EP2197904A1 - Novel protein variants by circular permutation - Google Patents
Novel protein variants by circular permutationInfo
- Publication number
- EP2197904A1 EP2197904A1 EP08804812A EP08804812A EP2197904A1 EP 2197904 A1 EP2197904 A1 EP 2197904A1 EP 08804812 A EP08804812 A EP 08804812A EP 08804812 A EP08804812 A EP 08804812A EP 2197904 A1 EP2197904 A1 EP 2197904A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- protein
- circular permutation
- polypeptides
- polynucleotides
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38609—Protease or amylase in solid compositions only
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/58—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from fungi
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21062—Subtilisin (3.4.21.62)
Definitions
- the present invention relates to a method for obtaining novel protein variants by circular permutation and the novel protein variants obtained by this method.
- mutation methods are generally used in which either targeted or random mutations are generated or amino acids are inserted or removed by insertion or deletion.
- Circular permutation methods have in principle been described for some time in the prior art.
- Graf and Schachmann Provide an overview of enzymes and other proteins with which circular permutation methods have been carried out.
- the hitherto known enzymes and proteins with which permutation methods have been carried out are also common in that the protein is expressed directly in active form.
- proteins, and in particular of enzymes which are expressed in an inactive preform, as a preprotein, proprotein or preproprotein, and are converted into the active form only after the expression by enzymatic cleavage.
- the "pre-part” of the protein is a signal peptide responsible for targeting the expressed protein into the correct cell compartment, while the "pro-part” of the protein keeps the protein inactive until it is activated by activation at the target site suitable place is converted into the active form at the appropriate time.
- circular detergent permutation processes for detergent enzymes enable new detergent enzymes to be found which have improved properties compared with the starting molecules.
- a first subject of the present invention is therefore a process for producing the circular permutation variant of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, in particular an enzyme, characterized in that the DNA coding for the mature protein is a circular permutation method is subjected.
- the present invention therefore also provides polynucleotides selected from a) for circular permutation variants of the mature protein of proteins naturally expressed as preprotein, proprotein and / or preproprotein, in particular enzymes, coding polynucleotides, b) mutants of polynucleotides according to (a) having a sequence homology and / or identity of at least 80, preferably at least 85 or 90%, more preferably at least 95, 98 or 99% to a polynucleotide according to (a), wherein the sequence comparison in one embodiment is to the circularly permuted polynucleotide without that for the bridging linker
- the sequence comparison in one embodiment is to the circularly permuted polynucleotide without that for the bridging linker
- polynucleotides according to the invention for circular permutation variants of BLAP selected from polypeptides having a sequence homology and / or identity of at least 80%, preferably at least 85 or 90%, more preferably at least 95, 98 or 99%, to a polypeptide according to SEQ ID NO: 5 or according to SEQ ID NO: 6 and / or selected from polypeptides having insertions, deletions or inversions of up to 30, 25 or 20, preferably up to 18, 16, 14 or 12, particularly preferably up to 10, 9, 8, 7 or 6, in particular up to 5, 4, 3 or 2 amino acids, in particular with insertions or deletions of exactly one amino acid with respect to a polypeptide having a polypeptide sequence according to SEQ ID NO: 5 or according to SEQ ID NO: 6th
- the polynucleotides may be present as a single strand or as a double strand.
- Subject matter of the invention are, besides the deoxyribonucleic acids, also the homologous and complementary ribonucleic acids.
- the present invention also relates, in particular, to those polynucleotides in which certain regions have been replaced by other regions, taking into account the differing codon usage of a host organism used for expression, in order to enable the expression of the polypeptide according to the invention.
- Another object of the present invention is a method for producing a circular permutation variant of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, in particular enzyme, comprising the following steps: a) performing a circular permutation method with the DNA of the mature protein, b ) Incorporation of the DNA obtained by the method according to (a) into a suitable vector in the 3 'direction to the DNA coding for a signal peptide and / or prepropeptide, c) introduction of the vector into a suitable host for expression of the DNA, and if appropriate, purification of the protein obtained.
