; COS-7; 293-HEK; BHK; K6H6; NSO; SP2 / 0-Ag 14, P3X63Ag8.653, embryonic duck cell line EB66® (Valneva); rat hepatoma lines H4-II-E (DSM ACC3129), and H4-ll-Es (DSM ACC3130) (see WO2012 / 041768), NM-H9D8 (
  • a non-human transgenic animal according to the invention can be obtained by direct injection of the gene (s) of interest into a fertilized egg (Gordon et al. 1980).
  • a transgenic non-human animal can also be obtained by introducing the gene (s) of interest into an embryonic stem cell and preparing the animal by a chimera aggregation method or a chimeric injection method (see Manipulating the Mouse Embryo, A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press (1994), Gene Targeting, A Practical Approach, IRL Press at Oxford University Press (1993)).
  • a non-human transgenic animal can also be obtained by a cloning technique in which a nucleus, in which the gene (s) of interest has been introduced, is transplanted into an enucleated egg (Ryan et al 1997, Cibelli et al., 1998, WO00 / 26357) .
  • a transgenic non-human animal producing an antibody of interest can be prepared by the above methods. The antibody can then be accumulated in the transgenic animal and harvested, in particular from the milk or eggs of the animal.
  • Non-human transgenic animals of interest include the mouse, rabbit, rat, goat, cattle (especially cow), and poultry (including chicken).
  • a transgenic plant according to the invention may be chosen from any plant that allows the production of antibodies. Many antibodies have already been produced in transgenic plants and the technologies necessary to obtain a transgenic plant expressing an antibody of interest and to the recovery of the antibody are well known to those skilled in the art (see Stoger and al-2002, Fisher et al-2003, Ma et al. 2003, Schillberg et al. 2005). It is also possible to influence the glycosylation obtained in plants to obtain glycosylation close to that of natural human antibodies (without xylose), but with, in addition, low fucosylation, for example with the aid of small interfering RNAs (Forthal et al. al, 2010).
  • the anti-CD303 antibody and the anti-HER2 antibody are present, according to the invention, either in a pharmaceutical composition or as combination products.
  • the pharmaceutical composition or the combination products may be administered orally, sublingually, subcutaneously, intramuscularly, intravenously, intraarterially, intrathecally, intraocularly, intracerebrally, transdermally, pulmonally, locally or rectally.
  • the antibodies can then be administered in unit dosage form, in admixture with conventional pharmaceutical carriers.
  • Unit dosage forms include oral forms such as tablets, capsules, powders, granules and oral solutions or suspensions, the forms sublingual and oral administration, aerosols, subcutaneous, transdermal, topical, intraperitoneal, intramuscular, intravenous, subcutaneous, intrathecal implants, intranasal administration forms and rectal administration forms.
  • the pharmaceutical composition or combination products contain a pharmaceutically acceptable carrier for a formulation that can be injected.
  • a pharmaceutically acceptable carrier for a formulation that can be injected. It may be in particular isotonic, sterile, saline solutions (with monosodium or disodium phosphate, sodium chloride, potassium chloride, calcium or magnesium chloride and the like, or mixtures of such salts), or freeze-dried compositions which, when adding sterilized water or physiological saline as appropriate, allow the constitution of injectable solutions.
  • Dosage forms suitable for injectable use include sterile aqueous solutions or dispersions, oily formulations, including sesame oil, peanut oil, and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the form must be sterile and must be fluid to the extent that it must be injected by syringe. It must be stable under the conditions of manufacture and storage and must be preserved from contaminations of microorganisms, such as bacteria and fungi.
  • the dispersions according to the invention can be prepared in glycerol, liquid polyethylene glycols or mixtures thereof, or in oils. Under normal conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • the pharmaceutically acceptable carrier may be a solvent or dispersion medium containing, for example, water, ethanol, a polyol (eg, glycerine, propylene glycol, polyethylene glycol, and the like), suitable mixtures of these, and / or vegetable oils.
  • a surfactant such as lecithin.
  • Prevention of the action of microorganisms may be caused by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid or thimerosal. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions may be caused by the use in the compositions of agents delaying absorption, for example, aluminum monostearate or gelatin.
  • Sterile injectable solutions are prepared by incorporating the active ingredients in the required amount in the appropriate solvent with several of the other ingredients listed above, if appropriate, followed by sterilization by filtration.
  • the dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle that contains the basic dispersion medium and the other required ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and lyophilization.
  • the solutions will be administered in a manner compatible with the dosage formulation and in a therapeutically effective amount.
  • the formulations are easily administered in a variety of dosage forms, such as the injectable solutions described above, but drug release capsules and the like can also be used.
  • parenteral administration in an aqueous solution for example, the solution should be suitably buffered and the liquid diluent rendered isotonic with sufficient saline or glucose.
  • aqueous solutions are particularly suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
  • sterile aqueous media that can be used are known to those skilled in the art.
  • a dose may be dissolved in 1 ml of isotonic NaCl solution and then added to 1000 ml of appropriate liquid, or injected at the proposed site of the infusion. Certain dosage variations will necessarily occur depending on the condition of the subject being treated.
  • the level of therapeutically effective dose specific for a particular patient will depend on a variety of factors, including the disorder being treated and the severity of the disease, the activity of the specific compound employed, the specific composition used, the age, the body weight, general health, sex and diet of the patient, the time of administration, the route of administration, the rate of excretion of the specific compound used, the duration of treatment, or the drugs used in parallel.
  • the invention is now illustrated by the following examples.
  • the anti-CD303 antibody used is a chimeric or humanized antibody comprising the CDRs 122A2 sequences.
  • the anti-HER2 antibody preferably used below is a trastuzumab antibody produced in transgenic goat's milk, for example as described in WO2014 / 125377).
  • Example 1 Impact of the Elimination of pDC on ADCC Activities and Phagocytosis of Trastuzumab (Herceptin®)
  • the pDCs are responsible for the differentiation of T regulators (Moseman EA, 2004, Martin-Gayo E, 2010) inter alia by the ICOS / ICOSL interaction, (Ito, T., 2007, Faget, J. 2012, Faget, J 2013).
  • the T thus differentiated regulators exert mechanisms of immunosuppression on the functions of the other cells of the immune system, in particular the NK cells, via the cell / cell contact but also via the secretion of immunomodulatory cytokines such as IL-10, IL-35 and TGF- ⁇ (Liu, C 2016).
  • the protective effect of anti-CD303 antibodies targeting pDCs can be demonstrated by the correlative study of the decrease or elimination of cytokines IL-10 and TGF- ⁇ in the tumor environment and its impact on the effector functions of an anti-cancer agent administered, specific for the tumor (anti-HER2 antibody such as Herceptin®).
  • anti-HER2 antibody such as Herceptin®
  • the anti-CD303 antibodies depleting the pDCs lead to a limitation of the immunosuppressive effects of regulatory T and thus a limitation of their secretion of IL-10 and TGF- ⁇ .
  • This limitation of secretion of IL-10 and TGF- ⁇ is correlated with a better ADCC of the NK cells, validating the indirect stimulatory effect of the anti-CD303 antibodies on the anti-cancer action of the anti-HER-2 antibodies.
  • NK-CD16 CD16-transfected NK effector cells
  • NK-CD16 cells were cultured in culture medium without IL-2, in the absence or in the presence of IL-10 (5, 50 or 120 ng / ml) and TGF- ⁇ (5 , 50 or 120 ng / ml).
  • IL-10 5, 50 or 120 ng / ml
  • TGF- ⁇ 5 , 50 or 120 ng / ml.
  • BT-474 cells (breast tumor cells) (35000 cells / well) expressing HER-2 are incubated in a flat-bottomed 96-well plate with said NK-CD16 cells, with an E / C ratio (Effector - NK / Target - BT-474) equal to 5/1 and 5000 ng / ml of anti-Her2 antibody (trastuzumab).
  • the negative control corresponds to the same protocol in which trastuzumab is replaced by an anti-FVIII chimeric antibody produced in YB2 / 0.
  • the target cell lysis induced by the anti-HER-2 antibodies is measured chromogenically by quantifying the intracellular enzyme lactate dehydrogenase (LDH) released in the supernatant by the lysed target cells (Roche Diagnostics - Cytotoxicity Detection Kit LDH).
  • LDH lactate dehydrogenase
  • % lysis [(ER - SR) / (100 - SR)] - [(NC - SR) / (100 - SR)]
  • ER and SR respectively represent the experimental (ER) and spontaneous (SR) release of LDH
  • NC represents the natural cytotoxicity of NK cells.
  • % lysis are expressed as a percentage, 100% being the value taken as a reference, obtained with NK-CD16 cells in the presence of trastuzumab and in the absence of IL-10 and TGF- ⁇ (i.e. Trastuzumab alone).
  • the average percentage of ADCC is 63% in the presence of IL-10 and TGF- ⁇ at a concentration of 5000 ng / ml of trastuzumab.
  • the monocytes are differentiated into CD16 + macrophages (M2 like) for 2 days in RPMI 1640 + 10% FCS + M-CSF 50 ng / ml for 48 hours.
  • SKBR3 cells and macrophages are labeled with PKH-67 (green fluorescence) and PKH-26 (red fluorescence), respectively.
  • the SKBR3 cells are opsonized with 10 ⁇ g / ml of the Trastuzumab antibody or with a control antibody and then incubated with the macrophages (1 .105 of each cell / well) in the absence or in the presence of different concentrations of IL-10 (5 , 50 or 120 ng / ml) alone, TGF- ⁇ (5, 50 or 120 ng / ml) alone and IL-10 + TGF- ⁇ .
  • the cells After 3h incubation at 37 ° C, the cells are placed on a counting cell (Mallassez) and observed with a fluorescence microscope.
  • a counting cell Malassez
  • the percentage of phagocytosis is evaluated by counting the number of macrophages (at least 100 macrophages) containing SKBR3 cells.
  • PBMC Mononucleated cells
  • beads coated with anti-CD3 / anti-CD28 to stimulate proliferation T are added in a ratio Treg / beads of 4/1 to verify the activation of Treg.
  • Treg cells (CD4 + , CD25 + ) are purified from PBMC by a two-step process: depletion of CD4 negative cells (CD8, CD14, CD15, CD16, CD19, CD36, CD56, CD123 positive cells) , TCRy / ⁇ , and CD235a) then positive selection of CD25 + cells.
  • Purified pDCs or pDC lines e.g. obtained according to the method described in Maeda T et al., Int J Hematol. 2005 Feb; 81 (2): 148-54 (such as the CAL-1 line or a new line generated by retransfection of CD303 into Cal-1 and selection of a line stably expressing more than 40,000 CD303 antigenic sites per cell, preferably between 40,000 and 50,000) are added in a Treg / pDC ratio of 100, 10 and 1.
  • Different amounts of the anti-CD303 antibody from 1 ng to 10 ⁇ g / ml
  • IL-2 500 U / ml
  • the number of Tregs and their phenotype is monitored over time (1 to 4 days).
  • beads coated with anti-CD3 / anti-CD28 to stimulate proliferation T are added in a ratio Treg / beads of 4/1 to verify the activation of Treg.
  • a negative control in the absence of pDC is established, in order to check the impact (expected neutral) of the anti-CD303 directly on the Tregs.
  • Example 3 Depletion of human pDCs via an anti-CD303 antibody in vivo in the treatment of breast cancer
  • the mouse model 'humanized tumor mouse model' (HTM) can be used. It is characterized by the development of a mature human immune system and the growth of human breast cancer cells that have been previously co-transplanted with human hematopoietic stem cells. Very recently, the efficacy of Trastuzumab / Herceptin treatment has been proven in this model (Wege AK et al, Oncotarget 2017, 8 (2): 2731-2744).
  • This model advantageously brings together several elements that are relevant for the reproducibility of the in vivo conditions: presence of human pDCs which alone express on their surface the target CD303, presence of infiltration of human Treg cells, presence of human tumor cells expressing on their surface HER2 , trastuzumab / Herceptin target molecule and an immunocompetent murine host (NK effector cells for ADCC activity).
  • the model previously described in the article Wege et al Int J Cancer 201 1, 129: 2194-2206) combines all these characteristics.
  • BRGSF TM or BRGSF TM -A2 mice BALB / c, Rag2tm1 Fwa, IL-2Ryctm1 Cgn, SIRPocNOD, Flk2tm1 lrl, Tg (HLA-A / H2-D / B2M) 1 Bpe
  • Said BRGSF TM mice can be generated according to the procedure described by Legrand N, Huntington ND, Nagasawa M et al.
  • mice from the immunodeficient mouse line BRGSF TM -A2 (BALB / c Rag2 tm1 Fwa IL-2Ry c tm1 tm1 C9N SIRPoc NOD Flk2 lrl Tg (HLA-A / D H2- / B2M) 1 Bpe are irradiated (3 Gy) during their first 192 hours of life and 24 hours after transplantation by intrahepatic injection with 1 x 10 5 human CD34 + cells isolated from umbilical cord blood (RBC) in the presence or not of tumor cells 3x10 6 BT474-Luc (expressing luciferase for monitoring bioluminescence).
  • BRGSF TM -A2 BALB / c Rag2 tm1 Fwa IL-2Ry c tm1 tm1 C9N SIRPoc NOD Flk2 lrl Tg (HLA-A / D H2- / B2M) 1 Bpe are irradiated (3
  • the BT474 cells are cells of human origin derived from a breast carcinoma expressing at their surface the receptor HER2 / Neu, the target of the Trastuzumab antibody
  • the BT474 cells were, before their administration, modified by lentiviral transduction in order to make them luminescent thanks to the constitutive expression of luciferase. modification allows a control the cross-over time of the taking of tumors through analysis of bioluminescence while not sacrificing animals and thus better adjust the start of processing window.
  • the mice are tested for their degree of humanization by analysis of the composition of cells present in their blood (human and murine) by flow cytometry and then divided into five groups.
  • a control group without injection of BT474 cells treated with an isotype antibody ie an anti-Factor VIII antibody
  • this group serves as a negative control for tumor 1
  • an injection control group of BT474 cells treated with an isotype antibody ie an anti-Factor VIII antibody
  • group 2 a group treated with transgenic trastuzumab
  • group 4 a group treated with the anti-CD303 antibody
  • group 5 a group treated with the combination of anti-CD303 and TTG antibody treatments
  • Treatment begins 14 weeks after humanization (ie injection of human CD34 + cells isolated from umbilical cord blood (CB) in the presence or absence of 3x10 6 BT474-Luc tumor cells) and lasts 19 weeks.
  • the treatment consists of the injection of the products tested intravenously at a dose of 30 mg / kg of body weight in the case of the anti-CD303 antibody every 3 days and once a week at 10 mg / kg of weight. in the case of TTG.
  • the body weight of the mice is determined 3 days before the start of treatment to adjust the dose individually.
  • the impact of the treatment on the human pDC subpopulation as well as the other populations of lymphoid cells (B lymphocytes, T lymphocytes, etc.) present in the blood and the spleen was determined by flow cytometry at different times: , j3 and j7.
  • the results show that treatment with anti-CD303 antibody at a dose of 30 mg / kg in humanized BRGSF-HIS mice induces depletion of human pDCs for at least 7 days in the blood and spleen. In blood, the depletion activity of human pDCs is rapid (> 80% on day 1) and later in the spleen.
  • this model proves to be a model particularly suited to the study of the invention since the search for pDC in sacrificed mouse tumors shows for the first time the presence of pDC infiltrating these tumors.
  • Figure 1 which shows the percentage of human pDC in the liver - tumor site - for the negative control (mice not injected with BT474 cells) (CT), and for the mice injected with BT474 cells (BT474)) .
  • the adapted HTM murine model can be advantageously used to evaluate the indirect effect of the administration of an anti-CD303 antibody on the effect of the anti-tumor breast agent, the anti-HER2 antibody (trastuzumab), under conditions reproducing a physiological situation in vivo, by comparing in particular the results obtained with the different groups tested.
  • This model is thus useful to be able to evaluate the benefit, advantageously the synergistic effect, of administering an anti-CD303 antibody in combination with the administration of an anti-HER2 antibody in a breast tumor.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Public Health (AREA)
  • Oncology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

