EP3146563A1 - Commutation cell - Google Patents

Commutation cell

Info

Publication number
EP3146563A1
EP3146563A1 EP15718847.5A EP15718847A EP3146563A1 EP 3146563 A1 EP3146563 A1 EP 3146563A1 EP 15718847 A EP15718847 A EP 15718847A EP 3146563 A1 EP3146563 A1 EP 3146563A1
Authority
EP
European Patent Office
Prior art keywords
commutation cell
semiconductor switch
controllable semiconductor
circuit carrier
circuit
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP15718847.5A
Other languages
German (de)
French (fr)
Inventor
Walter Daves
Knut Alexander KASPER
Silvia DUERNSTEINER
Martin Rittner
Michael Guenther
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Robert Bosch GmbH
Original Assignee
Robert Bosch GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Robert Bosch GmbH filed Critical Robert Bosch GmbH
Publication of EP3146563A1 publication Critical patent/EP3146563A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L25/00—Assemblies consisting of a plurality of individual semiconductor or other solid state devices ; Multistep manufacturing processes thereof
    • H01L25/16—Assemblies consisting of a plurality of individual semiconductor or other solid state devices ; Multistep manufacturing processes thereof the devices being of types provided for in two or more different main groups of groups H01L27/00 - H01L33/00, or in a single subclass of H10K, H10N, e.g. forming hybrid circuits
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L23/00—Details of semiconductor or other solid state devices
    • H01L23/48—Arrangements for conducting electric current to or from the solid state body in operation, e.g. leads, terminal arrangements ; Selection of materials therefor
    • H01L23/488—Arrangements for conducting electric current to or from the solid state body in operation, e.g. leads, terminal arrangements ; Selection of materials therefor consisting of soldered or bonded constructions
    • H01L23/498—Leads, i.e. metallisations or lead-frames on insulating substrates, e.g. chip carriers
    • H01L23/49833—Leads, i.e. metallisations or lead-frames on insulating substrates, e.g. chip carriers the chip support structure consisting of a plurality of insulating substrates
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L23/00—Details of semiconductor or other solid state devices
    • H01L23/48—Arrangements for conducting electric current to or from the solid state body in operation, e.g. leads, terminal arrangements ; Selection of materials therefor
    • H01L23/488—Arrangements for conducting electric current to or from the solid state body in operation, e.g. leads, terminal arrangements ; Selection of materials therefor consisting of soldered or bonded constructions
    • H01L23/498—Leads, i.e. metallisations or lead-frames on insulating substrates, e.g. chip carriers
    • H01L23/49838—Geometry or layout
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L24/00—Arrangements for connecting or disconnecting semiconductor or solid-state bodies; Methods or apparatus related thereto
    • H01L24/01—Means for bonding being attached to, or being formed on, the surface to be connected, e.g. chip-to-package, die-attach, "first-level" interconnects; Manufacturing methods related thereto
    • H01L24/26—Layer connectors, e.g. plate connectors, solder or adhesive layers; Manufacturing methods related thereto
    • H01L24/31—Structure, shape, material or disposition of the layer connectors after the connecting process
    • H01L24/33—Structure, shape, material or disposition of the layer connectors after the connecting process of a plurality of layer connectors
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L24/00—Arrangements for connecting or disconnecting semiconductor or solid-state bodies; Methods or apparatus related thereto
    • H01L24/80—Methods for connecting semiconductor or other solid state bodies using means for bonding being attached to, or being formed on, the surface to be connected
    • H01L24/83—Methods for connecting semiconductor or other solid state bodies using means for bonding being attached to, or being formed on, the surface to be connected using a layer connector
    • H—ELECTRICITY
    • H03—ELECTRONIC CIRCUITRY
    • H03K—PULSE TECHNIQUE
    • H03K17/00—Electronic switching or gating, i.e. not by contact-making and –breaking
    • H03K17/51—Electronic switching or gating, i.e. not by contact-making and –breaking characterised by the components used
    • H03K17/56—Electronic switching or gating, i.e. not by contact-making and –breaking characterised by the components used by the use, as active elements, of semiconductor devices
    • H03K17/567—Circuits characterised by the use of more than one type of semiconductor device, e.g. BIMOS, composite devices such as IGBT
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L2224/00—Indexing scheme for arrangements for connecting or disconnecting semiconductor or solid-state bodies and methods related thereto as covered by H01L24/00
    • H01L2224/01—Means for bonding being attached to, or being formed on, the surface to be connected, e.g. chip-to-package, die-attach, "first-level" interconnects; Manufacturing methods related thereto
    • H01L2224/26—Layer connectors, e.g. plate connectors, solder or adhesive layers; Manufacturing methods related thereto
    • H01L2224/28—Structure, shape, material or disposition of the layer connectors prior to the connecting process
    • H01L2224/29—Structure, shape, material or disposition of the layer connectors prior to the connecting process of an individual layer connector
    • H01L2224/29001—Core members of the layer connector
    • H01L2224/29099—Material
    • H01L2224/291—Material with a principal constituent of the material being a metal or a metalloid, e.g. boron [B], silicon [Si], germanium [Ge], arsenic [As], antimony [Sb], tellurium [Te] and polonium [Po], and alloys thereof
    • H01L2224/29138—Material with a principal constituent of the material being a metal or a metalloid, e.g. boron [B], silicon [Si], germanium [Ge], arsenic [As], antimony [Sb], tellurium [Te] and polonium [Po], and alloys thereof the principal constituent melting at a temperature of greater than or equal to 950°C and less than 1550°C
    • H01L2224/29139—Silver [Ag] as principal constituent
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L2224/00—Indexing scheme for arrangements for connecting or disconnecting semiconductor or solid-state bodies and methods related thereto as covered by H01L24/00
    • H01L2224/01—Means for bonding being attached to, or being formed on, the surface to be connected, e.g. chip-to-package, die-attach, "first-level" interconnects; Manufacturing methods related thereto
    • H01L2224/26—Layer connectors, e.g. plate connectors, solder or adhesive layers; Manufacturing methods related thereto
    • H01L2224/31—Structure, shape, material or disposition of the layer connectors after the connecting process
    • H01L2224/32—Structure, shape, material or disposition of the layer connectors after the connecting process of an individual layer connector
    • H01L2224/321—Disposition
    • H01L2224/32151—Disposition the layer connector connecting between a semiconductor or solid-state body and an item not being a semiconductor or solid-state body, e.g. chip-to-substrate, chip-to-passive
    • H01L2224/32221—Disposition the layer connector connecting between a semiconductor or solid-state body and an item not being a semiconductor or solid-state body, e.g. chip-to-substrate, chip-to-passive the body and the item being stacked
    • H01L2224/32225—Disposition the layer connector connecting between a semiconductor or solid-state body and an item not being a semiconductor or solid-state body, e.g. chip-to-substrate, chip-to-passive the body and the item being stacked the item being non-metallic, e.g. insulating substrate with or without metallisation
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L2224/00—Indexing scheme for arrangements for connecting or disconnecting semiconductor or solid-state bodies and methods related thereto as covered by H01L24/00
    • H01L2224/01—Means for bonding being attached to, or being formed on, the surface to be connected, e.g. chip-to-package, die-attach, "first-level" interconnects; Manufacturing methods related thereto
    • H01L2224/26—Layer connectors, e.g. plate connectors, solder or adhesive layers; Manufacturing methods related thereto
    • H01L2224/31—Structure, shape, material or disposition of the layer connectors after the connecting process
    • H01L2224/33—Structure, shape, material or disposition of the layer connectors after the connecting process of a plurality of layer connectors
    • H01L2224/331—Disposition
    • H01L2224/3318—Disposition being disposed on at least two different sides of the body, e.g. dual array
    • H01L2224/33181—On opposite sides of the body
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L2224/00—Indexing scheme for arrangements for connecting or disconnecting semiconductor or solid-state bodies and methods related thereto as covered by H01L24/00
    • H01L2224/80—Methods for connecting semiconductor or other solid state bodies using means for bonding being attached to, or being formed on, the surface to be connected
    • H01L2224/83—Methods for connecting semiconductor or other solid state bodies using means for bonding being attached to, or being formed on, the surface to be connected using a layer connector
    • H01L2224/838—Bonding techniques
    • H01L2224/8384—Sintering
    • H—ELECTRICITY
    • H01—ELECTRIC ELEMENTS
    • H01L—SEMICONDUCTOR DEVICES NOT COVERED BY CLASS H10
    • H01L2924/00—Indexing scheme for arrangements or methods for connecting or disconnecting semiconductor or solid-state bodies as covered by H01L24/00
    • H01L2924/0001—Technical content checked by a classifier
    • H01L2924/0002—Not covered by any one of groups H01L24/00, H01L24/00 and H01L2224/00