- a further subject of the present invention are therefore also polypeptides selected from a) circular permutation variants obtained by a method according to the invention, ie circular permutation variants of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, b) variants of circular permutation variants according to (a) with a sequence homology and / or identity of at least 80%, preferably at least 85 or 90%, especially preferably of at least 95, 98 or 99% over the sequence of a circular permutation variant according to (a), wherein the sequence comparison in one embodiment relates to the polypeptide sequence of the circular permutation variant without the sequence of the linker and in another embodiment to the polypeptide sequence of the zirkluaren permutation variant including the sequence of the linker, c) variants of circular permutation variants according to (a) with substitutions, insertions, deletions or inversions of up to 30, 25 or 20, preferably up to 18, 16, 14 or 12, particularly preferred up to 10 ,
- mature protein is meant according to the invention the protein without regard to the signal peptide and propeptide.
- the circular permutation variant according to the invention is therefore preferably the circular permutation variant of an enzyme, particularly preferably a protease, in particular an alkaline protease of the subtilisin type.
- subtilisin-type alkaline proteases are the Bacillus lentus alkaline protease (BLAP) and the subtilisins BPN 'and Carlsberg, the protease PB92, the subtilisins 147 and 309, subtilisin DY and the subtilases, but not the subtilisins in the enzymes Thermitase, Proteinase K and the proteases TW3 and TW7.
- Subtilisin Carlsberg in a developed form under the trade names Alcalase ® from Novozymes A / S, Bagsvaerd, Denmark.
- the subtilisins 147 and 309 are sold under the trade names Esperase ®, or Savinase ® from Novozymes.
- protease from Bacillus lentus DSM 5483 (WO 91/02792 A1) the listed under the name BLAP ® variants are derived from, in particular, in WO 92/21760 A1, WO 95/23221 A1, WO 02/088340 A2 and WO 03/038082 A2 are described.
- Other useful proteases from various Bacillus sp and B. gibsonii strains are found in the patent applications WO 03/054185, WO 03/056017, WO 03/055974 and WO 03/054184.
- proteases are, for example, under the trade names Durazym ®, relase ®, Everlase® ®, Nafizym, Natalase ®, Kannase® ® and Ovozymes ® from Novozymes, under the trade names Purafect ®, Purafect ® OxP and Properase.RTM ® by the company Genencor, that under the trade name Protosol® ® from Advanced Biochemicals Ltd., Thane, India, under the trade name WuxP from Wuxi Snyder Bioproducts Ltd., China, under the trade names Proleather® ® and protease P ® from Amano Pharmaceuticals Ltd., Nagoya, Japan, and the enzyme available under the name Proteinase K-16 from Kao Corp., Tokyo, Japan.
- the subject of the invention are preferably circular permutation variants of these enzymes as well as homologs thereof, preferably with the homology and identity values given above.
- the circularly permutated subtilisin is particularly preferably a circularly permuted BLAP protease having an initial sequence according to SEQ ID NO: 1, a circularly permuted BPN '-proease having an initial sequence according to SEQ ID NO: 2 or a circularly permuted subtilisin Carlsberg with an initial sequence according to SEQ ID NO: 3 as well as homologs thereof.
- the original termini of the mature starting enzyme are preferably linked to one another by any linker of a length of 1 to 40, particularly preferably 5 to 30, in particular 10 to 20, amino acids.
- a linker with a length of 10 to 20 amino acids particularly preferably a linker with 12 to 16 amino acids, especially a linker with 13, 14 or 15 amino acids is used, in particular the linker GAATSGKLNGSTAG (SEQ ID NO : 4).
- the linker may in principle be an oligopeptide or polypeptide of any desired sequence. It may be necessary to ensure that the sequence of the linker is chosen so that the linker has sufficient flexibility to link the two original termini of the starting protein. For example, the previously mentioned linker with the sequence GAATSGKLNGSTAG has proven to be suitable for bridging the BLAP proteases. Basically, of course, any other linker can be used to link the original term.
- the sequence of the linker is of lesser importance for the function of an enzyme because it is far from the active site of the enzyme.
- the new terms of the circular permutation variant are preferably at least 10 amino acids, more preferably at least 20 amino acids, more preferably at least 30, 35 or 40 amino acids away from the original termini.