La présente invention concerne une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable : a. au moins un anticorps anti-CD303; et b. au moins un anticorps anti-HER2. La présente invention est également relative à l'association des deux anticorps a) et b) susmentionnés comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.

Description

Combinaison d'anticorps anti-CD303 et anti-HER2
La présente invention a pour objet une nouvelle combinaison d'anticorps, notamment pour la prévention ou le traitement d'un cancer HER2-positif.
Le cancer du sein est la première cause de mortalité chez la femme entre 35 et 65 ans. Les cancers du sein les plus fréquents (95 %) sont des adénocarcinomes, qui se développent à partir des cellules épithéliales de la glande mammaire. On distingue les cancers in situ et les cancers infiltrants.
Le stade du cancer du sein est un facteur pronostique important. Un stade inférieur engendre moins de risques de réapparition du cancer (récidive) et un pronostic plus favorable. Un stade supérieur engendre un risque plus élevé de récidive et un pronostic moins favorable. Le système le plus fréquemment utilisé pour déterminer le stade du cancer du sein est la classification TNM (Tumeur, Nodes (terme anglais pour les ganglions lymphatiques) et Métastases). La classification TNM prend en compte :
- la taille de la tumeur primitive ;
- le nombre de ganglions lymphatiques régionaux qui contiennent des cellules cancéreuses ainsi que leur emplacement ; et
- la propagation du cancer, ou métastases, vers une autre partie du corps.
Les facteurs liés au stade qui sont les plus importants sont l'atteinte des ganglions lymphatiques et la taille de la tumeur.
La taille de la tumeur au sein fait augmenter le risque de récidive :
une grosse tumeur au sein (5 cm ou plus) engendre le plus grand risque de récidive ;
une tumeur au sein dont la taille est inférieure à 1 cm et qui ne s'est pas propagée aux ganglions lymphatiques engendre le meilleur pronostic.
L'atteinte des ganglions lymphatiques est également un facteur pronostique important du cancer du sein, et indépendant de la taille de la tumeur. Elle s'évalue par la présence ou non du cancer dans lesdits ganglions, ainsi que par le nombre de ganglions atteint. Si les ganglions lymphatiques sont positifs, cela engendre un risque de récidive plus élevé et un pronostic moins favorable qu'un cancer du sein qui ne s'est pas propagé aux ganglions lymphatiques (ganglions négatifs). En outre, le cancer du sein peut aussi se propager aux ganglions mammaires internes sans avoir atteint les ganglions axillaires. Dans ce cas-là, le risque de récidive est élevé même si les ganglions axillaires sont négatifs. Enfin, plus le nombre de ganglions positifs est élevé, plus le risque de récidive l'est aussi.
L'Union internationale contre le cancer (UICC) utilise le système TNM pour décrire l'étendue du cancer du sein, et définit les stades suivants : stade 0, stade I, stades II A et B, stades 111 A à C et stade IV.
Une fois dépisté, différents types de traitements peuvent être utilisés pour traiter un cancer du sein : la chirurgie, la radiothérapie, l'hormonothérapie, la chimiothérapie et les thérapies ciblées. Une individualisation des thérapies selon les patients est nécessaire pour une efficacité optimale. Il arrive parfois qu'un seul type de traitement soit utilisé. Dans d'autres cas, une association de traitements est effectuée pour mieux maîtriser la maladie. On peut ainsi, par exemple, réaliser une chirurgie et compléter ensuite le traitement uniquement par une chimiothérapie, ou uniquement par une radiothérapie. Plusieurs thérapies ciblées sont aujourd'hui utilisées pour lutter contre le cancer du sein. Ces thérapies, à base d'anticorps monoclonaux ou de molécules chimiques, bloquent des mécanismes spécifiques des cellules cancéreuses.
Cependant, il existe toujours un besoin pour une thérapie efficace d'un cancer HER2-positif, en particulier du cancer du sein, notamment lorsque le cancer présente une invasion de cellules effectrices susceptibles d'induire une tolérance par le système immunitaire, tout en identifiant une thérapie qui soit mieux tolérée, et qui présente moins d'effets secondaires.
Les inventeurs ont maintenant découvert que, de façon surprenante, l'association d'un anticorps anti-CD303 et d'un anticorps anti-HER2, est particulièrement efficace contre les tumeurs HER2-positives, en particulier contre les tumeurs mammaires. Notamment, la combinaison de ces deux anticorps peut présenter un effet synergique sur le site de la tumeur. La présente invention concerne ainsi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable :
a. au moins un anticorps anti-CD303; et
b. au moins un anticorps anti-HER2.
La présente invention se rapporte également à des produits contenant :
a. au moins un anticorps anti-CD303; et b. au moins un anticorps anti-HER2,
comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.
L'invention concerne encore :
au moins un anticorps anti-HER2 pour son utilisation pour la prévention ou le traitement d'un cancer HER2-positif en combinaison avec au moins un anticorps anti- CD303; et
- au moins un anticorps anti-CD303 pour son utilisation pour la prévention ou le traitement d'un cancer HER2-positif en combinaison avec au moins un anticorps anti- HER2.
L'invention concerne également une méthode de traitement d'un cancer HER2- positif, qui comprend l'administration à un patient d'au moins un anticorps anti-HER2 et d'au moins un anticorps anti-CD303.
Selon la présente invention, le terme « anticorps » fait référence aussi bien à une immunoglobuline, qu'aux fragments et dérivés de cette immunoglobuline. Les immunoglobulines sont bien connues de l'homme du métier et sont constituées d'un assemblage de deux dimères constitués chacun d'une chaîne lourde et d'une chaîne légère. Le complexe multimérique est assemblé par la liaison d'une chaîne légère et d'une chaîne lourde par un pont disulfure entre deux cystéines, les deux chaînes lourdes étant elles-mêmes également reliées entre elles par deux ponts disulfures.
Chacune des chaînes lourdes et des chaînes légères est constituée d'une région constante et d'une région variable. Plus précisément, chaque chaîne légère est constituée d'une région variable (VL) et d'une région constante (CL). Chaque chaîne lourde est constituée d'une région variable (VH> et d'une région constante constituée de trois domaines constants Cm , CH2 et CH3- Les domaines CH2 et CH3 composent le domaine Fc. Les régions variables de la chaîne légère et de la chaîne lourde sont constituées de trois domaines déterminant la reconnaissance de l'antigène (régions CDR, i.e. Complementary Determining Régions) entourées de quatre domaines charpentes (régions FR ou Framework).
Les anticorps anti-CD303 a) et anti-HER2 b) peuvent être monoclonaux ou polyclonaux. De préférence, ce sont des anticorps monoclonaux. Les anticorps peuvent être de plusieurs isotypes, en fonction de la nature de leur région constante : les régions constantes γ, α, μ, ε et δ correspondent respectivement aux immunoglobulines IgG, IgA, IgM, IgE et IgD. Avantageusement, les anticorps anti-CD303 a) et anti-HER2 b) sont d'isotype IgG. En effet, cet isotype montre une capacité à engendrer une activité ADCC (« Antibody-Dependent Cellular Cytotoxicity », soit
Cytotoxicité cellulaire dépendante de l'anticorps) chez le plus grand nombre d'individus (humains). Les régions constantes γ comprennent plusieurs sous-types : γ1 , γ2, γ3, ces trois types de régions constantes présentant la particularité de fixer le complément humain, et γ4, créant ainsi les sous-isotypes lgG1 , lgG2, lgG3, et lgG4. Avantageusement, les anticorps anti-CD303 a) et anti-HER2 b) sont d'isotype lgG1 ou lgG2, de préférence lgG1 .
Dans un aspect particulier de l'invention, les anticorps anti-CD303 a) et anti-HER2 b) sont choisis parmi les anticorps murins, les anticorps chimériques, les anticorps humanisés et les anticorps humains.
De préférence, l'anticorps anti-CD303 a) et/ou l'anticorps anti-HER2 b) est un anticorps chimérique, et plus préférentiellement un anticorps chimérique choisi parmi un anticorps chimérique murin/humain ou un anticorps chimérique humain/macaque.
Alternativement, de préférence, l'anticorps anti-CD303 a) et/ou l'anticorps anti- HER2 b) est un anticorps humanisé, en particulier un anticorps chimérique dont la région constante des chaînes lourdes et légères est d'origine humaine.
Le terme « anticorps chimérique » fait référence à un anticorps isolé, dans lequel la séquence de chaque chaîne légère et/ou de chaque chaîne lourde qui le constitue comprend ou consiste en une séquence hybride issue d'au moins deux animaux distincts. Notamment, un anticorps chimérique contient une région variable de chaîne légère et une région variable de chaîne lourde sauvages murines, fusionnées avec les régions constantes humaines de chaîne légère et de chaîne lourde respectivement. Un anticorps chimérique peut être préparé en utilisant les techniques de recombinaison génétique bien connues de l'homme du métier.
Le terme « anticorps humanisé » fait référence à un anticorps issu d'un animal autre que l'homme dans lequel les séquences des chaînes lourdes et des chaînes légères autres que les CDR ont été remplacées par des séquences correspondantes d'un ou plusieurs anticorps d'origine humaine. L'anticorps est donc majoritairement constitué de séquences humaines, mais sa spécificité pour l'antigène conférée par les CDRs est issue d'une autre espèce. En outre, certains des résidus des segments du squelette (dénommés FR) peuvent être modifiés pour conserver l'affinité de liaison (Jones et al- 1986 ; Verhoeyen et al- 1988 ; Riechmann et al-1988). Les anticorps humanisés selon l'invention peuvent être préparés par des techniques connues de l'homme de l'art telles les technologies de « CDR grafting », de « resurfacing », de SuperHumanisation, de « Human string content », de « FR libraries », de « Guided sélection », de « FR shuffling » et de « Humaneering », comme résumé dans la revue de Almagro et al-2008.
Comme indiqué ci-dessus, l'anticorps anti-CD303 et/ou l'anticorps anti-HER2 selon l'invention peut également être présent sous la forme d'un fragment d'anticorps anti- CD303 et/ou d'un fragment d'anticorps anti-HER2, respectivement.
Le terme « fragment » fait en particulier référence aux fragments Fab, F(ab)'2 ou
Fd.
Le terme « Fab » fait référence à un fragment d'anticorps de masse moléculaire d'environ 50.000 Da et possédant une activité de liaison à l'antigène. Le fragment Fab est formé de la chaîne légère en entier (VL+CL) et d'une partie de la chaîne lourde (VH+CH1 ). Il peut être obtenu notamment par traitement des IgG par une protéase, la papaïne.
Le terme « F(ab')2 » fait référence à un fragment d'environ 100.000 Da et possédant une activité de liaison à l'antigène. Il correspond à l'association par un pont disulfure (région charnière) de deux fragments Fab décrits ci-dessus. Il peut être obtenu par le traitement des IgG par une protéase, la pepsine.