Definitions

  • Commutation cells are known as parts of electrical circuits, such as those used in washing machines, blower fans, electric
  • FIG. 1 shows an exemplary embodiment of a conventional one
  • Commutation cell 1 in which a current change initiated by a switching process can take place.
  • the commutation cell 1 comprises a controllable semiconductor switch 2 and one in series with the controllable
  • Inductors are generated by the respective configuration of the electrical components and the respective construction and connection technology of the commutation cell 1.
  • Conventional commutation cells are usually constructed of electrical components which, for example in the arrangement shown in FIG. 1, are arranged next to one another on a circuit carrier and pass through Wiring elements, such as bonding wires, and required distances, in particular for heat spreading, between the electrical components high parasitic inductances.
  • the invention relates to a commutation cell having at least one electrical capacitance, at least one controllable semiconductor switch and at least one semiconductor, which is connected in series with the controllable semiconductor switch, characterized by three mutually parallel circuit carrier, wherein the controllable semiconductor switch over a partially between the controllable semiconductor switch and the semiconductor arranged circuit carrier is connected in series with the semiconductor, wherein the two remaining circuit carriers are electrically conductively connected to one another via a circuit formed from the controllable semiconductor switch, the semiconductor and the semi-conductor between the controllable semiconductor switch and the semiconductor circuit board, and wherein the electrical capacitance is connected separately from the module between the other two circuit carriers.
  • the electrical components are not arranged as conventionally next to one another on a circuit carrier. Furthermore, there are no conventionally required wiring elements, such as bonding wires, and conventionally required distances, in particular for heat spreading, between the electrical components.
  • the invention therefore provides a very compact commutation cell compared to conventional commutation cells
  • the commutation cell according to the invention thus has three superimposed wiring levels.
  • the use of simple materials, such as copper, for the circuit carrier also results in cost advantages over conventional commutation.
  • commutation cell according to the invention has optimal
  • the circuit carriers can be used as punched grids, printed circuit boards, laminates,
  • AMB active metal braze
  • DCB direct copper bonded substrates
  • conductor tracks or the like may be formed
  • Circuit carriers from each other is limited by the dimensions of the controllable semiconductor switch, the joint gap and the semiconductor.
  • the semiconductor may be formed as a passive semiconductor, for example as a semiconductor diode, or also as a controllable semiconductor switch.
  • SOI silicon-on-insulator
  • the commutation cell has two bodies which are essentially of the same physical construction and connectable to each other
  • Commutation cell parts wherein the partially arranged between the controllable semiconductor switch and the semiconductor circuit carrier has two parallel to one another, connectable to each other circuit board parts and the electrical capacitance has two electrodes, wherein the one
  • Commutation cell part is formed by the one circuit carrier part, the one electrode of the electrical capacitance, the controllable semiconductor switch and one of the remaining circuit carrier and the other Kommut réelleszellenteil by the other circuit carrier part, the other electrode of the electric capacitance, the semiconductor and the other of the other circuit carriers.
  • the two commutation cell parts can connect with each other before their connection
  • Commutation cell parts are constructed on two sides and then connected to each other with a simple assembly step.
  • a 2-sided construction a Kommutleiterszellenteils also causes a full-blown
  • Commutation cell parts connected to a commutation cell.
  • the circuit carrier parts and the electrodes of the electrical capacitor are each connected to one another via a joining layer formed by means of a joining method.
  • a joining method for example, a soldering, in particular soldering, Leitkleben, sintering, in particular silver sintering, or the like in question.
  • Commutation cell each one arranged by means of a joining process joining layer is arranged.
  • a joining process for example
  • Commutation cell are also connected via a soldering, the properties of the solders used to form the Kommut michmaschineszellenteils on the one hand and the commutation cell on the other hand must be coordinated.
  • soldering a Lothierarchie is to be observed, which prevents it when connecting the Kommutleiterszellenmaschine by means of a soldering process to a re-melting and Ablegieren the
  • Commutation cell each one arranged by means of a silver sintering process joining layer is arranged. This is beneficial as a through one
  • At least one is in at least one joining layer
  • a commutation cell can be designed to some extent independent of the particular geometry of the electrical capacitance, the controllable semiconductor switch and / or the semiconductor.
  • two or more spacer elements can also be arranged.
  • Compensation element may be formed, for example, of molybdenum.
  • the compensating element can also be used as a spacer at the same time.
  • In a marriage history can also be two or more
  • Compensating elements may be arranged.
  • the commutation cell has an external electrical insulation.
  • the external electrical insulation can be realized by a casting or a casting. Such a casting can also be used to provide sufficient mechanical stability of a commutation cell and to meet requirements with respect to the Moisture Sensitivity Level (MSL), which is a measure of the environmental capability of the circuit, and the exclusive provision of external electrical insulation on a commutation cell allows for maximum heat dissipation close to the commutation cell electrical components may also have TIM ("Thermal Interface Material") materials.
  • a circuit carrier may be formed as a ceramic-metal composite.
  • the commutation cell has at least one electronic control unit for controlling the controllable
  • the electronic control unit may be connected via a conventional bonding technology or via at least one circuit carrier with the controllable semiconductor switch and / or the semiconductor on which the electronic control unit is arranged.
  • FIG. 1 shows a circuit diagram of a conventional commutation cell
  • FIG. 2 is a schematic sectional view of an embodiment of a commutation cell according to the invention.
  • Fig. 3 a schematic sectional view of another
  • FIG. 4 a schematic sectional view of a commutation cell part of the commutation cell shown in FIG.
  • FIG 2 shows a schematic representation of an embodiment of a commutation cell according to the invention 7.
  • the commutation cell 7 has an electrical capacitance 8, a controllable semiconductor switch 9 and a Semiconductor 10, which is connected in series with the controllable semiconductor switch 9. Furthermore, the commutation cell 7 comprises three parallel arranged circuit carriers 11, 12 and 13, wherein the controllable semiconductor switch 9 via a partially between the controllable
  • Semiconductor switch 9 and the semiconductor 10 arranged circuit carrier 12 is connected in series with the semiconductor 10.
  • the other two circuit carriers 11 and 13 are connected via a controllable semiconductor switch 9, the
  • Figure 3 shows a schematic sectional view of another
  • Exemplary embodiment of a commutation cell 16 which differs from the exemplary embodiment shown in FIG. 2 in that it has two commutation cell parts 17 and 18 which are physically substantially identically constructed and connectable to one another.
  • the circuit carrier 12, via which the controllable semiconductor switch 9 is connected in series with the semiconductor 10, has two circuit carrier parts 19 and 20 arranged parallel to one another and the electrical capacitor 8 has two electrodes 21 and 22.
  • the one commutation cell part 17 is formed by the circuit substrate 19, the electrode 21 of the electric capacitor 8, the controllable semiconductor switch 9 and the circuit carrier 11 and the other Kommutéesszellenteil 18 is through the circuit substrate part 20, the electrode 22 of the electric capacitor 8, the semiconductor 10 and
  • Circuit carrier 13 is formed.
  • the circuit carrier parts 19 and 20 and the electrodes 21 and 22 of the electrical capacitor 8 are each connected to one another via a joining layer 23 formed by means of a joining method.
  • a joining layer 15 formed by means of a joining method adapted to the aforementioned joining method is arranged in each case.