- the new terms of the circular permutation variants are located outside the actual tertiary structure, in particular in the region of loop structures of the starting enzyme, ie in regions which lie outside the complex folding of the protein and instead have bridging properties.
- termini of the circularly permuted BLAP protease are therefore in this embodiment between the amino acids 1-4, 10-14, 18-26, 32-45, 49-62, 70-76, 78-87, 93-102, 115 -118, 122-131, 142-146, 154-169, 175-179, 181-183, 185-192, 196-199, 203-207, 211-215, 231-237, 247-264 or 267-268 of the starting enzyme.
- the terms of the circularly permuted BPN 'protease are therefore correspondingly in this embodiment between the amino acids 1-7, 10-14, 19-26, 32-46, 50-64, 95-104, 17-120, 124- 133, 145-148, 156-175, 181-185, 187-189, 191-198, 202-205, 209-213, 217-220, 237-243, 252-270, or 273-275 of the parent enzyme.
- the terms of the circularly permutated subtilisin Carlsberg are therefore correspondingly in this embodiment between amino acids 1-7, 9-13, 19-26, 32-46, 50-64, 72-89, 95-104, 116-121, 124 -134, 145-148, 156-175, 181-185, 187-189, 191-198, 202-205, 209-213, 217-220, 237-243, 250-270 or 274-275 of the parent enzyme.
- the localization of the new termini in a loop structure or in a similar region outside the actual tertiary structure of the parent enzyme is not required for the functionality of the enzyme, but it is also possible that the new termini in the middle of the tertiary and / or quaternary structure of the folded source protein without interfering with the activity or stability of the enzyme.
- the termini of the circularly permuted protein are therefore not in the range of loop structures in this embodiment.
- termini of the circularly permuted BLAP protease are therefore in this embodiment between amino acids 4-10, 14-18, 26-32, 45-49, 62-70, 76-78, 87-93, 102-115, 118 -122, 131-142, 146-154, 169-175, 179-181, 183-185, 192-196, 199-203, 207-211, 215-231, 237-247, 264-267 or 268 end of the starting enzyme.
- the terms of the circularly permuted BPN 'protease are therefore correspondingly in this embodiment between amino acids 7-10, 14-19, 26-32, 46-50, 64-95, 104-117, 120-124, 133-145, 148-156, 175-181, 185-187, 189-191, 198-202, 205-209, 213-217, 220-237, 243-252, 270-273 or 275 end of the parent enzyme.
- the terms of the circularly permutated subtilisin Carlsberg are therefore correspondingly in this embodiment between amino acids 7-9, 13-19, 26-32, 46-50, 64-72, 89-95, 104-116, 121-124, 134 -145, 148-156, 175-181, 185-187, 189-191, 198-202, 205-209, 213-217, 220-237, 243-250, 270-274 or 275 end of the parent enzyme.
- the circular permutation variants of BLAP are selected from polypeptides having a sequence homology and / or identity of at least 80%, preferably at least 85 or 90%, more preferably at least 95, 98 or 99%, to a polypeptide according to SEQ ID NO: 5 or according to SEQ ID NO: 6 and / or of polypeptides having insertions, deletions or inversions of up to 30, 25 or 20, preferably up to 18, 16, 14 or 12, particularly preferably up to 10, 9, 8, 7 or 6, in particular up to 5, 4, 3 or 2 amino acids, in particular with insertions or deletions of exactly one amino acid with respect to a polypeptide having a polypeptide sequence according to SEQ ID NO: 5 or according to SEQ ID NO: 6.
- the measure of homology is a percentage of identity, such as can be determined, for example, according to the method given by D. J. Lipman and W. R. Pearson in Science 227 (1985), pp. 1435-1441. This indication may refer to the entire protein or to the respective region to be assigned.
- a broad homology term, similarity also includes conserved variations, that is, amino acids with similar chemical activity, as these usually perform similar chemical activities within the protein. With nucleic acids one knows only the percentage of identity.