Le terme « Fd » correspond à la partie de la chaîne lourde qui est incluse dans le fragment Fab. Le fragment Fd est ainsi formé des domaines VH et CH1 . Comme indiqué ci-dessus, l'anticorps anti-CD303 et/ou l'anticorps anti-HER2 selon l'invention peut également être présent sous la forme d'un dérivé d'anticorps anti- CD303 a) et/ou d'un dérivé d'anticorps anti-HER2 b), respectivement.
Le terme « dérivé » fait en particulier référence aux dérivés scFv, et aux multimères de scFv, comme le diabody, triabody ou tetrabody.
Le terme « scFv » (single chain Fv) est un polypeptide VH:VL synthétisé en utilisant les gènes codant pour les domaines VL et VH et une séquence linker. Un scFv inclut les CDR maintenus dans une conformation appropriée, par exemple en utilisant des techniques de recombinaison génétique. Les scFv peuvent également servir de modules de base pour le développement de structures multimériques (dimérique : « diabody », trimérique : « triabody », tétramérique : « tetrabody »).
Le terme « diabody » fait référence à un dimère de scFv. Ce dimère de fragment a la propriété de maintenir la double valence que l'anticorps parent possède. Le diabody est bivalent, mono ou bispécifique selon qu'il fixe deux antigènes identiques ou différents.
Le terme « triabody » fait référence à l'association trivalente de scFv. Un triabody peut ainsi fixer trois antigènes identiques ou différents.
Le terme « tétrabody » fait référence à l'association tétravalente de scFv. Un tétrabody peut fixer quatre antigènes identiques ou différents.
Le terme « cancer HER2-positif » fait référence à un cancer comprenant des cellules qui présentent la protéine HER2 à leur surface. Notamment, lesdites cellules cancéreuses surexpriment la protéine HER2. Le cancer HER2-positif est par exemple le cancer de l'utérus, le cancer de l'ovaire, le cancer du sein ou le cancer de l'estomac. De préférence, le cancer HER2-positif est le cancer du sein. Le terme « cancer du sein » fait référence au cancer des glandes mammaires, qu'il soit non invasif (Carcinome Canalaire In Situ I Intracanalaire (CCIS)) ou invasif. La présente invention concerne aussi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable, au moins un anticorps anti-CD303, et au moins un fragment ou un dérivé d'anticorps anti-HER2.
La présente invention se rapporte également à des produits contenant au moins un anticorps anti-CD303, et au moins un fragment ou un dérivé d'anticorps anti-HER2, comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.
La présente invention concerne aussi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable, au moins un fragment d'anticorps anti-CD303, et au moins un anticorps anti-HER2 ou l'un de ses fragments ou l'un de ses dérivés.
La présente invention se rapporte également à des produits contenant au moins un fragment d'anticorps anti-CD303, et au moins un anticorps anti-HER2 ou l'un de ses fragments ou l'un de ses dérivés, comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif. La présente invention concerne aussi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable, au moins un dérivé d'anticorps anti-CD303, et au moins un anticorps anti-HER2 ou l'un de ses fragments ou l'un de ses dérivés.
La présente invention se rapporte également à des produits contenant au moins un dérivé d'anticorps anti-CD303, et au moins un anticorps anti-HER2 ou l'un de ses fragments ou l'un de ses dérivés, comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.
La présente invention concerne aussi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable, au moins un anticorps anti-HER2, et au moins un fragment ou un dérivé d'anticorps anti-CD303.
La présente invention se rapporte également à des produits contenant au moins un anticorps anti-HER2, et au moins un fragment ou un dérivé d'anticorps anti-CD303, comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.
La présente invention concerne aussi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable, au moins un fragment d'anticorps anti-HER2, et au moins un anticorps anti-CD303 ou l'un de ses fragments ou l'un de ses dérivés.
La présente invention se rapporte également à des produits contenant au moins un fragment d'anticorps anti-HER2, et au moins un anticorps anti-CD303 ou l'un de ses fragments ou l'un de ses dérivés, comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.
La présente invention concerne aussi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable, au moins un dérivé d'anticorps anti-HER2, et au moins un anticorps anti-CD303 ou l'un de ses fragments ou l'un de ses dérivés.
La présente invention se rapporte également à des produits contenant au moins un dérivé d'anticorps anti-HER2, et au moins un anticorps anti-CD303 ou l'un de ses fragments ou l'un de ses dérivés, comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif. La présente invention concerne ainsi une composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable :
a. au moins un anticorps anti-CD303; et
b. au moins un anticorps anti-HER2.
Par « véhicule pharmaceutiquement acceptable », on entend un milieu non toxique compatible avec un système biologique tel qu'une cellule, une culture cellulaire, un tissu ou un organisme. L'invention se rapporte également à des produits contenant chacun un des deux agents actifs a) et b) susmentionnés, lesdits actifs étant combinés pour une utilisation simultanée, séparée ou étalée dans le temps, et dans la prévention ou le traitement d'un cancer HER2-positif. Anticorps anti-CD303
L'anticorps anti-CD303 est un anticorps dirigé contre la protéine CD303. Cette protéine, également nommée initialement BDCA-2, est exprimée de manière spécifique à la surface des cellules dendritiques plasmacytoïdes, et est une protéine de type II appartenant aux lectines de type C.
L'antigène CD303 humain (ou protéine CD303) est le membre C de la 4ème famille de domaine lectine de type C (CLEC4 ou « C-type lectin domain family 4, member C »). Il s'agit d'une glycoprotéine transmembranaire de type II de 213 acides aminés (accessible dans Uniprot : Q8WTT0), comprenant un court domaine cytoplasmique sans motif de signalisation évident (acides aminés 1 -21 ), une région transmembranaire (acides aminés 22-44), et un domaine extracellulaire (acides aminés 45-213).
Les cellules dendritiques plasmacytoïdes correspondent à une sous-population de cellules dendritiques, aussi appelée DC2. Les cellules dendritiques plasmacytoïdes sont caractérisées par les marqueurs Lin- (CD3-, CD19-, CD20-, CD14-, CD56-), HLA-DR+, CD1 1 c-, CD123+ et CD45RA+. Ces cellules ont aussi été caractérisées phénotypiquement : elles expriment les marqueurs CD4, CD303 et BDCA-4. Elles sont présentes dans les organes lymphoïdes et sont également en circulation dans le sang. Elles ont la capacité de sécréter de l'IFN de type I en présence d'une infection virale. Elles peuvent favoriser la croissance des cellules tumorales et leur survie, en induisant notamment un environnement immunosuppressif dans l'environnement de la tumeur, par exemple en induisant la différenciation de lymphocytes T régulateurs (Treg). Ainsi, ces cellules présentent des propriétés immunosuppressives et/ou tolérogènes vis-à-vis de la tumeur. L'expression « propriétés immunosuppressives » se réfère aux propriétés des cellules dendritiques de développer et maintenir l'immunosuppression dans l'environnement de la tumeur. L'expression « propriétés tolérogènes » signifie que les cellules dendritiques plasmacytoïdes ne vont pas induire de réponse immunitaire.
L'utilisation d'anticorps anti-CD303 selon l'invention, par leur action cytotoxique, permet avantageusement de supprimer les cellules dendritiques plasmacytoïdes infiltrant la tumeur. Les propriétés immunosuppressives et/ou tolérogènes vis-à-vis de la tumeur sont ainsi diminuées, avantageusement supprimées, ce qui améliore l'immunité antitumorale in situ.
De préférence, l'anticorps anti-CD303 selon l'invention est un anticorps monoclonal dirigé contre l'ectodomaine de l'antigène CD303 humain (SEQ ID NO :69).
Avantageusement, l'anticorps anti-CD303 selon l'invention comprend des chaînes lourdes comprenant trois CDR-H (CDR de chaîne lourde selon la nomenclature IMGT) ayant les séquences d'acides aminés suivantes, ou des séquences ayant au moins 80% d'identité avec les séquences suivantes, et des chaînes légères comprenant trois CDR-L (CDR de chaîne légère selon la nomenclature IMGT) ayant les séquences d'acides aminés suivantes, ou des séquences ayant au moins 80% d'identité avec les séquences suivantes :
i) CDR1 -H-famille 1 : SEQ ID NO : 1 , CDR2-H-famille 1 : SEQ ID NO : 2,
CDR3-H-famille 1 : SEQ ID NO : 3, CDR1 -L-famille 1 : SEQ ID NO : 4, CDR2-L-famille 1 : SEQ ID NO : 5, CDR3-L-famille 1 : SEQ ID NO : 6; ou
ii) CDR1 -H-famille 2 : SEQ ID NO : 7, CDR2-H-famille 2: SEQ ID NO : 8,
CDR3-H-famille 2: SEQ ID NO : 9, CDR1 -L-famille 2: SEQ ID NO : 10, CDR2-L-famille 2: SEQ ID NO : 1 1 , CDR3-L-famille 2: SEQ ID NO : 12.
L'expression « au moins 80% d'identité » signifie une identité de 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% et 100%. Les pourcentages d'identité auxquels il est fait référence dans le cadre de la présente invention sont déterminés sur la base d'un alignement global des séquences à comparer, c'est-à-dire sur un alignement des séquences prises dans leur intégralité sur toute la longueur en utilisant tout algorithme bien connu de l'homme du métier tel que l'algorithme de Needleman et Wunsch-1970. Cette comparaison de séquences peut être effectuée à l'aide de tout logiciel bien connu de l'homme du métier, par exemple le logiciel needle en utilisant le paramètre « Gap open » égal à 10.0, le paramètre « Gap extend » égal à 0.5 et une matrice « Blosum 62 ». Le logiciel needle est par exemple disponible sur le site internet ebi.ac.uk world wide sous la dénomination « Align ».
Lorsque le CDR ou la région variable d'un anticorps possède une séquence d'acides aminés ayant au moins 80%, de préférence au moins 85%, au moins 90%, au moins 95%, au moins 96%, au moins 97%, au moins 98%, ou au moins 99% d'identité avec une séquence de référence, elle peut présenter des insertions, délétions ou substitutions par rapport à la séquence de référence. Lorsqu'il s'agit de substitutions, la substitution est de préférence réalisée par un acide aminé « équivalent », c'est-à-dire tout acide aminé dont la structure est proche de celle de l'acide aminé d'origine et est donc peu probable de modifier les activités biologiques de l'anticorps, ou un acide aminé dont la structure diffère mais dont les propriétés intrinsèques sont connues pour être équivalentes à celles de l'acide aminé d'origine et ne modifiant par les activités biologiques de l'anticorps.
Le Tableau 1 ci-dessous résume les séquences d'acides aminés des CDR-IMGT des deux familles d'anticorps anti-CD303 pouvant être utilisées selon l'invention :
Tableau 1 . Séquences d'acides aminés des CDR des deux familles d'anticorps anti-CD303 pouvant être utilisées selon l'invention selon la nomenclature IMGT. Dans chaque séquence, X peut représenter n'importe quel acide aminé.