Abstract

The invention relates to a commutation cell (7, 16), comprising at least one electrical capacitor (8), at least one controllable semiconductor switch (9), and at least one semiconductor (10), which is connected in series with the controllable semiconductor switch (9), characterized by three circuit carriers (11, 12, 13) arranged parallel to each other, the controllable semiconductor switch (9) being connected in series with the semiconductor (10) by means of a circuit carrier (12) arranged partially between the controllable semiconductor switch (9) and the semiconductor (10), the two other circuit carriers (11, 13) being connected to each other in an electrically conductive manner by means of an assembly (14) formed by the controllable semiconductor switch (9), the semiconductor (10), and the circuit carrier (12) arranged partially between the controllable semiconductor switch (9) and the semiconductor (10), and wherein the electrical capacitor (8) is connected between the two other circuit carriers (11, 13) separately from the assembly (14).

Description

Beschreibung Titel  Description title
Kommutierungszelle Stand der Technik Commutation cell prior art
Kommutierungszellen sind als Teile von elektrischen Schaltungen bekannt, wie sie beispielsweise in Waschmaschinen, Gebläselüftern, elektrischen Commutation cells are known as parts of electrical circuits, such as those used in washing machines, blower fans, electric
Servolenkungen und elektrischen Antrieben von Kraftfahrzeugen verbaut sind. Power steering systems and electric drives of motor vehicles are installed.
Figur 1 zeigt eine beispielhafte Ausführungsform einer herkömmlichen FIG. 1 shows an exemplary embodiment of a conventional one
Kommutierungszelle 1, in der sich eine durch einen Schaltvorgang initiierte Stromänderung abspielen kann. Die Kommutierungszelle 1 umfasst einen steuerbaren Halbleiterschalter 2 und eine in Reihe zu dem steuerbaren Commutation cell 1, in which a current change initiated by a switching process can take place. The commutation cell 1 comprises a controllable semiconductor switch 2 and one in series with the controllable
Halbleiterschalter geschaltete Halbleiterdiode 3. Mit der Kommutierungszelle 1 wird ein elektrisches Potential an einem dynamischen Knoten 4 verändert. Die physikalische Realisierung der Kommutierungszelle 1 ist durch die Geometrie und weitere Eigenschaften der zu ihrer Ausbildung verwendeten elektrischen Bauteile sowie durch Leiterbahnen der Kommutierungszelle 1 bestimmt. Durch die Kommutierungszelle 1 wird eine Leiterschleife 5 ausgebildet, welche parasitäre Induktivitäten in der Kommutierungszelle 1 erzeugt, die schematisch durch die elektrischen Bauteile 6 angedeutet sind. Diese parasitären Semiconductor switch switched semiconductor diode 3. With the commutation cell 1, an electrical potential at a dynamic node 4 is changed. The physical realization of the commutation cell 1 is determined by the geometry and further properties of the electrical components used for their formation and by interconnects of the commutation cell 1. By the commutation cell 1, a conductor loop 5 is formed, which generates parasitic inductances in the commutation cell 1, which are schematically indicated by the electrical components 6. These parasitic
Induktivitäten werden durch die jeweilige Ausgestaltung der elektrischen Bauteile und die jeweilige Aufbau- und Verbindungstechnik der Kommutierungszelle 1 erzeugt. Inductors are generated by the respective configuration of the electrical components and the respective construction and connection technology of the commutation cell 1.
Herkömmliche Kommutierungszellen sind üblicherweise aus elektrischen Bauteilen aufgebaut, die, beispielsweise in der in Figur 1 gezeigten Anordnung, nebeneinander an einem Schaltungsträger angeordnet sind, und weisen durch Verdrahtungselemente, wie beispielsweise Bonddrähte, und erforderliche Abstände, insbesondere zur Wärmespreizung, zwischen den elektrischen Bauteilen hohe parasitäre Induktivitäten auf. Conventional commutation cells are usually constructed of electrical components which, for example in the arrangement shown in FIG. 1, are arranged next to one another on a circuit carrier and pass through Wiring elements, such as bonding wires, and required distances, in particular for heat spreading, between the electrical components high parasitic inductances.
Offenbarung der Erfindung Disclosure of the invention
Gegenstand der Erfindung ist eine Kommutierungszelle mit wenigstens einer elektrischen Kapazität, wenigstens einem steuerbaren Halbleiterschalter und wenigstens einem Halbleiter, der in Reihe zu dem steuerbaren Halbleiterschalter geschaltet ist, gekennzeichnet durch drei parallel zueinander angeordnete Schaltungsträger, wobei der steuerbare Halbleiterschalter über einen teilweise zwischen dem steuerbaren Halbleiterschalter und dem Halbleiter angeordneten Schaltungsträger in Reihe zu dem Halbleiter geschaltet ist, wobei die beiden übrigen Schaltungsträger über eine aus dem steuerbaren Halbleiterschalter, dem Halbleiter und dem teilweise zwischen dem steuerbaren Halbleiterschalter und dem Halbleiter angeordneten Schaltungsträger gebildete Baugruppe elektrisch leitend miteinander verbunden sind, und wobei die elektrische Kapazität separat von der Baugruppe zwischen die beiden übrigen Schaltungsträger geschaltet ist. The invention relates to a commutation cell having at least one electrical capacitance, at least one controllable semiconductor switch and at least one semiconductor, which is connected in series with the controllable semiconductor switch, characterized by three mutually parallel circuit carrier, wherein the controllable semiconductor switch over a partially between the controllable semiconductor switch and the semiconductor arranged circuit carrier is connected in series with the semiconductor, wherein the two remaining circuit carriers are electrically conductively connected to one another via a circuit formed from the controllable semiconductor switch, the semiconductor and the semi-conductor between the controllable semiconductor switch and the semiconductor circuit board, and wherein the electrical capacitance is connected separately from the module between the other two circuit carriers.
Bei der erfindungsgemäßen Kommutierungszelle sind die elektrischen Bauteile nicht wie herkömmlich nebeneinander an einem Schaltungsträger angeordnet. Des Weiteren sind keine herkömmlich notwendigen Verdrahtungselemente, wie beispielsweise Bonddrähte, und herkömmlich erforderliche Abstände, insbesondere zur Wärmespreizung, zwischen den elektrischen Bauteilen vorhanden. Mit der Erfindung wird daher eine im Vergleich zu herkömmlichen Kommutierungszellen sehr kompakt aufgebaute Kommutierungszelle In the commutation cell according to the invention, the electrical components are not arranged as conventionally next to one another on a circuit carrier. Furthermore, there are no conventionally required wiring elements, such as bonding wires, and conventionally required distances, in particular for heat spreading, between the electrical components. The invention therefore provides a very compact commutation cell compared to conventional commutation cells