- the complete sequence of the particular polypeptide (or polynucleotide) according to the invention or the complete sequence of the particular polypeptide region (or polynucleotide region) of the invention is to be considered, and not just the overlapping region between them Polypeptide (or polynucleotide) or polypeptide region (or polynucleotide region) and comparative protein (or comparative nucleotide). If the homology and identity information relates to a polypeptide according to the invention excluding the linker peptide, the polypeptide sequence which is bridged by the linker is to be regarded as a continuous sequence. This also applies analogously to the polynucleotide sequence coding for a polypeptide according to the invention.
- Another object of the present invention are vectors, in particular cloning and expression vectors containing polynucleotides of the invention, and cells, in particular host cells containing polynucleotides according to the invention, vectors and / or polypeptides.
- the cells are selected from Gram-negative bacteria, in particular those of the genera Escherichia coli or Klebsiella, in particular from the strains of E. coli K12, E. coli B or Klebsiella planticola, and more particularly from derivatives of the strains Escherichia coli BL21 ( DE3), E. coli RV308, E. coli DH5 ⁇ , E. coli JM 109, E. coli XL-1 or Klebsiella planticola (Rf).
- the cells are selected from Gram-positive bacteria, especially those of the genera Bacillus, Staphylococcus or Corynebacteria, more particularly of the species Bacillus lentus, B. licheniformis, B. amyloliquefaciens, B. subtilis, B. globigii, B. gibsonii, B. pumilus or B. alcalophilus, Staphylococcus carnosus or Corynebacterium glutamicum.
- Gram-positive bacteria especially those of the genera Bacillus, Staphylococcus or Corynebacteria, more particularly of the species Bacillus lentus, B. licheniformis, B. amyloliquefaciens, B. subtilis, B. globigii, B. gibsonii, B. pumilus or B. alcalophilus, Staphylococcus carnosus or Corynebacterium glutamicum.
- a further subject of the invention are agents which form the aforementioned invention
- compositions especially mixtures, formulations, solutions, etc., the utility of which is improved by addition of a protein of the invention described above, within the scope of the present invention.
- these may be, for example, solid mixtures, for example powders with freeze-dried or encapsulated proteins, or gel or liquid agents.
- Preferred formulations contain, for example, buffer substances, stabilizers, reaction partners and / or cofactors of the proteases and / or other ingredients synergistic with the proteases. In particular, this appropriation is to be understood as the areas of application set out below. Further applications emerge from the prior art.
- Possible fields of use here are, in particular, the use for obtaining or treating raw materials or intermediates in textile production, in particular for removing protective layers on fabrics, in particular wool or silk, and the use for the care of textiles, the natural fibers, in particular wool or silk, contain.
- the invention also relates to processes for the treatment of textile raw materials and for textile care, in which polypeptides according to the invention are used in at least one of the process steps.
- processes for textile raw materials, fibers or textiles with natural constituents, in particular those with wool or silk may be, for example, processes in which materials for processing in textiles be prepared, for example, the anti-fungal equipment, or for example methods that enrich the cleaning of worn textiles to a nourishing component.
- Another use according to the invention is the use of the polypeptides according to the invention in cosmetic agents.
- This is understood to mean all types of cleansing and conditioning agents for human skin or hair, in particular cleansing agents.
- the agent may also be a pharmaceutical agent depending on the purpose of use.
- compositions according to the invention are shampoos, soaps, washing lotions, creams, peels and mouth, tooth or denture care agents.
- these compositions may also contain constituents, as mentioned below for detergents and cleaners.
- a particularly preferred subject according to the invention are detergents and cleaners containing polypeptides according to the invention.
- washing and cleaning agents with a protease preferred according to the invention surprisingly found an increase in the washing performance compared to agents with conventionally employed proteases.
- the washing performance or the cleaning performance of a washing or cleaning agent is to be understood as meaning the effect that the considered means on the soiled articles, for example, textiles or objects with hard surfaces exerts.
- Individual components of such agents, in particular the enzymes according to the invention are assessed with regard to their contribution to the washing or cleaning performance of the entire detergent or cleaning agent. It should be noted in particular that from the enzymatic properties of an enzyme can not be readily deduced to its contribution to the washing performance of an agent. Rather, in addition to the enzymatic activity, factors such as stability, substrate binding, binding to the items to be cleaned or interactions with other ingredients of the detergents or cleaning agents, in particular possible synergy effects in the removal of the contaminants, also play a role here.