Avantageusement, l'anticorps anti-CD303 selon l'invention comprend trois CDR-H (CDR de chaîne lourde selon la nomenclature IMGT) ayant les séquences d'acides aminés suivantes, ou des séquences ayant au moins 80% d'identité avec les séquences suivantes, et trois CDR-L (CDR de chaîne légère selon la nomenclature IMGT) ayant les séquences d'acides aminés suivantes, ou des séquences ayant au moins 80% d'identité avec les séquences suivantes :
i) CDR1 -H-122A2 : SEQ ID NO : 13, CDR2-H-122A2: SEQ ID NO : 14, CDR3-H-122A2: SEQ ID NO : 15, CDR1 -L-122A2: SEQ ID NO : 16, CDR2- L-122A2: SEQ ID NO : 17, CDR3-L-122A2: SEQ ID NO : 18; ii) CDR1 -H-102E9 : SEQ ID NO : 19, CDR2-H-102E9: SEQ ID NO : 20, CDR3-H-102E9: SEQ ID NO : 21 , CDR1 -L-102E9: SEQ ID NO : 22, CDR2- L-102E9: SEQ ID NO : 23, CDR3-L-102E9: SEQ ID NO : 24; iii) CDR1 -H-104C12 : SEQ ID NO : 25, CDR2-H-104C12: SEQ ID NO : 26, CDR3-H-104C12: SEQ ID NO : 27, CDR1 -L-104C12: SEQ ID NO : 28,
CDR2-L-104C12: SEQ ID NO : 29, CDR3-L-104C12: SEQ ID NO : 30; iv) CDR1 -H-1 14D1 1 : SEQ ID NO : 31 , CDR2-H-1 14D1 1 : SEQ ID NO : 32, CDR3-H-1 14D1 1 : SEQ ID NO : 33, CDR1 -L-1 14D1 1 : SEQ ID NO : 34, CDR2-L-1 14D1 1 : SEQ ID NO : 35, CDR3-L-1 14D1 1 : SEQ ID NO : 36; ou v) CDR1 -H-104E10: SEQ ID NO : 37, CDR2-H-104E10: SEQ ID NO : 38,
CDR3-H-104E10 : SEQ ID NO : 39, CDR1 -L-104E10: SEQ ID NO : 40, CDR2-L-104E10: SEQ ID NO : 41 , CDR3-L-104E10: SEQ ID NO : 42.
Avantageusement, l'anticorps anti-CD303 selon l'invention possède des chaînes lourdes et légères dont les régions variables ont les séquences d'acides aminés suivantes ou des séquences ayant au moins 80% d'identité avec les séquences suivantes :
i) Anticorps 122A2: chaîne lourde : SEQ ID NO : 43, chaîne légère : SEQ ID NO : 48,
ii) Anticorps 102E9: chaîne lourde : SEQ ID NO : 44, chaîne légère : SEQ ID NO : 49,
iii) Anticorps 104C12: chaîne lourde : SEQ ID NO : 45, chaîne légère : SEQ ID NO : 50,
iv) Anticorps 1 14D1 1 : chaîne lourde : SEQ ID NO : 46, chaîne légère : SEQ ID NO : 51 , ou
v) Anticorps 104E10: chaîne lourde : SEQ ID NO : 47, chaîne légère :
SEQ ID NO : 52.
Le Tableau 2 ci-dessous résume les séquences d'acides aminés des CDRs et des régions variables des chaînes lourdes et légères des anticorps anti-CD303 selon l'invention : Anticorps 122A2
Chaîne lourde
CDR1 -H-IMGT-122A2 GYTFTDYS (SEQ ID NO : 13)
CDR2-H-IMGT-122A2 ISTYYGDS (SEQ ID NO : 14)
CDR3-H-IMGT-122A2 ARNGNFYVMDY (SEQ ID NO : 15)
QVQLQQSGAELVRPGVSVKISCKGSGYTFTDYSMHWVK QSHAKSLEWIGVISTYYGDSNYNQKFKGKATMTVDKSST
VH-122A2
TAYMELARLTSEDSAIYYCARNGNFYVMDYWGQGTSVTV SS (SEQ ID NO : 43)
Chaîne légère
CDR1 -L-IMGT-122A2 QDISNY (SEQ ID NO : 16)
CDR2-L-IMGT-122A2 YTS (SEQ ID NO : 17)
CDR3-L-IMGT-122A2 QQGNTLPWT (SEQ ID NO : 18)
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKP
VL-122A2 DGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLDQ
EDIATYFCQQGNTLPWTFGGGTKLEIK (SEQ ID NO : 48)
Anticorps 102E9
Chaîne lourde
CDR1 -H-IMGT-102E9 GYTFTDYS (SEQ ID NO : 19)
CDR2-H-IMGT-102E9 INTETGEP (SEQ ID NO : 20)
CDR3-H-IMGT-102E9 TRNGYYVGYYAMDY (SEQ ID NO : 21 )
QIHLVQSGPDLKKPGETVKISCKASGYTFTDYSMHWVKQ APGKGLKWMGWINTETGEPTYADDFKGRFAFSLESSAST
VH-102E9
AFLQINNLKNEDTSTYFCTRNGYYVGYYAMDYWGQGTSV TVSS (SEQ ID NO : 44)
Chaîne légère
CDR1 -L-IMGT-102E9 SSVIY (SEQ ID NO : 22)
CDR2-L-IMGT-102E9 STS (SEQ ID NO : 23)
CDR3-L-IMGT-102E9 QQRRSYPFT (SEQ ID NO : 24)
QIVLTQSPAIMSASPGEKVTITCSASSSVIYIHWFQQKPGT
VL-102E9 SPKLWIYSTSYLASGVPARFSGSGSGTSYSLTISRMEAED
AATYYCQQRRSYPFTFGGGTKLEIK (SEQ ID NO : 49)
Anticorps 104C12
Chaîne lourde CDR1 -H-IMGT-104C12 GYTFTDYS (SEQ ID NO : 25)
CDR2-H-IMGT-104C12 ISPYYGDT (SEQ ID NO : 26)
CDR3-H-IMGT-104C12 ARNDDYYRFAY (SEQ ID NO : 27)
QVQLQQSGAELVGPGVSVKISCKGSGYTFTDYSMHWVK QSHAKSLEWIGVISPYYGDTNYNQKFKGKATMTVDKSSS
VH-104C12
TAYMELASLTSEDSAIYFCARNDDYYRFAYWGQGTLVTV SA (SEQ ID NO : 45)
Chaîne légère
CDR1 -L-IMGT-104C12 QDINNY (SEQ ID NO : 28)
CDR2-L-IMGT-104C12 YTS (SEQ ID NO : 29)
CDR3-L-IMGT-104C12 QQGKTLPWT (SEQ ID NO : 30)
DLQMTQTPSSLSASLGDRVTISCRASQDINNYLSWYQEK PDGTFKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTVRNLE
VL-104C12
QEDIGTYFCQQGKTLPWTFGGGTKLEIR (SEQ ID NO : 50)
Anticorps 114D11
Chaîne lourde
CDR1 -H-IMGT-1 14D1 1 GYTFTDSS (SEQ ID NO : 31 )
CDR2-H-IMGT-1 14D1 1 INTETGGP (SEQ ID NO : 32)
CDR3-H-IMGT-1 14D1 1 ARNGYYVGYYALDY (SEQ ID NO : 33)
QIQLVQSGPELKKPGETVKISCKASGYTFTDSSMHWVQQ APNKGLKWMGWINTETGGPTYADDFKGRFAFSLETSART
VH-1 14D1 1
AYLQ I N N LKN E DTATYFCARNG YYVG YYALDYWGQGTS V TVSS (SEQ ID NO : 46)
Chaîne légère
CDR1 -L-IMGT-1 14D1 1 SSVFY (SEQ ID NO : 34)
CDR2-L-IMGT-1 14D1 1 STS (SEQ ID NO : 35)
CDR3-L-IMGT-1 14D1 1 QQRRSYPYT (SEQ ID NO : 36)
QIVLTQSPAIMSASPGEKVTITCSASSSVFYMHWFQQKPG
VL-1 14D1 1 TSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAE
DAATYYCQQRRSYPYTFGGGTKLEIK (SEQ ID NO : 51 )
Anticorps 104E10
Chaîne lourde
CDR1 -H-IMGT-104E10 GYTFTDYS (SEQ ID NO : 37) CDR2-H-IMGT-104E10 INTETGEP (SEQ ID NO : 38)
CDR3-H-IMGT-104E10 ARNGYYVGYYAMDY (SEQ ID NO : 39)
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSMHWVKQ APGKGLKWMGWINTETGEPTYADDFKGRFAFSLETSATT
VH-104E10
AYLQINNFKNE DTAT YFC AR NG YYVG YYAM D YWGQGTS VTVSS (SEQ ID NO : 47)
Chaîne légère
CDR1 -L-IMGT-104E10 SSVIY (SEQ ID NO : 40)
CDR2-L-IMGT-104E10 STS (SEQ ID NO : 41 )
CDR3-L-IMGT-104E10 QQRRSYPYT (SEQ ID NO : 42)
QIVLTQSPAIMSASPGEKVTMTCSASSSVIYMHWFQQKP
VL-104E10 GTSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEA
EDAATYYCQQRRSYPYTFGGGTKLEIK (SEQ ID NO : 52)
Tableau 2. Séquences d'acides aminés des CDR1 , CDR2, et CDR3 des chaînes lourdes et légères selon la nomenclature IMGT, et des fragments VH et VL des anticorps anti-CD303 selon l'invention.
De préférence, l'anticorps anti-CD303 selon l'invention présente une région constante humaine, préférentiellement une région constante humaine d'isotype lgG1 .
Les séquences préférées de région constante des chaînes lourde ou légère humaines, SEQ ID NO : 53 et SEQ ID NO : 54, d'isotype lgG1 , sont présentées dans le Tableau 3 ci-dessous.
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK
Région
VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP
constante de
EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
chaîne lourde
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
humaine
TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
préférée (lgG1 )
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPG (SEQ ID NO :53)
Région
RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA
constante de
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ
chaîne légère
GLSSPVTKSFNRGEC (SEQ ID NO :54)
humaine préférée (lgG1 )
Tableau 3 \. Séquences préférées de région constante de chaînes lourde et légère humaines SEQ ID NO : 53 et SEQ ID NO : 54.
Ainsi, l'anticorps anti-CD303 selon l'invention comprend avantageusement les chaînes lourde et légère décrites dans le Tableau 4 ci-dessous.
Tableau 4. Séquences d'acides aminés des chaînes lourdes et légères des anticorps anti-CD303 selon l'invention. Anticorps anti-HER2
L'anticorps anti-HER2 est un anticorps dirigé contre le récepteur du facteur de croissance pour l'épiderme humain (Human Epidermal Growth Factor Receptor 2).
HER-2, aussi connu sous le nom de HER2/neu ou ErbB2, est un membre de la famille des récepteurs du facteur de croissance épidermique. HER2 est un récepteur tyrosine kinase lié à la membrane plasmique qui peut se dimériser avec lui-même et avec d'autres membres de la famille des récepteurs du facteur de croissance épidermique (HER1 , HER2, HER3 et HER4). La dimérisation, à son tour, conduit à l'activation de diverses voies biologiques intracellulaires. HER2 est un oncogène qui est surexprimé dans une variété de cancers, y compris les cancers du sein, de l'ovaire, de l'estomac et de l'utérus. La surexpression de HER2 dans le cancer (cancer HER2-positif ou « cancer HER2+ ») est associée à un mauvais pronostic.
HER2 est notamment la cible du trastuzumab (Herceptin®), anticorps monoclonal qui lie le domaine IV du segment extracellulaire du récepteur HER2/neu. Le trastuzumab a été approuvé par la FDA en 1998 et a été utilisé pour le traitement du cancer du sein HER2+ et le cancer gastrique HER2+.
L'anticorps anti-HER2 selon l'invention peut donc être le trastuzumab. Cependant, le trastuzumab dans sa version classique n'est pas thérapeutiquement efficace dans un grand nombre de patients atteints de cancers HER2+. Ainsi, de préférence, l'anticorps anti-HER2 selon l'invention est le trastuzumab hautement galactosylé, optionnellement hautement fucosylé.
Le trastuzumab a pour chaîne lourde la séquence SEQ ID NO :65 suivante :
MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQA PGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
(SEQ ID NO: 65)
Et il a pour chaîne légère la séquence SEQ ID NO :66 suivante :
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWY QQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPP TFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO :66)
De préférence, l'anticorps anti-HER2 est présent sous forme d'une composition d'anticorps monoclonaux anti-HER2, de préférence sous forme d'une composition de trastuzumab, ladite composition comprenant des structures glycanniques sur les sites de glycosylation Fc (Asn 297 selon la numérotation EU) ayant une teneur en galactose de plus de 60%. La numérotation EU est généralement utilisée pour désigner un résidu dans une région constante de chaîne lourde d'immunoglobuline (voir la numérotation EU rapportée dans Kabat et al., Séquences of Proteins of Immunological Interest, 5e éd., Public Health Service, National Institutes of Health, Bethesda, MD (1991 )). La position typique du résidu glycosylé dans un anticorps est l'asparagine en position 297 (« Asn297 ») selon la numérotation EU. Il convient de noter que l'un des anticorps monoclonaux anti-HER2 décrits ici peut être partiellement ou totalement purifié.
Les anticorps anti-HER2 peuvent être glycosylés avec un N-glycane sur le site Asn297 de la chaîne lourde de la région Fc. Les anticorps comprenant généralement deux chaînes lourdes, ils possèdent jusqu'à deux N-glycanes sur la région Fc. Une variété de profils oligosaccharidiques a été observée à ce niveau et généralement, les oligosaccharides trouvés sur ce site incluent le galactose, la N-acétylglucosamine (GIcNAc), le mannose, l'acide sialique, l'acide N-acétylneuraminique (NeuAc ou NANA), l'acide N-glycolylneuraminique (NGNA) et le fucose. Les N-glycanes trouvés sur l'Asn297 ont généralement une structure de base commune consistant en une chaîne non ramifiée d'une première N-acétylglucosamine (GIcNAc), qui est fixée à l'asparagine de l'anticorps, une seconde GIcNAc qui est attachée à la première GIcNAc et un premier mannose qui est attaché à la seconde GIcNAc. Deux mannoses supplémentaires sont fixés au premier mannose de la chaîne GIcNAc-GIcNAc-mannose, pour compléter la structure du noyau (ou cœur pentasaccharidique) et fournir deux "bras" pour la glycosylation supplémentaire. En outre, les résidus de fucose peuvent être fixés à la première GIcNAc liée à l'Asn297.