vorgeschlagen, was mit einer Minimierung einer eingeschlossenen Leiterschleife und somit der damit verbundenen parasitären Induktivitäten verbunden ist. Die erfindungsgemäße Kommutierungszelle weist somit drei übereinander liegende Verdrahtungsebenen auf. Durch den Einsatz einfacher Materialien, wie beispielsweise Kupfer, für die Schaltungsträger ergeben sich des Weiteren Kostenvorteile gegenüber herkömmlichen Kommutierungszellen. Die proposed, which is associated with a minimization of a trapped conductor loop and thus the associated parasitic inductances. The commutation cell according to the invention thus has three superimposed wiring levels. The use of simple materials, such as copper, for the circuit carrier also results in cost advantages over conventional commutation. The
erfindungsgemäße Kommutierungszelle weist zudem optimale In addition, commutation cell according to the invention has optimal
Entwärmungseigenschaften auf, da eine doppelseitige Kühlung und eine Wärmespreizung nahe an einem im Betrieb Wärme erzeugenden elektrischen Bauteil möglich sind. Bessere Entwärmungseigenschaften können eine höhere Effizienz und insbesondere höhere Leistungsdichten und dadurch eine bessere Materialausnutzung ermöglichen. Entwärmungseigenschaften because a double-sided cooling and heat dissipation close to an operating heat generating electrical Component are possible. Better heat dissipation properties can allow for higher efficiency and, in particular, higher power densities and thereby better material utilization.
Die Schaltungsträger können als Stanzgitter, Leiterplatten, Laminate, The circuit carriers can be used as punched grids, printed circuit boards, laminates,
AMB(„active metal braze")-Substrate, DCB(direct copper bonded)-Substrate, Leiterbahnenzüge oder dergleichen ausgebildet sein. Der Abstand der AMB ("active metal braze") - substrates, DCB (direct copper bonded) substrates, conductor tracks or the like may be formed
Schaltungsträger voneinander ist durch die Dimensionierung des steuerbaren Halbleiterschalters, des Fügespaltes und des Halbleiters limitiert. Circuit carriers from each other is limited by the dimensions of the controllable semiconductor switch, the joint gap and the semiconductor.
Der Halbleiter kann als passiver Halbleiter, beispielsweise als Halbleiterdiode, oder ebenfalls als ansteuerbarer Halbleiterschalter ausgebildet sein. The semiconductor may be formed as a passive semiconductor, for example as a semiconductor diode, or also as a controllable semiconductor switch.
Die elektrische Kapazität kann als Keramikvielschicht-Chipkondensator (MLCC) oder auch als Mehrlagen-Silikon-on-lnsulator(SOI)-Kondensator ausgebildet sein, wobei Letzteres einer raumsparenden Ausgestaltung einer The electrical capacitance may be formed as a ceramic multilayer chip capacitor (MLCC) or as a multilayer silicon-on-insulator (SOI) capacitor, the latter of a space-saving design of a
erfindungsgemäßen Kommutierungszelle entgegenkommt. accommodates the commutation cell according to the invention.
Gemäß einer vorteilhaften Ausgestaltung weist die Kommutierungszelle zwei körperlich im Wesentlichen gleich aufgebaute, miteinander verbindbare According to an advantageous embodiment, the commutation cell has two bodies which are essentially of the same physical construction and connectable to each other
Kommutierungszellenteile auf, wobei der teilweise zwischen dem steuerbaren Halbleiterschalter und dem Halbleiter angeordnete Schaltungsträger zwei parallel zueinander anordbare, miteinander verbindbare Schaltungsträgerteile und die elektrische Kapazität zwei Elektroden aufweist, wobei der eine Commutation cell parts, wherein the partially arranged between the controllable semiconductor switch and the semiconductor circuit carrier has two parallel to one another, connectable to each other circuit board parts and the electrical capacitance has two electrodes, wherein the one
Kommutierungszellenteil durch das eine Schaltungsträgerteil, die eine Elektrode der elektrischen Kapazität, den steuerbaren Halbleiterschalter und einen der übrigen Schaltungsträger und der andere Kommutierungszellenteil durch das andere Schaltungsträgerteil, die andere Elektrode der elektrischen Kapazität, den Halbleiter und den anderen der übrigen Schaltungsträger gebildet ist. Die beiden Kommutierungszellenteile können vor ihrer Verbindung miteinander auf Commutation cell part is formed by the one circuit carrier part, the one electrode of the electrical capacitance, the controllable semiconductor switch and one of the remaining circuit carrier and the other Kommutierungszellenteil by the other circuit carrier part, the other electrode of the electric capacitance, the semiconductor and the other of the other circuit carriers. The two commutation cell parts can connect with each other before their connection
Funktionstüchtigkeit geprüft werden. Durch die Verwendung von zwei miteinander verbindbaren Kommutierungszellenteilen wird ein Montagerisiko einer verdeckten Montage minimiert, insbesondere indem die einzelnen Functionality to be tested. By using two commutating cell parts which can be connected to one another, a mounting risk of concealed mounting is minimized, in particular by virtue of the individual components
Kommutierungszellenteile 2-seitig aufgebaut und anschließend mit einem einfachen Montageschritt miteinander verbunden werden. Ein 2-seitiger Aufbau eines Kommutierungszellenteils bewirkt zudem eine vollumfängliche Commutation cell parts are constructed on two sides and then connected to each other with a simple assembly step. A 2-sided construction a Kommutierungszellenteils also causes a full-blown
Zugänglichkeit bei einer Montage und einer Inspektion. Ferner sind mit dieser Ausgestaltung im Vergleich zu herkömmlichen komplexen Fertigungsprozessen Kostenvorteile durch das relativ einfache Verbinden von zwei Accessibility during assembly and inspection. Furthermore, with this embodiment, in comparison to conventional complex manufacturing processes cost advantages through the relatively simple connection of two
Kommutierungszellenteilen zu einer Kommutierungszelle verbunden. Commutation cell parts connected to a commutation cell.
Nach einer weiteren vorteilhaften Ausgestaltung sind die Schaltungsträgerteile und die Elektroden der elektrischen Kapazität jeweils über eine mittels eines Fügeverfahrens ausgebildete Fügeschicht miteinander verbunden. Dies stellt eine gängige und etablierte Verbindungstechnologie dar, was die Herstellung der Kommutierungszelle vereinfacht. Als Fügeverfahren kommt beispielsweise ein Lötverfahren, insbesondere Weichlöten, Leitkleben, Sintern, insbesondere Silbersintern, oder dergleichen in Frage. Diese Fügeverfahren haben According to a further advantageous embodiment, the circuit carrier parts and the electrodes of the electrical capacitor are each connected to one another via a joining layer formed by means of a joining method. This is a common and established interconnect technology, which simplifies the fabrication of the commutation cell. As a joining method, for example, a soldering, in particular soldering, Leitkleben, sintering, in particular silver sintering, or the like in question. These joining methods have
gemeinsam, dass mit ihnen ein metallischer Kontakt zwischen zu fügenden Bauteilen ausbildet werden kann. together that with them a metallic contact between components to be joined can be formed.
Eine weitere vorteilhafte Ausgestaltung sieht vor, dass zwischen den miteinander verbundenen elektrischen Bauteilen von wenigstens einem A further advantageous embodiment provides that between the interconnected electrical components of at least one