- Another object of the present invention are therefore detergents and cleaning agents, in particular surfactant and / or bleach-containing, containing a polypeptide of the invention.
- the detergents and cleaning agents according to the invention may be any conceivable type of cleaning agent, both concentrates and agents to be used undiluted, for use on a commercial scale, in the washing machine or in hand washing or cleaning.
- These include, for example, detergents for textiles, carpets, or natural fibers, for which according to the present invention the term laundry detergent is used.
- laundry detergent includes, for example, dishwashing detergents for dishwashers or manual dishwashing detergents or cleaners for hard surfaces such as metal, glass, porcelain, ceramics, tiles, stone, painted surfaces, plastics, wood or leather; for such according to the present invention, the term cleaning agent is used.
- sterilizing and disinfecting agents are to be regarded as detergents and cleaners in the sense of the invention.
- Embodiments of the present invention include all of the prior art and / or all suitable administration forms of the washing or cleaning agents according to the invention. These include, for example, solid, powdery, liquid, gelatinous or pasty agents, optionally also of several phases, compressed or uncompressed; further include, for example: extrudates, granules, tablets or pouches, packed both in large containers and in portions.
- a washing or cleaning agent according to the invention optionally contains further ingredients such as further enzymes, enzyme stabilizers, surfactants, for.
- further ingredients such as further enzymes, enzyme stabilizers, surfactants, for.
- constituents of the abovementioned groups which can be used according to the invention, reference is also made in particular to the application DE 102007049830.8.
- Surfactants are present in cleaning agents or detergents according to the invention as a whole preferably in an amount of from 5 to 50% by weight, particularly preferably from 8 to 30% by weight, based on the finished composition, wherein in a preferred embodiment at least one nonionic surfactant is used.
- the content of detergents or cleaning agents in bleaching agents may be from 1 to 40% by weight and in particular from 10 to 20% by weight, it being advantageous to use perborate monohydrate or percarbonate as the bleaching agent.
- Builder substances may optionally be present in the detergents or cleaners according to the invention in amounts of up to 90% by weight. They are preferably contained in amounts of up to 75% by weight.
- Thickeners are preferably present in compositions according to the invention in an amount of up to 5% by weight, in particular from 0.05 to 2% by weight and more preferably from 0.1 to 1.5% by weight, based on the finished composition, contain.
- compositions according to the invention may comprise further enzymes in addition to the polypeptides according to the invention for increasing the washing or cleaning performance, it being possible in principle to use all enzymes established for this purpose in the prior art.
- enzymes include in particular other proteases, amylases, lipases, hemicellulases, cellulases or oxidoreductases, and preferably mixtures thereof.
- These enzymes are basically of natural origin; Starting from the natural molecules, improved variants are available for use in detergents and cleaners, which are preferably used accordingly.
- Agents according to the invention preferably contain these further enzymes in total amounts of 1 ⁇ 10 -6 to 5 percent by weight, based on active protein.
- subtilisin-type enzymes which have been described previously are preferred, as well as other detergent proteases which have also been described previously.
- subtilisin Carlsberg is in developed form under the trade names Alcalase ® from Novozymes A / S, Bagsvaerd, Denmark.
- the subtilisins 147 and 309 are sold under the trade names Esperase ®, or Savinase ® from Novozymes.
- BLAP ® variants of the protease from Bacillus lentus DSM 5483 (WO 91/02792 A1) to derive, in particular, in WO 92/21760 A1, WO 95/23221 A1, WO 02/088340 A2 and WO 03 / 038082 A2.
- Further useful proteases from various Bacillus sp. And B. gibsonii strains are found in the patent applications WO 03/054185, WO 03/056017, WO 03/055974 and WO 03/054184.