La structure de base des deux bras est également désignée sous le nom d"'antenne". Le type le plus commun des motifs N-glycanes des anticorps présents dans le plasma est de type complexe, à savoir composé de plus d'un type de monosaccharide. Dans la voie biosynthétique pour ce motif N-glycane, plusieurs GIcNAc transférases fixent les résidus GIcNAc aux mannoses du noyau glycane, qui peut être allongé par le galactose, l'acide sialique et des résidus de fucose. Ce motif de glycosylation est appelée structure «complexe».
Un second motif de glycosylation qui se trouve sur les «bras» de la structure de base de N-glycane est un motif «high mannose», qui se caractérise par des mannoses supplémentaires (joints soit sous forme ramifiée ou sous forme non ramifiée).
Un troisième motif de glycosylation est une structure hybride dans laquelle l'un des bras est remplacé par le mannose tandis que l'autre bras est complexe. Un anticorps anti-HER2 "galactosylé", tel qu'utilisé ici, se réfère à tout anticorps anti-HER2 qui possède au moins un monosaccharide galactose dans l'un de ses N- glycanes. Les anticorps galactosylés comprennent des anticorps où les deux N-glycanes ont chacun des motifs de type complexe sur chacun des bras des motifs N-glycanes, des anticorps où les deux N-glycanes ont un motif du type complexe sur un seul bras des motifs N-glycanes, les anticorps qui ont un seul N-glycane avec des motifs de type complexe sur chacun des bras de la N-glycane, et des anticorps qui ont un seul N- glycane ayant un motif de type complexe sur un seul des bras des motifs N-glycanes. Des anticorps galactosylés, qui comprennent au moins un monosaccharide galactose, incluent les formes G1 (un galactose), G1 F (un galactose, un fucose), G2 (deux galactoses) et G2F (deux galactoses, un fucose). En outre, le N-glycane qui comprend au moins un monosaccharide galactose peut être sialylé ou non sialylé. Il faut en outre noter que les N-glycanes peuvent également contenir des résidus de galactose supplémentaires, tels que l'alpha-Gal, dans un ou plusieurs bras du motif glycannique complexe, entraînant potentiellement un N-glycane avec quatre groupements galactose.
Un anticorps anti-HER2 «hautement galactosylé», tel qu'utilisé ici, se réfère à un anticorps anti-HER2 qui comprend au moins deux monosaccharides galactose dans les motifs de N-glycane. Des anticorps hautement galactosylés comprennent des anticorps où les deux N-glycanes ont chacun des motifs de type complexe sur chacun des bras des motifs N-glycanes, des anticorps où les deux N-glycanes ont un motif du type complexe sur un seul bras des motifs N-glycanes, et des anticorps qui ont un N-glycane avec un motif du type complexe sur chacun des bras du N-glycane. Ainsi, les anticorps anti-HER2 hautement galactosylés selon l'invention correspondent aux formes dans lesquelles les N- glycanes comprennent chacun un galactose dans le motif glycane (par exemple G1 ou G1 F), dans lesquelles au moins un N-glycane comprend deux galactoses dans le motif glycane (par exemple G2 ou G2F) et dans lesquelles 3 ou 4 galactoses sont dans le motif glycane (par exemple: (i) un N-glycane avec un motif glycane G1 et un N-glycane avec un motif glycane G2 ou G2F, ou (ii) deux N-glycanes avec G2 ou G2F). Plus préférentiellement, l'anticorps anti-HER2 hautement galactosylé comprend au moins trois monosaccharides galactose dans les motifs glycanniques. Dans certains modes de réalisation, l'anticorps anti-HER2 hautement galactosylé comprend au moins quatre monosaccharides galactose dans les motifs glycanniques. La composition d'anticorps anti-HER2 hautement galactosylés selon l'invention comprend de préférence une population d'anticorps anti-HER2 (de préférence le trastuzumab) dans laquelle le degré de galactosylation des anticorps dans la population est au moins 60%, de préférence d'au moins 70%. De préférence, la composition d'anticorps anti-HER2 hautement galactosylés selon l'invention comprend une population d'anticorps anti-HER2 (de préférence le trastuzumab) hautement galactosylés dans laquelle le niveau de fucosylation est en outre d'au moins 50%, de préférence d'au moins 60%. De préférence, la composition d'anticorps anti-HER2 hautement galactosylés, optionnellement hautement fucosylés, selon l'invention est une composition de trastuzumab produite dans des cellules épitheliales mammaires d'un mammifère non humain, de préférence chez un mammifère transgénique non humain. Typiquement, le mammifère non humain est choisi parmi une chèvre, un mouton, bison, chameau, vache, porc, lapin, le buffle, le cheval, le rat, la souris et un lama. Plus particulièrement, le trastuzumab peut être produit par des chèvres transgéniques, plus spécifiquement produit dans le lait de chèvres transgéniques.
Un exemple de telles chèvres transgéniques est obtenu comme suit : des chèvres productrices de trastuzumab sont générées en utilisant des techniques traditionnelles de micro-injection (voir par exemple US 7,928,064). Les ADNc codant pour les chaînes lourde et légère (SEQ ID NO: 67 et SEQ ID NO: 68) ont été ligaturés avec le vecteur d'expression de la caséine bêta pour donner des constructions BC2601 HC et LC BC2602. Dans ces plasmides, la séquence d'acide nucléique codant pour le trastuzumab est sous le contrôle d'un promoteur facilitant l'expression du trastuzumab dans la glande mammaire des chèvres. Les séquences procaryotes sont éliminées et l'ADN est microinjecté dans des embryons de pré-implantation de la chèvre. Ces embryons ont ensuite été transférés à des pseudo-femelles gravides. La descendance qui a résulté a été criblée pour la présence des transgènes. Les descendants qui transportaient les deux chaînes ont été identifiés comme fondateurs transgéniques. Ensuite, à l'âge approprié, les fondateurs ont été élevés. À la suite de la grossesse et la parturition, ils ont subi des traites de lait. La composition de trastuzumab hautement galactosylée, et hautement fucosylée, a ainsi été purifiée à partir du lait. Avantageusement, il est fait référence à la production d'anticorps transgéniques anti-HER2 tels que décrits dans la demande de brevet publiée sous le numéro WO2014/125377 (« Anticorps anti-HER2 hautement galactosylés et leurs utilisations »). Les anticorps anti-CD303 et anti-HER2 selon l'invention peuvent, chacun indépendamment, être produits dans une cellule hôte, un animal non-humain transgénique ou une plante transgénique comprenant au moins un acide nucléique codant pour un tel anticorps, ses fragments ou dérivés, ou un vecteur contenant un tel acide nucléique.
De préférence, l'anticorps anti-CD303 et/ou l'anticorps anti-HER2 selon l'invention sont produits par transgénèse, notamment dans un animal non-humain transgénique ou une plante transgénique.
La cellule hôte peut être d'origine procaryote ou eucaryote, et peut notamment être choisie parmi les cellules bactériennes, les cellules d'insecte, de plantes, de levure ou de mammifères. L'anticorps selon l'invention peut alors être produit en cultivant la cellule hôte dans des conditions appropriées. Une cellule hôte selon l'invention peut notamment être obtenue par transformation d'une lignée cellulaire par le(s) vecteur(s) d'expression des chaînes lourde et légère d'un anticorps selon l'invention, et séparation des différents clones cellulaires obtenus. La lignée cellulaire transformée est de préférence d'origine eucaryote, et peut notamment être choisie parmi les cellules d'insecte, de plantes, de levure ou de mammifères. Des lignées cellulaires appropriées pour la production d'anticorps incluent notamment les lignées choisies parmi : SP2/0 ; YB2/0 ; IR983F ; le myélome humain Namalwa ; PERC6 ; les lignées CHO, notamment CHO-K-1 , CHO- Led O, CHO-Lec1 , CHO-Lec13, CHO Pro-5, CHO dhfr-, ou lignée CHO délétée pour les deux allèles codant pour le gène FUT8 et/ou le gène GMD ; Wil-2; Jurkat; Vero; Molt -4; COS-7; 293-HEK; BHK; K6H6; NSO; SP2/0-Ag 14, P3X63Ag8.653, lignée de cellule de canard embryonnaire EB66® (Valneva) ; les lignées d'hépatome de rat H4-II-E (DSM ACC3129), et H4-ll-Es (DSM ACC3130) (voir WO2012/041768), NM-H9D8 (DSM ACC2806), NM-H9D8-E6 (DSM ACC 2807), et NM H9D8-E6Q12 (DSM ACC 2856) (voir WO2008/028686).
Un animal non-humain transgénique selon l'invention peut être obtenu par injection directe du ou des gène(s) d'intérêt dans un œuf fertilisé (Gordon et al-1980). Un animal non-humain transgénique peut également être obtenu par introduction du ou des gène(s) d'intérêt dans une cellule souche embryonnaire et préparation de l'animal par une méthode d'agrégation de chimère ou une méthode d'injection de chimère (voir Manipulating the Mouse Embryo, A Laboratory Manual, Second édition, Cold Spring Harbor Laboratory Press (1994); Gene Targeting, A Practical Approach, IRL Press at Oxford University Press (1993)). Un animal non-humain transgénique peut également être obtenu par une technique de clonage dans laquelle un noyau, dans lequel le ou les gène(s) d'intérêt a été introduit, est transplanté dans un œuf énucléé (Ryan et al-1997; Cibelli et al-1998, WO00/26357). Un animal non humain transgénique produisant un anticorps d'intérêt peut être préparé par les méthodes ci-dessus. L'anticorps peut alors être accumulé dans l'animal transgénique et récolté, notamment à partir du lait ou des œufs de l'animal. Pour la production d'anticorps dans le lait d'animaux non humains transgéniques, des procédés de préparation sont notamment décrits dans WO90/04036, W095/17085, WO01/26455, WO2004/050847, WO2005/033281 , WO2007/048077. Des procédés de purification de protéines d'intérêt à partir du lait sont également connus (voir WO01/26455, WO2007/106078). Les animaux non humains transgéniques d'intérêt incluent notamment la souris, le lapin, le rat, la chèvre, les bovins (notamment la vache), et les volailles (notamment le poulet).
Une plante transgénique selon l'invention peut être choisie parmi toute plante permettant la production d'anticorps. De nombreux anticorps ont déjà été produits dans des plantes transgéniques et les technologies nécessaires à l'obtention d'une plante transgénique exprimant un anticorps d'intérêt et à la récupération de l'anticorps sont bien connues de l'homme du métier (voir Stoger et al-2002, Fisher et al-2003, Ma et al-2003, Schillberg et al-2005). Il est également possible d'influencer la glycosylation obtenue dans les plantes pour obtenir une glycosylation proche de celle des anticorps humains naturels (sans xylose), mais avec en outre une faible fucosylation, par exemple à l'aide de petits ARNs interférents (Forthal et al-2010).
L'anticorps anti-CD303 et l'anticorps anti-HER2 sont présents, selon l'invention, soit dans une composition pharmaceutique, soit comme produits de combinaison.
Ils peuvent donc être combinés avec des excipients pharmaceutiquement acceptables, et éventuellement des matrices à libération prolongée, comme des polymères biodégradables.