Kommutierungszellenteil jeweils eine mittels eines Fügeverfahrens ausgebildete Fügeschicht angeordnet ist. Wird als Fügeverfahren beispielsweise ein Commutation cell each one arranged by means of a joining process joining layer is arranged. Is used as a joining process, for example
Lötverfahren gewählt und soll ein derartig ausgebildetes Kommutierungszellenteil mit dem jeweilig anderen Kommutierungszellenteil zur Ausbildung der Soldering selected and should such a trained Kommutierungszellenteil with the respective other Kommutierungszellenteil to form the
Kommutierungszelle ebenfalls über ein Lötverfahren verbunden werden, müssen die Eigenschaften der zur Ausbildung des Kommutierungszellenteils einerseits und der Kommutierungszelle andererseits verwendeten Lote aufeinander abgestimmt werden. Bei Loten ist eine Lothierarchie einzuhalten, welche verhindert, dass es beim Verbinden der Kommutierungszellenteile mittels eines Lötverfahrens zu einem erneuten Aufschmelzen und Ablegieren der Commutation cell are also connected via a soldering, the properties of the solders used to form the Kommutierungszellenteils on the one hand and the commutation cell on the other hand must be coordinated. When soldering a Lothierarchie is to be observed, which prevents it when connecting the Kommutierungszellenteile by means of a soldering process to a re-melting and Ablegieren the
Fügeschichten des wenigstens einen Kommutierungszellenteils kommt, bei dem zwischen den miteinander verbundenen elektrischen Bauteilen jeweils eine mittels eines Lötverfahrens ausgebildete Fügeschicht angeordnet ist. Bei der Verwendung von Fügeverfahren über den Mechanismus der Festkörperdiffusion, beispielsweise Diffusionslöten oder Sintern, ist auf eine geeignete Metallisierung und eine geeignete Konstruktion zu achten, die einen Fügehilfsdruck aufbringen kann. Es wird des Weiteren als vorteilhaft erachtet, wenn zwischen miteinander verbundenen elektrischen Bauteilen von wenigstens einem Fügeschichten the at least one Kommutierungszellenteils comes, in which between the interconnected electrical components in each case a formed by a soldering joining layer is arranged. When using joining methods via the solid-state diffusion mechanism, for example, diffusion soldering or sintering, attention must be paid to suitable metallization and construction which can apply joining auxiliary pressure. It is further considered advantageous if between interconnected electrical components of at least one
Kommutierungszellenteil jeweils eine mittels eines Silbersinter- Verfahrens ausgebildete Fügeschicht angeordnet ist. Dies ist vorteilhaft, da ein durch einCommutation cell each one arranged by means of a silver sintering process joining layer is arranged. This is beneficial as a through one
Silbersinter- Verfahren gebildetes Fügematerial nicht bei einer für ein Silver sintering process formed joining material not at one for a
Lötverfahren typischen Fügetemperatur von etwa 250°C bis 300°C aufschmilzt, sondern im festen Zustand verbleibt. Folglich muss keine Abstimmung von verschiedenen Loten aufeinander entsprechend der vorgenannten Ausgestaltung erfolgen, um beim Verbinden der beiden Kommutierungszellenteile ein Soldering typical melting temperature of about 250 ° C to 300 ° C melts, but remains in the solid state. Consequently, there is no need to tune different solders to each other according to the aforementioned embodiment in order to connect the two commutation cell parts
Schmelzen von Fügeschichten der einzelnen Kommutierungszellenteile zu verhindern.  To prevent melting of joining layers of the individual commutating cell parts.
Vorteilhafterweise ist in wenigstens einer Fügeschicht zumindest ein Advantageously, at least one is in at least one joining layer
Abstandelement angeordnet. Dies schafft eine größere Gestaltungfreiheit bei der Entwicklung einer Kommutierungszelle, da eine Kommutierungszelle in gewissem Maß unabhängig von der jeweiligen Geometrie der elektrischen Kapazität, des steuerbaren Halbleiterschalters und/oder des Halbleiters entworfen werden kann. In einer Fügeschicht können auch zwei oder mehrere Abstandselemente angeordnet sein. Distance element arranged. This provides greater freedom of design in the development of a commutation cell, since a commutation cell can be designed to some extent independent of the particular geometry of the electrical capacitance, the controllable semiconductor switch and / or the semiconductor. In a joining layer, two or more spacer elements can also be arranged.
Nach einer weiteren vorteilhaften Ausgestaltung ist in wenigstens einer According to a further advantageous embodiment is in at least one
Fügeschicht zumindest ein Ausgleichselement zum Ausgleichen von Fügeschicht at least one compensation element to compensate for
verschiedenen Wärmeausdehnungskoeffizienten der über die Fügeschicht miteinander verbundenen elektrischen Bauteile angeordnet. Das different thermal expansion coefficients of the interconnected via the joining electrical components. The
Ausgleichselement kann beispielsweise aus Molybdän gebildet sein. Das Ausgleichselement kann gleichzeitig auch als Abstandelement eingesetzt werden. In einer Fügeschicht können auch zwei oder mehrere Compensation element may be formed, for example, of molybdenum. The compensating element can also be used as a spacer at the same time. In a marriage history can also be two or more
Ausgleichselemente angeordnet sein. Compensating elements may be arranged.
Gemäß einer weiteren vorteilhaften Ausgestaltung weist die Kommutierungszelle eine äußere elektrische Isolierung auf. Die äußere elektrische Isolierung kann durch einen Verguss oder einen Abguss realisiert sein. Ein solcher Verguss bzw. Abguss kann auch zur Schaffung einer ausreichenden mechanischen Stabilität einer Kommutierungszelle und zum Erfüllen von Erfordernissen bezüglich des Feuchtigkeitsempfindlichkeitsschwellwerts („Moisture Sensitivity Level", MSL), welcher ein Maß für die Belastbarkeit der Schaltung mit Umwelteinflüssen ist, dienen. Die ausschließliche Anordnung einer äußeren elektrischen Isolierung an einer Kommutierungszelle ermöglicht eine maximale Wärmespreizung nahe an den elektrischen Bauteilen der Kommutierungszelle. Die elektrische Isolierung kann auch TIM(„Thermal Interface Material") -Materialien aufweisen. Alternativ kann ein Schaltungsträger als Keramik-Metall-Verbund ausgebildet werden. According to a further advantageous embodiment, the commutation cell has an external electrical insulation. The external electrical insulation can be realized by a casting or a casting. Such a casting can also be used to provide sufficient mechanical stability of a commutation cell and to meet requirements with respect to the Moisture Sensitivity Level (MSL), which is a measure of the environmental capability of the circuit, and the exclusive provision of external electrical insulation on a commutation cell allows for maximum heat dissipation close to the commutation cell electrical components may also have TIM ("Thermal Interface Material") materials. Alternatively, a circuit carrier may be formed as a ceramic-metal composite.
Femer wird es als vorteilhaft erachtet, wenn die Kommutierungszelle wenigstens eine elektronische Steuereinheit zum Steuern des steuerbaren Furthermore, it is considered advantageous if the commutation cell has at least one electronic control unit for controlling the controllable