- proteases are, for example, under the trade names Durazym ®, relase ®, Everlase® ®, Nafizym, Natalase ®, Kannase® ® and Ovozymes ® from Novozymes, under the trade names Purafect ®, Purafect ® OxP and Properase.RTM ® by the company Genencor, that under the trade name Protosol® ® from Advanced Biochemicals Ltd., Thane, India, under the trade name WuxP from Wuxi Snyder Bioproducts Ltd., China, under the trade names Proleather® ® and protease P ® from Amano Pharmaceuticals Ltd., Nagoya, Japan, and the enzyme available under the name Proteinase K-16 from Kao Corp., Tokyo, Japan.
- amylases which can be used according to the invention are the ⁇ -amylases from Bacillus licheniformis, B. amyloliquefaciens or B. stearothermophilus and also their further developments improved for use in detergents and cleaners.
- the enzyme from B. licheniformis is available from Novozymes under the name Termamyl ® and from Genencor under the name Purastar® ® ST. Development products of this ⁇ - amylase are available from Novozymes under the trade names Duramyl ® and Termamyl ® ultra, from Genencor under the name Purastar® ® OxAm and from Daiwa Seiko Inc., Tokyo, Japan, as Keistase ®.
- the ⁇ -amylase from B. amyloliquefaciens is marketed by Novozymes under the name BAN ®, and variants derived from the ⁇ -amylase from B. stearothermophilus under the names BSG ® and Novamyl ®, likewise from Novozymes.
- Further usable commercial products are, for example, the amylase LT® and Stainzyme®, the latter also from Novozymes.
- ⁇ -amylase from Bacillus sp. Disclosed in the application WO 02/10356 A2 for this purpose.
- a 7-7 (DSM 12368) and the cyclodextrin glucanotransferase (CGTase) from B. agaradherens (DSM 9948) described in the application WO 02/44350 A2.
- the amylolytic enzymes which belong to the sequence space of ⁇ -amylases, which is defined in the application WO 03/002711 A2, and those which are described in the application WO 03/054177 A2 can be used.
- fusion products of the molecules mentioned can be used, for example those from application DE 10138753 A1.
- compositions according to the invention may contain lipases or cutinases, in particular because of their triglyceride-cleaving activities, but also in order to generate in situ peracids from suitable precursors.
- lipases or cutinases include, for example, the lipases originally obtainable from Humicola lanuginosa (Thermomyces lanuginosus) or further developed, in particular those with the amino acid exchange D96L. They are sold, for example, by Novozymes under the trade names Lipolase ®, Lipolase Ultra ®, LipoPrime® ®, Lipozyme® ® and Lipex ®.
- the cutinases can be used, which were originally isolated from Fusarium solani pisi and Humicola insolens.
- lipases are available from Amano under the designations Lipase CE ®, Lipase P ®, Lipase B ®, or lipase CES ®, Lipase AKG ®, Bacillis sp. Lipase® , Lipase AP® , Lipase M- AP® and Lipase AML® are available. From the company Genencor, for example, the lipases, or cutinases can be used, the initial enzymes were originally isolated from Pseudomonas mendocina and Fusarium so / an / V.
- Detergents according to the invention may contain cellulases, depending on the purpose, as pure enzymes, as enzyme preparations or in the form of mixtures in which the individual components advantageously supplement each other in terms of their various performance aspects.
- These performance aspects include in particular contributions to the primary washing performance, to the secondary washing performance of the agent
- EG endoglucanase
- Novozymes under the trade name Celluzyme ®.
- the products Endolase® ® and Carezyme ® likewise available from Novozymes, are based on the 50 kD EG and 43 kD EG from H. insolens DSM 1800.
- Further commercial products of this company are Cellusoft® ® and Renozyme ®. The latter is based on the application WO 96/29397 A1.
- Performance-enhanced cellulase variants are disclosed, for example, in the application WO 98/12307 A1.
- the cellulases disclosed in the application WO 97/14804 A1 can be used; For example, it revealed 20 kD EG Melanocarpus, available from AB Enzymes, Finland, under the trade names Ecostone® ® and Biotouch ®. Other commercial products of the company AB Enzymes are Econase ® and Ecopulp ® . Other suitable cellulases from Bacillus sp. CBS 670.93 and CBS 669.93 are disclosed in WO 96/34092 A2, wherein those derived from Bacillus sp. CBS 670.93 from the company Genencor under the trade name Puradax ® is available. Further commercial products of the company Genencor are "Genencor detergent cellulase L" and lndiAge ® Neutra.