La composition pharmaceutique ou les produits de combinaison peut être administré par voie orale, sublinguale, sous-cutanée, intramusculaire, intraveineuse, intra- artérielle, intrathécale, intra-oculaire, intra-cérébrale, transdermique, pulmonaire, locale ou rectale. Les anticorps peuvent alors être administrés sous forme unitaire d'administration, en mélange avec des supports pharmaceutiques classiques. Des formes unitaires d'administration comprennent les formes par voie orale telles que les comprimés, les gélules, les poudres, les granules et les solutions ou suspensions orales, les formes d'administration sublinguale et buccale, les aérosols, les implants sous-cutanés, transdermique, topique, intrapéritonéale, intramusculaire, intraveineuse, sous-cutanée, intrathécale, les formes d'administration par voie intranasale et les formes d'administration rectale.
De préférence, la composition pharmaceutique ou les produits de combinaison contient un véhicule pharmaceutiquement acceptable pour une formulation susceptible d'être injectée. Il peut s'agir en particulier de formules isotoniques, stériles, de solutions salines (avec phosphate monosodique ou disodique, chlorure de sodium, de potassium, de calcium ou de magnésium et analogues, ou des mélanges de tels sels), ou de compositions lyophilisées, qui, lors de l'addition d'eau stérilisée ou de sérum physiologique selon les cas, permettent la constitution de solutés injectables.
Les formes pharmaceutiques appropriées pour une utilisation injectable comprennent des solutions aqueuses stériles ou des dispersions, des formulations huileuses, y compris l'huile de sésame, l'huile d'arachide, et des poudres stériles pour la préparation extemporanée de solutions injectables stériles ou de dispersions. Dans tous les cas, la forme doit être stérile et doit être fluide dans la mesure où elle doit être injectée par seringue. Elle doit être stable dans les conditions de fabrication et de stockage et doit être préservée des contaminations de micro-organismes, comme les bactéries et les champignons.
Les dispersions selon l'invention peuvent être préparées dans du glycérol, des polyéthylèneglycols liquides ou leurs mélanges, ou dans des huiles. Dans des conditions normales de stockage et d'utilisation, ces préparations contiennent un conservateur pour empêcher la croissance des micro-organismes.
Le véhicule pharmaceutiquement acceptable peut être un solvant ou milieu de dispersion contenant, par exemple, l'eau, l'éthanol, un polyol (par exemple, la glycérine, le propylène glycol, le polyéthylène glycol, et analogues), des mélanges appropriés de ceux- ci, et/ou les huiles végétales. La fluidité convenable peut être maintenue, par exemple, par l'utilisation d'un tensioactif, tel que la lécithine. La prévention de l'action de microorganismes peut être provoquée par divers agents antibactériens et antifongiques, par exemple, des parabènes, le chlorobutanol, le phénol, l'acide sorbique ou encore le thimérosal. Dans de nombreux cas, il sera préférable d'inclure des agents isotoniques, par exemple, des sucres ou du chlorure de sodium. L'absorption prolongée des compositions injectables peut être provoquée par l'utilisation dans les compositions d'agents retardant l'absorption, par exemple, le monostéarate d'aluminium ou la gélatine. Les solutions injectables stériles sont préparées en incorporant les substances actives en quantité requise dans le solvant approprié avec plusieurs des autres ingrédients énumérés ci-dessus, le cas échéant, suivie d'une stérilisation par filtration. En règle générale, les dispersions sont préparées en incorporant les divers ingrédients actifs stérilisés dans un véhicule stérile qui contient le milieu de dispersion basique et les autres ingrédients requis parmi ceux énumérés ci-dessus. Dans le cas de poudres stériles pour la préparation de solutions injectables stériles, les procédés de préparation préférés sont le séchage sous vide et la lyophilisation. Lors de la formulation, les solutions seront administrées d'une manière compatible avec la formulation posologique et en une quantité thérapeutiquement efficace. Les formulations sont facilement administrées dans une variété de formes galéniques, telles que les solutions injectables décrites ci-dessus, mais les capsules de libération de médicament et similaires peuvent également être utilisés. Pour l'administration parentérale dans une solution aqueuse par exemple, la solution doit être convenablement tamponnée et le diluant liquide rendu isotonique avec suffisamment de solution saline ou de glucose. Ces solutions aqueuses particulières conviennent particulièrement pour une administration intraveineuse, intramusculaire, sous-cutanée et intrapéritonéale. À cet égard, les milieux aqueux stériles qui peuvent être utilisés sont connus de l'homme de l'art. Par exemple, une dose peut être dissoute dans 1 ml de solution de NaCI isotonique puis ajoutée à 1000 ml de liquide approprié, ou injectée sur le site proposé de la perfusion. Certaines variations de posologie devront nécessairement se produire en fonction de l'état du sujet traité.
Le niveau de dose thérapeutiquement efficace spécifique pour un patient particulier dépendra d'une variété de facteurs, y compris le trouble qui est traité et la gravité de la maladie, l'activité du composé spécifique employé, la composition spécifique utilisée, l'âge, le poids corporel, la santé générale, le sexe et le régime alimentaire du patient, le moment de l'administration, la voie d'administration, le taux d'excrétion du composé spécifique utilisé, la durée du traitement, ou encore les médicaments utilisés en parallèle. L'invention est maintenant illustrée par les exemples suivants.
EXEMPLES :
Avantageusement dans le cadre de la présente invention, l'anticorps anti-CD303 utilisé est un anticorps chimérique ou humanisé comprenant les séquences CDRs 122A2. L'anticorps anti-HER2 utilisé de préférence ci-dessous est un anticorps trastuzumab produit dans le lait de chèvre transgénique, par exemple tel que décrit dans la demande WO2014/125377). Exemple 1 : Impact de l'élimination des pDC sur les activités ADCC et phagocytose de trastuzumab (Herceptin®)
1 .1 - Principe de l'étude
Les pDC sont responsables de la différenciation des T régulateurs (Moseman EA, 2004 ; Martin-Gayo E, 2010) entre autre par l'interaction ICOS/ICOSL, (Ito, T., 2007 ; Faget, J. 2012 ; Faget, J. 2013). Les T régulateurs ainsi différenciés exercent des mécanismes d'immunosuppression sur les fonctions des autres cellules du système immunitaire, notamment les cellules NK, via le contact cellule/cellule mais également via la sécrétion de cytokines immuno-modulatrices comme IL-10, IL-35 et TGF-β (Liu, C 2016).
Par effet cascade, il est ainsi possible d'étudier l'impact de l'élimination des pDC sur l'activité d'un agent anti-cancéreux spécifique d'une tumeur impliquant une activation des pDC in situ. Notamment, l'effet protecteur des anticorps anti-CD303 ciblant les pDC peut être démontré par l'étude corrélative de la diminution ou élimination des cytokines IL-10 et TGF-β dans l'environnement tumoral et son impact sur les fonctions effectrices d'un agent anti-cancéreux administré, spécifique de la tumeur (anticorps anti-HER2 tel qu 'Herceptin®). En effet, selon ce modèle, les anticorps anti-CD303 déplétant les pDC entraînent une limitation des effets immunosuppresseurs des T régulateurs et ainsi une limitation de leur sécrétion d'IL-10 et TGF-β. Cette limitation de sécrétion d'IL-10 et TGF-β est corrélée à une meilleure ADCC des cellules NK, validant l'effet stimulateur indirect des anticorps anti-CD303 sur l'action anti-cancéreuse des anticorps anti-HER-2.
1 .2- Effet de l'IL-10 et TGF-β sur l'activité ADCC de trastuzumab
Afin de tester l'ADCC du trastuzumab dans un contexte tumoral impliquant une activation des pDC d'une part ou en éliminant les pDC d'autre part, le protocole suivant est mis en place :
Des cellules effectrices NK transfectées avec CD16 (« NK-CD16 ») ont été cultivées à 3x105 cellules/ml dans un milieu de culture contenant de l'IL-2.
A J-1 , les cellules NK-CD16 ont été cultivées dans un milieu de culture sans IL-2, en absence ou en présence d'IL-10 (5, 50 ou 120 ng/ml) et de TGF-β (5, 50 ou 120 ng/ml). A JO, des cellules BT-474 (cellules tumorales de sein) (35000 cellules/puits) exprimant HER-2 sont incubées dans une plaque 96 puits à fond plat avec lesdites cellules NK- CD16, avec un ratio E/C (Effecteur - NK / Cible - BT-474) égal à 5/1 et 5000 ng/ml d'anticorps anti-Her2 (trastuzumab).
Après 16 heures d'incubation à 37°C, le surnageant est collecté.
Le contrôle négatif correspond au même protocole dans lequel le trastuzumab est remplacé par un anticorps chimérique anti anticorps anti-FVIII produit en YB2/0.
La lyse des cellules cibles induite par les anticorps anti-HER-2 est mesurée de façon chromogénique en quantifiant l'enzyme intracellulaire lactate déshydrogénase (LDH) relarguée dans le surnageant par les cellules cibles lysées (Roche Diagnostics - Cytotoxicity Détection Kit LDH).
Le pourcentage de lyse est calculé selon la formule suivante :
% lyse = [(ER - SR) / (100 - SR)] - [(NC - SR) / (100 - SR)]
Où ER et SR représentent respectivement les relargages expérimental (ER) et spontané (SR) de LDH, et NC représente la cytotoxicité naturelle des cellules NK.
Les résultats (% lyse) sont exprimés en pourcentage, 100% étant la valeur prise comme référence, obtenue avec les cellules NK-CD16 en présence de trastuzumab et en absence d'IL-10 et de TGF-β (i.e. Trastuzumab seul).
Les résultats d'ADCC sont détaillés dans le tableau 1 suivant :
Tableau 1 Ces résultats montrent que l'activité ADCC du trastuzumab est inhibée en présence d'IL- 10 et TGF-β comparé au contrôle sans ces cytokines.
Basée sur une valeur arbitraire de 100% pour trastuzumab seul, le pourcentage moyen d'ADCC est de 63% en présence d'IL-10 et de TGF-β à la concentration de 5000 ng/ml de trastuzumab.
Conclusion : Par effet cascade, la comparaison du pourcentage de lyse observable en l'absence de cytokines l'IL-10 et/ou TGF-β, avec le pourcentage de lyse observable en présence de ces mêmes cytokines, permet d'évaluer l'impact de la déplétion des pDC présents sur le site tumoral. Il est ainsi démontré que les anticorps anti-CD303 permettent de potentialiser indirectement l'effet des anticorps anti-cancéreux anti-HER2.
2- Effet de l'IL-10 et TGF- β sur la phagocytose induite par Trastuzumab
Les monocytes sont différenciés en macrophages CD16+ (M2 like) pendant 2 jours en RPMI 1640 + 10 % SVF + M-CSF 50 ng/ml pendant 48h.
Les cellules SKBR3 et les macrophages sont marqués avec PKH-67 (fluorescence verte) et PKH-26 (fluorescence rouge), respectivement.
Les cellules SKBR3 sont opsonisées avec 10 μg/ml de l'anticorps Trastuzumab ou avec un anticorps témoin puis incubées avec les macrophages (1 .105 de chaque cellules/puits) en absence ou en présence de différentes concentrations d'IL-10 (5, 50 ou 120 ng/ml) seule, de TGF-β (5, 50 ou 120 ng/ml) seul et d'IL-10 + TGF-β.
Après 3h d'incubation à 37°C, les cellules sont placées sur une cellule de comptage (Mallassez) et observées avec un microscope à fluorescence.