Halbleiterschalters aufweist. Die elektronische Steuereinheit kann über eine herkömmliche Bond-Technologie oder über wenigstens einen Schaltungsträger mit dem steuerbaren Halbleiterschalter und/oder dem Halbleiter verbunden sein, an dem die elektronische Steuereinheit angeordnet ist.  Semiconductor switch has. The electronic control unit may be connected via a conventional bonding technology or via at least one circuit carrier with the controllable semiconductor switch and / or the semiconductor on which the electronic control unit is arranged.
Im Folgenden wird die Erfindung unter Bezugnahme auf die anliegenden Figuren anhand von bevorzugten Ausführungsbeispielen exemplarisch erläutert, wobei die nachfolgend dargestellten Merkmale sowohl jeweils für sich genommen als auch in verschiedener Kombination miteinander einen Aspekt der Erfindung darstellen können. Es zeigen: In the following, the invention will be explained by way of example with reference to the attached figures with reference to preferred exemplary embodiments, wherein the features illustrated below may represent an aspect of the invention both individually and in various combinations with one another. Show it:
Fig. 1: einen Schaltplan einer herkömmlichen Kommutierungszelle, 1 shows a circuit diagram of a conventional commutation cell,
Fig. 2: eine schematische Schnittdarstellung eines Ausführungsbeispiels für eine erfindungsgemäße Kommutierungszelle, 2 is a schematic sectional view of an embodiment of a commutation cell according to the invention,
Fig. 3: eine schematische Schnittdarstellung eines weiteren Fig. 3: a schematic sectional view of another
Ausführungsbeispiels für eine erfindungsgemäße Kommutierungszelle, und Fig. 4: eine schematische Schnittdarstellung eines Kommutierungszellenteils der in Figur 3 gezeigten Kommutierungszelle. Exemplary embodiment of a commutation cell according to the invention, and FIG. 4: a schematic sectional view of a commutation cell part of the commutation cell shown in FIG.
Figur 2 zeigt eine schematische Darstellung eines Ausführungsbeispiels für eine erfindungsgemäße Kommutierungszelle 7. Die Kommutierungszelle 7 weist eine elektrische Kapazität 8, einen steuerbaren Halbleiterschalter 9 und einen Halbleiter 10 auf, der in Reihe zu dem steuerbaren Halbleiterschalter 9 geschaltet ist. Des Weiteren umfasst die Kommutierungszelle 7 drei parallel zueinander angeordnete Schaltungsträger 11, 12 und 13, wobei der steuerbare Halbleiterschalter 9 über einen teilweise zwischen dem steuerbaren Figure 2 shows a schematic representation of an embodiment of a commutation cell according to the invention 7. The commutation cell 7 has an electrical capacitance 8, a controllable semiconductor switch 9 and a Semiconductor 10, which is connected in series with the controllable semiconductor switch 9. Furthermore, the commutation cell 7 comprises three parallel arranged circuit carriers 11, 12 and 13, wherein the controllable semiconductor switch 9 via a partially between the controllable
Halbleiterschalter 9 und dem Halbleiter 10 angeordneten Schaltungsträger 12 in Reihe zu dem Halbleiter 10 geschaltet ist. Die beiden übrigen Schaltungsträger 11 und 13 sind über eine aus dem steuerbaren Halbleiterschalter 9, dem Semiconductor switch 9 and the semiconductor 10 arranged circuit carrier 12 is connected in series with the semiconductor 10. The other two circuit carriers 11 and 13 are connected via a controllable semiconductor switch 9, the
Halbleiter 10 und dem teilweise zwischen dem steuerbaren Halbleiterschalter 9 und dem Halbleiter 10 angeordneten Schaltungsträger 12 gebildete Baugruppe 14 elektrisch leitend miteinander verbunden. Die elektrische Kapazität 8 ist separat von der Baugruppe 14 zwischen die beiden übrigen Schaltungsträgern 11 und 13 geschaltet. Zwischen den miteinander verbundenen elektrischen Bauteilen 8 bis 13 der Kommutierungszelle 7 ist jeweils eine mittels eines Fügeverfahrens ausgebildete Fügeschicht 15 angeordnet. Semiconductor 10 and the partially formed between the controllable semiconductor switch 9 and the semiconductor 10 circuit carrier 12 formed assembly 14 electrically connected to each other. The electrical capacitor 8 is connected separately from the assembly 14 between the other two circuit carriers 11 and 13. Between the interconnected electrical components 8 to 13 of the commutation cell 7 each formed by means of a joining process joining layer 15 is arranged.
Figur 3 zeigt eine schematische Schnittdarstellung eines weiteren Figure 3 shows a schematic sectional view of another
Ausführungsbeispiels für eine erfindungsgemäße Kommutierungszelle 16, welche sich von dem in Figur 2 gezeigten Ausführungsbeispiel insbesondere dadurch unterscheidet, dass sie zwei körperlich im Wesentlichen gleich aufgebaute, miteinander verbindbare Kommutierungszellenteile 17 und 18 aufweist. Der Schaltungsträger 12, über das der steuerbare Halbleiterschalter 9 in Reihe zu dem Halbleiter 10 geschaltet ist, weist zwei parallel zueinander angeordnete Schaltungsträgerteile 19 und 20 und die elektrische Kapazität 8 weist zwei Elektroden 21 und 22 auf. Der eine Kommutierungszellenteil 17 ist durch das Schaltungsträgerteil 19, die Elektrode 21 der elektrischen Kapazität 8, den steuerbaren Halbleiterschalter 9 und den Schaltungsträger 11 und der andere Kommutierungszellenteil 18 ist durch das Schaltungsträgerteil 20, die Elektrode 22 der elektrischen Kapazität 8, den Halbleiter 10 und den Exemplary embodiment of a commutation cell 16 according to the invention, which differs from the exemplary embodiment shown in FIG. 2 in that it has two commutation cell parts 17 and 18 which are physically substantially identically constructed and connectable to one another. The circuit carrier 12, via which the controllable semiconductor switch 9 is connected in series with the semiconductor 10, has two circuit carrier parts 19 and 20 arranged parallel to one another and the electrical capacitor 8 has two electrodes 21 and 22. The one commutation cell part 17 is formed by the circuit substrate 19, the electrode 21 of the electric capacitor 8, the controllable semiconductor switch 9 and the circuit carrier 11 and the other Kommutierungszellenteil 18 is through the circuit substrate part 20, the electrode 22 of the electric capacitor 8, the semiconductor 10 and
Schaltungsträger 13 gebildet. Die Schaltungsträgerteile 19 und 20 und die Elektroden 21 und 22 der elektrischen Kapazität 8 sind jeweils über eine mittels eines Fügeverfahrens ausgebildete Fügeschicht 23 miteinander verbunden. Zwischen den miteinander verbundenen elektrischen Bauteilen 9, 11, 15, 19 und 21 bzw. 10, 13, 15, 20 und 22 der Kommutierungszellenteile 17 bzw. 18 ist jeweils eine mittels eines auf das zuvor genannte Fügeverfahren abgestimmten Fügeverfahrens ausgebildete Fügeschicht 15 angeordnet. Circuit carrier 13 is formed. The circuit carrier parts 19 and 20 and the electrodes 21 and 22 of the electrical capacitor 8 are each connected to one another via a joining layer 23 formed by means of a joining method. Between the interconnected electrical components 9, 11, 15, 19 and 21 or 10, 13, 15, 20 and 22 of the commutation cell parts 17 and 18, a joining layer 15 formed by means of a joining method adapted to the aforementioned joining method is arranged in each case.

Claims

Ansprüche claims
1. Kommutierungszelle (7, 16) mit wenigstens einer elektrischen Kapazität (8), wenigstens einem steuerbaren Halbleiterschalter (9) und wenigstens einem Halbleiter (10), der in Reihe zu dem steuerbaren Halbleiterschalter (9) geschaltet ist, gekennzeichnet durch drei parallel zueinander angeordnete Schaltungsträger (11, 12, 13), wobei der steuerbare Halbleiterschalter (9) über einen teilweise zwischen dem steuerbaren Halbleiterschalter (9) und dem Halbleiter (10) angeordneten Schaltungsträger (12) in Reihe zu dem Halbleiter (10) geschaltet ist, wobei die beiden übrigen Schaltungsträger (11, 13) über eine aus dem steuerbaren Halbleiterschalter (9), dem Halbleiter (10) und dem teilweise zwischen dem steuerbaren Halbleiterschalter (9) und dem Halbleiter (10) angeordneten Schaltungsträger (12) gebildete Baugruppe (14) elektrisch leitend miteinander verbunden sind, und wobei die elektrische Kapazität (8) separat von der Baugruppe (14) zwischen die beiden übrigen Schaltungsträger (11, 13) geschaltet ist. 1. commutation cell (7, 16) with at least one electrical capacitance (8), at least one controllable semiconductor switch (9) and at least one semiconductor (10) connected in series with the controllable semiconductor switch (9), characterized by three parallel to each other arranged circuit carrier (11, 12, 13), wherein the controllable semiconductor switch (9) via a partially between the controllable semiconductor switch (9) and the semiconductor (10) arranged circuit carrier (12) in series with the semiconductor (10) is connected, the two remaining circuit carriers (11, 13) via an assembly (14) formed from the controllable semiconductor switch (9), the semiconductor (10) and the partially between the controllable semiconductor switch (9) and the semiconductor (10) arranged circuit carrier (12) electrically conductively connected to each other, and wherein the electrical capacitance (8) separately from the module (14) between the two remaining circuit carrier (1 1, 13) is connected.
2. Kommutierungszelle (7, 16) gemäß Anspruch 1, gekennzeichnet durch zwei körperlich im Wesentlichen gleich aufgebaute, miteinander verbindbare Kommutierungszellenteile (17, 18), wobei der Schaltungsträger (12), über das der steuerbare Halbleiterschalter (9) in Reihe zu dem Halbleiter (10) geschaltet ist, zwei parallel zueinander anordbare, miteinander verbindbare Schaltungsträgerteile (19, 20) und die elektrische Kapazität (8) zwei 2. commutation cell (7, 16) according to claim 1, characterized by two physically substantially identically constructed, interconnectable commutation cell parts (17, 18), wherein the circuit carrier (12) via which the controllable semiconductor switch (9) in series with the semiconductor (10) is connected, two parallel to one another, connectable to each other circuit carrier parts (19, 20) and the electrical capacitance (8) two
Elektroden (21, 22) aufweist, wobei der eine Kommutierungszellenteil (17) durch das eine Schaltungsträgerteil (19), die eine Elektrode (21) der elektrischen Kapazität (8), den steuerbaren Halbleiterschalter (9) und einen der übrigen Schaltungsträger (11) und der andere Kommutierungszellenteil (18) durch das andere Schaltungsgitterteil (20), die andere Elektrode (22) der elektrischen Kapazität (8), den Halbleiter (10) und den anderen der übrigen Schaltungsträger (13) gebildet ist. Electrodes (21, 22), the one commutation cell part (17) passing through the one circuit carrier part (19), one electrode (21) of the electrical capacitor (8), the controllable semiconductor switch (9) and one of the other circuit carriers (11) and the other commutation cell part (18) is formed by the other circuit grid part (20), the other electrode (22) of the electric capacitance (8), the semiconductor (10) and the other of the other circuit carriers (13).
3. Kommutierungszelle (7, 16) gemäß Anspruch 2, dadurch gekennzeichnet, dass die Schaltungsträgerteile (19, 20) und die Elektroden (21, 22) der elektrischen Kapazität (8) jeweils über eine mittels eines Fügeverfahrens ausgebildete Fügeschicht (23) miteinander verbunden sind. 3. commutation cell (7, 16) according to claim 2, characterized in that the circuit carrier parts (19, 20) and the electrodes (21, 22) of the electrical capacitance (8) in each case connected via a joining layer formed by a joining process (23) are.
4. Kommutierungszelle (7, 16) gemäß Anspruch 2 oder 3, dadurch 4. commutation cell (7, 16) according to claim 2 or 3, characterized
gekennzeichnet, dass zwischen den miteinander verbundenen elektrischen Bauteilen (9, 10, 11, 13, 15, 19, 20, 21, 22) von wenigstens einem  characterized in that between the interconnected electrical components (9, 10, 11, 13, 15, 19, 20, 21, 22) of at least one
Kommutierungszellenteil (17, 18) jeweils eine mittels eines Fügeverfahrens ausgebildete Fügeschicht (15) angeordnet ist.  Commutation cell part (17, 18) each arranged by means of a joining process joining layer (15) is arranged.
5. Kommutierungszelle (7, 16) gemäß einem der Ansprüche 2 bis 4, dadurch gekennzeichnet, dass zwischen miteinander verbundenen elektrischen Bauteilen (9, 10, 11, 13, 15, 19, 20, 21, 22) von wenigstens einem 5. commutation cell (7, 16) according to one of claims 2 to 4, characterized in that between interconnected electrical components (9, 10, 11, 13, 15, 19, 20, 21, 22) of at least one
Kommutierungszellenteil (17, 18) jeweils eine mittels eines Silbersinter- Verfahrens ausgebildete Fügeschicht (15) angeordnet ist.  Commutation cell part (17, 18) each arranged by means of a silver sintering process joining layer (15) is arranged.
6. Kommutierungszelle (7, 16) gemäß einem der Ansprüche 2 bis 5, dadurch gekennzeichnet, dass in wenigstens einer Fügeschicht (15, 23) zumindest ein Abstandelement angeordnet ist. 6. commutation cell (7, 16) according to one of claims 2 to 5, characterized in that in at least one joining layer (15, 23) at least one spacer element is arranged.
7. Kommutierungszelle (7, 16) gemäß einem der Ansprüche 2 bis 6, dadurch gekennzeichnet, dass in wenigstens einer Fügeschicht (15, 23) zumindest ein Ausgleichselement zum Ausgleichen von verschiedenen 7. commutation cell (7, 16) according to one of claims 2 to 6, characterized in that in at least one bonding layer (15, 23) at least one compensation element for balancing different
Wärmeausdehnungskoeffizienten der über die Fügeschicht (15, 23) miteinander verbundenen elektrischen Bauteile (9, 10, 11, 13, 15, 19, 20, 21, 22) angeordnet ist.  Thermal expansion coefficient of the over the joining layer (15, 23) interconnected electrical components (9, 10, 11, 13, 15, 19, 20, 21, 22) is arranged.
8. Kommutierungszelle (7, 16) gemäß einem der Ansprüche 1 bis 7, 8. Commutation cell (7, 16) according to one of claims 1 to 7,
gekennzeichnet durch eine äußere elektrische Isolierung.  characterized by an external electrical insulation.
9. Kommutierungszelle (7, 16) gemäß einem der Ansprüche 1 bis 8, 9. commutation cell (7, 16) according to one of claims 1 to 8,
gekennzeichnet durch wenigstens eine elektronische Steuereinheit zum Steuern des steuerbaren Halbleiterschalters (9).  characterized by at least one electronic control unit for controlling the controllable semiconductor switch (9).
EP15718847.5A 2014-05-21 2015-04-21 Commutation cell Withdrawn EP3146563A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE102014209690.1A DE102014209690B4 (en) 2014-05-21 2014-05-21 Kommutierungszelle
PCT/EP2015/058559 WO2015176893A1 (en) 2014-05-21 2015-04-21 Commutation cell