Le pourcentage de phagocytose est évalué en comptant le nombre de macrophages (au moins 100 macrophages) contenant des cellules SKBR3.
Conclusion : Par effet cascade, la comparaison du pourcentage de phagocytose observable en l'absence de cytokines l'IL-10 et/ou TGF-β, avec le pourcentage de lyse observable en présence de ces mêmes cytokines, permet d'évaluer l'impact de la déplétion des pDC présents sur le site tumoral. Il peut ainsi être démontré que les anticorps anti-CD303 permettent de potentialiser indirectement l'effet des anticorps anticancéreux anti-HER2.
Exemple 2 - Effet d'un anticorps anti-CD303 sur l'activation des cellules T régulatrices (Treq) 2.1 - Rôle de l'anti-CD303 sur le phénotvpe et l'expansion des Treq en PBMC
Les cellules mononucléées (PBMC) sont isolées à partir d'un tube de sang prélevé sur anti-coagulant. Les PBMC ne contiennent pas de pDC. Les cellules Treg sont identifiées et phénotypiquement caractérisées par cytométrie en flux sur la base de 3 marqueurs : CD4, CD25 et Fox-P3.
Différentes quantités de l'anticorps anti-CD303 (de 1 ng à 10 μg/ml) sont ajoutées aux PBMC en présence d'IL-2 (500 U/ml). Le nombre de Treg et leur phénotype est suivi au cours du temps (1 à 4 jours).
Dans les mêmes conditions, des billes coatées avec anti-CD3 / anti-CD28 pour stimuler la prolifération T sont ajoutées dans un ratio Treg / billes de 4 / 1 pour vérifier l'activation des Treg.
Conclusion : Il peut ainsi être démontré que les anticorps anti-CD303, en l'absence de pDC, n'ont pas d'impact direct sur l'expansion et le phénotype immunosuppresseur des T régulateurs.
2.2- Rôle de l'anti-CD303 sur le phénotvpe et l'expansion de Treq purifiés en présence de pDC
Les cellules Treg (CD4+, CD25+) sont purifiées à partir de PBMC grâce à un procédé en 2 étapes : déplétion des cellules CD4 négatives (cellules positives pour les marqueurs CD8, CD14, CD15, CD16, CD19, CD36, CD56, CD123, TCRy/δ, et CD235a) puis sélection positive des cellules CD25+.
Des pDC purifiées ou des lignées pDC, e.g. obtenues selon le procédé décrit dans Maeda T et al., Int J Hematol. 2005 Feb ; 81 (2) :148-54 (telle que la lignée CAL-1 ou une nouvelle lignée générée par retransfection de CD303 dans Cal-1 et sélection d'une lignée exprimant stablement plus de 40 000 sites antigéniques CD303 par cellule, de préférence entre 40 000 et 50 000) sont ajoutées dans un ratio Treg / pDC de 100, 10 et 1 . Différentes quantités de l'anticorps anti-CD303 (de 1 ng à 10 μg/ml) sont ajoutées au mélange Treg / pDC en présence d'IL-2 (500 U/ml). Le nombre de Treg et leur phénotype est suivi au cours du temps (1 à 4 jours).
Dans les mêmes conditions, des billes coatées avec anti-CD3 / anti-CD28 pour stimuler la prolifération T sont ajoutées dans un ratio Treg / billes de 4 /1 pour vérifier l'activation des Treg. Un témoin négatif en absence de pDC est établi, de façon à vérifier l'impact (attendu neutre) de l'anti-CD303 directement sur les Treg.
Conclusion : L'observation sur plusieurs jours de l'expansion et de la différenciation des Treg purifiés en présence de pDC, après administration d'anticorps anti-CD303 peut permettre de montrer que l'administration d'anti-CD303 est efficace pour diminuer ou supprimer les propriétés immunosuppressives des pDC.
Exemple 3 : Déplétion des pDCs humaines via un anticorps anti-CD303 in vivo dans le traitement du cancer du sein
3.1 -Génération d'un modèle d'étude reproductif d'une situation pathologique chez l'homme
Afin d'étudier l'effet d'un anticorps anti-CD303 dans le traitement du cancer du sein, le modèle murin 'humanized tumor mouse model' (HTM) peut être utilisé. Il est caractérisé par le développement d'un système immunitaire mature humain et la croissance de cellules de cancers du sein humaines qui ont été au préalable co-transplantées avec les cellules souches hématopoïétiques humaines. Très récemment, l'efficacité du traitement par Trastuzumab/Herceptin a été prouvée dans ce modèle (Wege AK et al, Oncotarget 2017, 8(2): 2731 -2744).
Ce modèle permet avantageusement de réunir plusieurs éléments pertinents pour la reproductibilité des conditions in vivo : présence de pDCs humaines qui seules expriment à leur surface la cible CD303, présence d'infiltration de cellules Treg humaines, présence de cellules tumorales humaines exprimant à leur surface HER2, molécule ciblée par trastuzumab/Herceptin® et un hôte murin immunocompétent (cellules effectrices de type NK pour l'activité ADCC). Le modèle décrit précédemment dans l'article Wege et al (Int. J. Cancer 201 1 , 129: 2194-2206) réunit toutes ces caractéristiques.
Ce modèle a été adapté pour le rendre compatible avec les souris BRGSF™ ou BRGSF™-A2 (BALB/c, Rag2tm1 Fwa, IL-2Ryctm1 Cgn, SIRPocNOD, Flk2tm1 lrl, Tg(HLA- A/H2-D/B2M)1 Bpe) caractérisées par l'absence de cellules murines T, B, et NK, et exprimant uniquement le HLA de classe 1 humain HLA-A2.1 . Lesdites souris BRGSF™ peuvent être générées selon la procédure décrite par Legrand N, Huntington ND, Nagasawa M et al. (Functional CD47/signal regulatory protein alpha (SIRP(alpha)) interaction is required for optimal human T- and natural killer- (NK) cell homeostasis in vivo. Proc.Natl.Acad.Sci.U.S.A 201 1 ;108: 13224-13229). Elles acquièrent le génotype(HLA-A/H2-D/B2M)1 Bpe par transgenèse. (Pascolo, S., N. Bervas, J.M. Ure, A.G. Smith, F. A. Lemonnier, and B. Perarnau. 1997. HLA-A2.1 -restricted éducation and cytolytic activity of CD8(+) T lymphocytes from beta2 microglobulin (beta2m) HLA-A2.1 monochain transgenic H-2Db beta2m double knockout mice. J Exp Med 185:2043-2051 ).
3.2 - Méthode pouvant être utilisée pour tester l'activité de l'anticorps anti-CD303
Brièvement, les souris nouveau-nées issues de la lignée de souris immunodéficientes BRGSF™-A2 (BALB/c Rag2tm1 Fwa IL-2Ryc tm1 C9n SIRPocNOD Flk2tm1 lrl Tg(HLA-A/H2- D/B2M)1 Bpe sont irradiées (3 Gy) au cours de leurs 192 premières heures de vie. Vingt- quatre heures plus tard, elles sont transplantées par injection intra-hépatique avec 1 x105 cellules CD34+ humaines isolées à partir de sang de cordon ombilical (CB) en présence, ou non, de cellules tumorales 3x106 BT474-Luc (exprimant la luciférase pour un suivi en bioluminescence). Les cellules BT474 sont des cellules d'origine humaine issues d'un carcinome du sein exprimant à leur surface le récepteur HER2/Neu, la cible de l'anticorps Trastuzumab. Dans le cadre de ce modèle particulier, les cellules BT474 ont été, avant leur administration, modifiées par transduction lentivirale dans le but de les rendre luminescentes grâce à l'expression constitutive de la luciférase. Cette modification permet un contrôle transversal au cours du temps de la prise des tumeurs grâce à l'analyse de la bioluminescence tout en ne sacrifiant pas des animaux et ainsi ajuster au mieux la fenêtre de début de traitement. Onze à douze semaines après la co-administration des cellules humaines, les souris sont testées pour leur degré d'humanisation par analyse de la composition de cellules présentes dans leur sang (humaines et murines) par cytométrie en flux puis réparties au sein de cinq groupes différents (cf. tableau 2 ci-dessous) : un groupe contrôle sans injection de cellules BT474 traité avec un anticorps isotype (i.e. un anticorps anti-anticorps anti-Facteur VIII) (ce groupe sert de contrôle négatif à la prise de tumeurs, groupe 1 ), un groupe contrôle avec injection de cellules BT474 traité avec un anticorps isotype (i.e. un anticorps anti-anticorps anti-Facteur VIII) (groupe 2), un groupe traité avec le trastuzumab transgénique (TTG) (groupe 3), un groupe traité avec l'anticorps anti-CD303 (groupe 4) et un groupe traité avec la combinaison de traitements anticorps anti-CD303 et TTG (groupe 5). Les doses utilisées ainsi que les fréquences de traitement sont indiquées dans le tableau 2 ci-dessous :
Le traitement débute 14 semaines après l'humanisation (i.e. injection des cellules CD34+ humaines isolées à partir de sang de cordon ombilical (CB) en présence, ou non, de cellules tumorales 3x106 BT474-Luc) et dure 19 semaines.
Le traitement consiste en l'injection des produits testés par voie intraveineuse à une dose de 30 mg/kg de poids corporel dans le cas de l'anticorps anti-CD303 tous les 3 jours et une fois par semaine à 10 mg/kg de poids corporel dans le cas de l'anticorps TTG. Le poids corporel des souris est déterminé 3 jours avant le début du traitement pour ajuster la dose individuellement.
Des prélèvements fréquents de sang sont réalisés pour tester l'efficacité de déplétion de pDCs humaines par cytométrie en flux. De plus, une analyse réalisée dès le début du traitement puis toutes les deux semaines par bioluminescence est réalisée pour comparer l'efficacité des différents produits testés. Enfin, une analyse des tumeurs de trois animaux par groupe à la semaine 18 après l'humanisation est réalisée par cytométrie en flux pour vérifier la présence ou l'absence des pDCs humaines infiltrantes dans les tumeurs. Résultats :
- L'impact du traitement sur la sous-population pDC humaine ainsi que les autres populations de cellules lymphoïdes (lymphocytes B, lymphocytes T ...) présentes dans le sang et la rate a été déterminé par cytométrie en flux à différents temps: j1 , j3 et j7. Les résultats montrent que le traitement par l'anticorps anti-CD303 à une dose de 30 mg/kg chez des souris BRGSF-HIS humanisées induit la déplétion des pDC humaines pendant au moins 7 jours dans le sang et la rate. Dans le sang, l'activité de déplétion des pDC humaines est rapide (> 80% le jour 1 ) et plus tardive dans la rate. Dans le sang et la rate, la déplétion des pDC humaines était toujours efficace (> 90%) le jour 7, c'est-à-dire 3 jours après la dernière injection de l'anticorps monoclonal anti-CD303. Il est à noter que l'activité de déplétion de l'anticorps anti-CD303 est très spécifique puisqu'elle n'affecte pas significativement les autres sous-populations de cellules hématopoïétiques humaines dans les organes testés.
- De plus, il est à noter que ce modèle s'avère être un modèle particulièrement adapté à l'étude de l'invention puisque la recherche de pDC dans les tumeurs de souris sacrifiées montre pour la première fois la présence de pDC infiltrant ces tumeurs (cf. figure 1 qui montre le pourcentage de pDC humaines dans le foie - site tumoral -, pour le contrôle négatif (souris non injectées avec des cellules BT474) (CT), et pour les souris injectées avec des cellules BT474 (BT474)).
Conclusion :
Le modèle murin HTM adapté peut être avantageusement utilisé pour évaluer l'effet indirect de l'administration d'un anticorps anti-CD303 sur l'effet de l'agent anti-tumeur de sein, l'anticorps anti-HER2 (trastuzumab), dans des conditions reproduisant une situation physiologique in vivo, en comparant notamment les résultats obtenus avec les différents groupes testés.
Ce modèle est ainsi utile pour pouvoir évaluer le bénéfice, avantageusement l'effet synergique, d'administrer un anticorps anti-CD303 en combinaison à l'administration d'un anticorps anti-HER2 dans une tumeur de sein.