Publications (1)

Publication Number Publication Date
EP3146563A1 true EP3146563A1 (en) 2017-03-29

Family

ID=53008477

Family Applications (1)

Application Number Title Priority Date Filing Date
EP15718847.5A Withdrawn EP3146563A1 (en) 2014-05-21 2015-04-21 Commutation cell

Country Status (5)

Country Link
US (1) US9871025B2 (en)
EP (1) EP3146563A1 (en)
JP (1) JP6486390B2 (en)
DE (1) DE102014209690B4 (en)
WO (1) WO2015176893A1 (en)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102018212436A1 (en) 2018-07-25 2020-01-30 Infineon Technologies Ag SEMICONDUCTOR HOUSING WITH SYMMETRICALLY ARRANGED POWER CONNECTIONS AND METHOD FOR THE PRODUCTION THEREOF
DE102018212438A1 (en) 2018-07-25 2020-01-30 Infineon Technologies Ag SEMICONDUCTOR HOUSING WITH ELECTROMAGNETIC SHIELDING STRUCTURE AND METHOD FOR THE PRODUCTION THEREOF
DE102018126972A1 (en) 2018-07-25 2020-01-30 Infineon Technologies Ag SEMICONDUCTOR HOUSING WITH OVERLAPPING ELECTRICALLY CONDUCTIVE AREAS AND METHOD FOR THE PRODUCTION THEREOF
DE102018212443A1 (en) * 2018-07-25 2020-01-30 Infineon Technologies Ag Semiconductor package with passive electrical component and method for its production

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2004193476A (en) * 2002-12-13 2004-07-08 Denso Corp Semiconductor device
US20100237507A1 (en) * 2009-03-23 2010-09-23 Toyota Jidosha Kabushiki Kaisha Power module
JP2010251665A (en) * 2009-04-20 2010-11-04 Nippon Soken Inc Semiconductor device for power conversion

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP4438489B2 (en) * 2004-04-13 2010-03-24 富士電機システムズ株式会社 Semiconductor device
JP4635564B2 (en) * 2004-11-04 2011-02-23 富士電機システムズ株式会社 Semiconductor device
JP4552810B2 (en) * 2005-09-06 2010-09-29 株式会社デンソー Semiconductor device
JP2007116013A (en) * 2005-10-24 2007-05-10 Renesas Technology Corp Semiconductor device and power supply using same
FR2981200B1 (en) * 2011-10-10 2017-01-13 Centre Nat De La Rech Scient (Cnrs) MONOLITHIC CELL WITH INTEGRATED CIRCUIT AND IN PARTICULAR MONOLITHIC SWITCH CELL
JP2013153010A (en) * 2012-01-24 2013-08-08 Denso Corp Semiconductor module and semiconductor device
DE102012207652A1 (en) 2012-05-08 2013-11-14 Robert Bosch Gmbh Two-stage process for joining a semiconductor to a substrate with silver-based compound material
CA2907472C (en) * 2013-04-04 2017-05-02 Tm4 Inc. Commutation cell and compensation circuit therefor
DE202013104510U1 (en) * 2013-10-04 2013-11-14 Abb Technology Ag Semiconductor stack for converters with snubber capacitors
EP3063858A4 (en) * 2013-11-01 2017-05-31 TM4 Inc. Power converter configured for limiting switching overvoltage
US9768693B2 (en) * 2013-11-14 2017-09-19 Tm4 Inc. Compensation circuit, commutation cell and power converter controlling turn-on and turn-off of a power electronic switch
US9882465B2 (en) * 2013-11-14 2018-01-30 Tm4 Inc. Commutation cell, power converter and compensation circuit having dynamically controlled voltage gains

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2004193476A (en) * 2002-12-13 2004-07-08 Denso Corp Semiconductor device
US20100237507A1 (en) * 2009-03-23 2010-09-23 Toyota Jidosha Kabushiki Kaisha Power module
JP2010251665A (en) * 2009-04-20 2010-11-04 Nippon Soken Inc Semiconductor device for power conversion

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of WO2015176893A1 *

Also Published As

Publication number Publication date
JP6486390B2 (en) 2019-03-20
DE102014209690B4 (en) 2020-02-20
DE102014209690A1 (en) 2015-11-26
JP2017523596A (en) 2017-08-17
WO2015176893A1 (en) 2015-11-26
US20170069608A1 (en) 2017-03-09
US9871025B2 (en) 2018-01-16

Similar Documents

Publication Publication Date Title
DE102005047106B4 (en) Power semiconductor module and method of manufacture
DE102011083223B4 (en) Power semiconductor module with integrated thick-film circuit board
DE102005039478B4 (en) Power semiconductor device with semiconductor chip stack and method for producing the same
DE102005047567B3 (en) Power semiconductor module comprises a housing, connecting elements and an electrically insulated substrate arranged within the housing and semiconductor components with a connecting element and an insulating molded body
EP2514282B1 (en) Multilayer printed circuit board having a bare-die-mounting for use in a gear box control
DE102011078811B3 (en) Power electronic system with a cooling device
EP2107604A2 (en) Power semiconductor module with hermetically sealed switching assembly and corresponding production method
WO2009132922A2 (en) Substrate-mounted circuit module comprising components in a plurality of contact planes
DE102016203581A1 (en) SEMICONDUCTOR DEVICE AND METHOD FOR PRODUCING A SEMICONDUCTOR DEVICE
WO2014206665A1 (en) Electrical circuit and method for producing an electrical circuit for activating a load
EP3146563A1 (en) Commutation cell
DE102016212506A1 (en) Semiconductor device and method of manufacturing a semiconductor device
DE102006025531A1 (en) Converter module
DE102014010373A1 (en) Electronic module for a motor vehicle
EP3529832B1 (en) Power module
DE102004058806B4 (en) A method of fabricating circuit patterns on a heat sink and circuit structure on a heat sink
DE102011078806B4 (en) Manufacturing method for a power electronic system with a cooling device
EP2875514A1 (en) Electrical component comprising a connection element having a plastic body
EP3384527A1 (en) Electronic power module
WO2017080903A1 (en) Contacting arrangement for a circuit board substrate, and method for contacting a circuit board substrate
DE102015223551A1 (en) Circuit carrier for an electrical circuit and associated manufacturing method
DE102008040290A1 (en) Hybrid circuit structure for use in automotive-area, has low-current substrate for carrying low current components, and power substrate comprising front side with contact surface section, where low-current substrate is fastened to section
DE102014109385A1 (en) Electronic component arrangement
EP2887392A2 (en) Power electronics module and method for producing a power electronics module
DE102010012457B4 (en) Circuit arrangement with an electrical component and a composite film

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20161221

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20200324

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: ROBERT BOSCH GMBH

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20200804