Claims

REVENDICATIONS
1 . Composition pharmaceutique comprenant, dans un véhicule pharmaceutiquement acceptable :
a. au moins un anticorps anti-CD303; et
b. au moins un anticorps anti-HER2.
2. Produits contenant :
a. au moins un anticorps anti-CD303; et
b. au moins un anticorps anti-HER2,
comme produits de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif.
3. Composition pharmaceutique selon la revendication 1 ou produits selon la revendication 2, dans lequel les anticorps a) et b) sont choisis parmi les anticorps murins, les anticorps chimériques, les anticorps humanisés et les anticorps humains.
4. Composition pharmaceutique selon la revendication 1 ou 3, ou produits selon la revendication 2 ou 3, dans lequel l'anticorps anti-CD303 est un anticorps monoclonal dirigé contre l'ectodomaine de l'antigène CD303 humain.
5. Composition pharmaceutique selon la revendication 1 , 3 ou 4, ou produits selon l'une des revendications 2 à 4, dans lequel l'anticorps anti-CD303 comprend les CDRs suivants :
CDR1 -H-IMGT-122A2 GYTFTDYS (SEQ ID NO : 13)
CDR2-H-IMGT-122A2 ISTYYGDS (SEQ ID NO : 14)
CDR3-H-IMGT-122A2 ARNGNFYVMDY (SEQ ID NO : 15)
CDR1 -L-IMGT-122A2 QDISNY (SEQ ID NO : 16)
CDR2-L-IMGT-122A2 YTS (SEQ ID NO : 17)
CDR3-L-IMGT-122A2 QQGNTLPWT (SEQ ID NO : 18) ou bien CDR2-H-IMGT-102E9 INTETGEP (SEQ ID NO : 20)
CDR3-H-IMGT-102E9 TRNGYYVGYYAMDY (SEQ ID NO : 21 )
CDR1 -L-IMGT-102E9 SSVIY (SEQ ID NO : 22)
CDR2-L-IMGT-102E9 STS (SEQ ID NO : 23)
CDR3-L-IMGT-102E9 QQRRSYPFT (SEQ ID NO : 24) ou bien
CDR1 -H-IMGT-104C12 GYTFTDYS (SEQ ID NO : 25)
CDR2-H-IMGT-104C12 ISPYYGDT (SEQ ID NO : 26)
CDR3-H-IMGT-104C12 ARNDDYYRFAY (SEQ ID NO : 27)
CDR1 -L-IMGT-104C12 QDINNY (SEQ ID NO : 28)
CDR2-L-IMGT-104C12 YTS (SEQ ID NO : 29)
CDR3-L-IMGT-104C12 QQGKTLPWT (SEQ ID NO : 30) ou bien
CDR1 -H-IMGT-1 14D1 1 GYTFTDSS (SEQ ID NO : 31 )
CDR2-H-IMGT-1 14D1 1 INTETGGP (SEQ ID NO : 32)
CDR3-H-IMGT-1 14D1 1 ARNGYYVGYYALDY (SEQ ID NO : 33)
CDR1 -L-IMGT-1 14D1 1 SSVFY (SEQ ID NO : 34)
CDR2-L-IMGT-1 14D1 1 STS (SEQ ID NO : 35)
CDR3-L-IMGT-1 14D1 1 QQRRSYPYT (SEQ ID NO : 36) ou bien
CDR1 -H-IMGT-104E10 GYTFTDYS (SEQ ID NO : 37)
CDR2-H-IMGT-104E10 INTETGEP (SEQ ID NO : 38)
CDR3-H-IMGT-104E10 ARNGYYVGYYAMDY (SEQ ID NO : 39)
CDR1 -L-IMGT-104E10 SSVIY (SEQ ID NO : 40)
CDR2-L-IMGT-104E10 STS (SEQ ID NO : 41 )
CDR3-L-IMGT-104E10 QQRRSYPYT (SEQ ID NO : 42)
Composition pharmaceutique selon l'une des revendications 1 ou 3 à 5, ou produits selon l'une des revendications 2 à 5, dans lequel l'anticorps anti-HER2 est une composition de trastuzumab, ladite composition comprenant des structures glycanniques sur les sites de glycosylation Fc ayant une teneur en galactose de plus de 60%, de préférence d'au moins 70%.
7. Composition pharmaceutique selon l'une des revendications 1 ou 3 à 6, ou produits selon l'une des revendications 2 à 6, dans lequel l'anticorps anti-HER2 est une composition de trastuzumab, ladite composition comprenant des structures glycanniques sur les sites de glycosylation Fc ayant un niveau de fucosylation d'au moins 50%, de préférence d'au moins 60%.
8. Composition pharmaceutique selon l'une des revendications 1 ou 3 à 7, ou produits selon l'une des revendications 2 à 7, dans lequel l'anticorps anti-HER2 est le trastuzumab produit dans le lait de chèvres transgéniques.
9. Composition pharmaceutique selon l'une des revendications 1 ou 3 à 8, ou produits selon l'une des revendications 2 à 8, dans lequel l'anticorps anti-CD303 et/ou l'anticorps anti-HER2 est choisi parmi les Fab, F(ab)'2, Fd, scFv et les multimères de scFv.
10. Composition pharmaceutique selon l'une des revendications 1 ou 3 à 9, ou produits selon l'une des revendications 2 à 9, pour son utilisation dans la prévention ou le traitement d'un cancer HER2-positif choisi parmi le cancer de l'utérus, le cancer de l'ovaire, le cancer du sein et le cancer de l'estomac.
1 1 . Composition pharmaceutique selon l'une des revendications 1 ou 3 à 9, ou produits selon l'une des revendications 2 à 9, pour son utilisation dans la prévention ou le traitement du cancer du sein HER2-positif.
EP17826467.7A 2016-12-16 2017-12-15 Combinaison d'anticorps anti-cd303 et anti-her2 Withdrawn EP3555133A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR1662603A FR3060395B1 (fr) 2016-12-16 2016-12-16 Combinaison d'anticorps anti-cd303 et anti-her2
PCT/EP2017/083157 WO2018109210A1 (fr) 2016-12-16 2017-12-15 Combinaison d'anticorps anti-cd303 et anti-her2

Publications (1)

Publication Number Publication Date
EP3555133A1 true EP3555133A1 (fr) 2019-10-23

Family

ID=58401748

Family Applications (1)

Application Number Title Priority Date Filing Date
EP17826467.7A Withdrawn EP3555133A1 (fr) 2016-12-16 2017-12-15 Combinaison d'anticorps anti-cd303 et anti-her2

Country Status (4)

Country Link
US (1) US20190330369A1 (fr)
EP (1) EP3555133A1 (fr)
FR (1) FR3060395B1 (fr)
WO (1) WO2018109210A1 (fr)

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US5843705A (en) 1995-02-21 1998-12-01 Genzyme Transgenic Corporation Transgenically produced antithrombin III
JP4523165B2 (ja) 1998-11-02 2010-08-11 トラスティーズ オブ タフツ カレッジ トランスジェニックおよびクローン哺乳動物
KR100772465B1 (ko) 1999-10-14 2007-11-02 지티씨바이오쎄라퓨틱스,인크. 트랜스제닉 동물 내에서 표적 분자를 생성시키는 방법, 및그 표적 분자를 정제하는 방법
ES2280264T3 (es) * 1999-11-15 2007-09-16 Miltenyi Biotec Gmbh Fragmentos de union a antigeno especificos de celulas dendriticas, composiciones y metodos de uso de los mismos, antigenos reconocidos y celulas asi obtenidas.
WO2004050847A2 (fr) 2002-11-27 2004-06-17 Gtc Biotherapeutics, Inc. Production stable d'anticorps modifies dans le lait, et procedes de production
CA2540854A1 (fr) 2003-09-30 2005-04-14 Sterrenbeld Biotechnologie North America, Inc. Procede permettant de creer des mammiferes transgeniques produisant des proteines exogenes dans le lait et mammiferes transgeniques ainsi crees
CN101484470B (zh) 2005-10-21 2014-07-23 阿伊沃生物制剂有限公司 具有增强的抗体依赖性细胞毒性活性的抗体及其生产方法和用途
US7531632B2 (en) 2006-02-16 2009-05-12 Gtc Biotherapeutics, Inc. Clarification of transgenic milk using depth filtration
KR101603632B1 (ko) 2006-09-10 2016-03-16 글리코토페 게엠베하 항체 발현을 위한 골수성 백혈병 기원의 인간 세포의 용도
US20120258496A1 (en) 2010-09-27 2012-10-11 Boehringer Ingelheim International Gmbh Production of low fucose antibodies in h4-ii-e rat cells
CA2900912A1 (fr) * 2013-02-13 2014-08-21 Laboratoire Francais Du Fractionnement Et Des Biotechnologies Anticorps anti-her2 hautement galactosyles et leurs utilisations
CN106029874B (zh) * 2013-12-16 2020-09-15 北卡罗来纳-查佩尔山大学 浆细胞样树突状细胞的耗竭
FR3034420A1 (fr) * 2015-03-31 2016-10-07 Lab Francais Du Fractionnement Anticorps monoclonaux anti-cd303

Also Published As

Publication number Publication date
FR3060395A1 (fr) 2018-06-22
WO2018109210A1 (fr) 2018-06-21
FR3060395B1 (fr) 2019-05-24
US20190330369A1 (en) 2019-10-31

Similar Documents

Publication Publication Date Title
JP2022116257A (ja) 癌の治療に用いるための細胞傷害誘導治療剤
TW201920239A (zh) 介白素-21突變蛋白及治療方法
TW202023625A (zh) 抗tigit抗體
BR112020023844A2 (pt) Anticorpos, métodos de tratamento do câncer e de produção de um anticorpo, ácido nucleico, vetor, células hospedeiras e composição farmacêutica
CN107252485A (zh) 用于诱导对疾病的免疫应答的组合疗法
WO2005053742A1 (fr) Medicament contenant une composition a base d'anticorps
TW201707724A (zh) 反應b7-h3之抗體、其免疫活性片段及使用
TW201938200A (zh) 抗mct1抗體及其用途
JP2010525037A (ja) 悪性病変、自己免疫性疾患、あるいは感染性疾患を治療するための部品キット
EP2651978B1 (fr) Utilisation d'un anticorps dirige contre une proteine membranaire
AU2017388346A1 (en) Antibody capable of binding to myelin oligodendrocyte glycoprotein
FR2906533A1 (fr) Procede de generation d'anticorps actifs contre un antigene de resistance,anticorps obtenus par ledit procede et leurs utilisations
EP3816290A1 (fr) Anticorps se liant à la molécule d'adhésion cellulaire 3
TW202012445A (zh) 與硫酸軟骨蛋白多醣-5結合之抗體
US20230414778A1 (en) COMBINATION OF ANTIBODY-DRUG CONJUGATE WITH ANTI-SIRPalpha ANTIBODY
WO2018109210A1 (fr) Combinaison d'anticorps anti-cd303 et anti-her2
EP3390452B1 (fr) Nouvelle utilisation d'un anticorps dirige contre la proteine membranaire cd303
WO2018109209A1 (fr) Combinaison d'anticorps anti-cd303 et anti-amhrii
CN114651011A (zh) 靶向cd43的独特癌相关表位的单克隆抗体
TW202408584A (zh) 抗體-藥物結合物與抗SIRPα抗體之組合
CA2542508A1 (fr) Igg3 anti rhesus-d dans la lignee yb2/0 ayant une forte activite en phagocytose
KR20220079858A (ko) 오비누투주맙 내성 cd20 양성 암의 세포의 증식을 억제하는 제, 및 그에 관련된 의약 조성물, 의약, 제조, 세포의 증식을 억제하는 방법, 치료 방법, ii형 항cd20 항체, 화합물, 그들의 조합, 증강제 및 유도제
TW202216193A (zh) 包含抗CD19抗體及阻斷SIRPα-CD47先天免疫檢查點之多肽之抗腫瘤組合療法
CA2542928A1 (fr) Utilisation de cations metalliques pour cristalliser le fragment fc d'un anticorps rhesus d
JPWO2012133914A1 (ja) Ｒａｎｋｌアンタゴニストを含む癌免疫増強剤

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20190614

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20200612

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20220710