- compositions according to the invention may, in particular for the removal of certain problem soiling, comprise, in addition to the polypeptides according to the invention, further enzymes which are combined under the term hemicellulases.
- further enzymes which are combined under the term hemicellulases.
- Suitable mannanases are available, for example under the name Gamanase ® and Pektinex AR ® from Novozymes, under the name Rohapec ® B1 L from AB Enzymes and under the name Pyrolase® ® from Diversa Corp., San Diego, CA, USA ,
- a suitable ⁇ -glucanase from a B. alcalophilus is disclosed, for example, in the application WO 99/06573 A1.
- the obtained from B. subtilis beta-glucanase is available under the name Cereflo ® from Novozymes.
- detergents and cleaners according to the invention may be oxidoreductases, for example oxidases, oxygenases, catalases, peroxidases, such as halo, chloro, bromo, lignin, glucose or manganese peroxidases, dioxygenases or laccases (phenol oxidases, polyphenol oxidases) contain.
- oxidases oxygenases, catalases, peroxidases, such as halo, chloro, bromo, lignin, glucose or manganese peroxidases, dioxygenases or laccases (phenol oxidases, polyphenol oxidases) contain.
- Suitable commercial products Denilite® ® 1 and 2 from Novozymes should be mentioned.
- organic, particularly preferably aromatic, compounds which interact with the enzymes in order to enhance the activity of the relevant oxidoreductases (enhancers) or to ensure the flow of electrons (mediators) at greatly varying redox potentials between the oxidizing enzymes and the soils.
- Agents according to the invention can be added to the polypeptides according to the invention as well as the additionally used enzymes in any form established according to the prior art.
- These include, for example, the solid preparations obtained by granulation, extrusion or lyophilization or, especially in the case of liquid or gel-form detergents, solutions of the enzymes, advantageously as concentrated as possible, sparing in water and / or added with stabilizers.
- these proteins can be encapsulated for both the solid and liquid dosage forms, for example, by spray-drying or extruding the enzyme solution together with a preferably natural polymer or in the form of capsules, for example those in which the enzymes are entrapped as in a solidified gel or in those of the core-shell type, in which an enzyme-containing core is coated with a water, air and / or chemical impermeable protective layer.
- further active ingredients for example stabilizers, emulsifiers, pigments, bleaches or dyes, may additionally be applied.
- Such capsules are known per se Methods, for example, by shaking or rolling granulation or applied in fluid-bed processes.
- such granules for example by applying polymeric film-forming agent, low in dust and storage stable due to the coating.
- a protein contained in an agent according to the invention in particular also the polypeptide according to the invention, can be protected against damage, for example inactivation, denaturation or decomposition, for example by physical influences, oxidation or proteolytic cleavage, especially during storage.
- damage for example inactivation, denaturation or decomposition, for example by physical influences, oxidation or proteolytic cleavage, especially during storage.
- inhibition of proteolysis is particularly preferred, especially if the agents also contain proteases.
- Preferred agents according to the invention contain stabilizers for this purpose.
- One group of stabilizers are reversible protease inhibitors.
- Benzamidine hydrochloride, borax, boric acids, boronic acids or their salts or esters are frequently used for this purpose, including, in particular, derivatives with aromatic groups, for example ortho, meta or para-substituted phenylboronic acids, in particular 4-formylphenylboronic acid, or the salts or Esters of the compounds mentioned.
- peptide aldehydes that is oligopeptides with a reduced C-terminus, especially those of 2 to 50 monomers are used for this purpose.
- the peptidic reversible protease inhibitors include, among others, ovomucoid and leupeptin.
- specific, reversible peptide inhibitors for the protease subtilisin and fusion proteins from proteases and specific peptide inhibitors are suitable.
- enzyme stabilizers are amino alcohols such as mono-, di-, triethanol- and -propanolamine and mixtures thereof, aliphatic carboxylic acids up to C12, such as succinic acid, other dicarboxylic acids or salts of said acids. End-capped fatty acid amide alkoxylates are also suitable for this purpose. Certain organic acids used as builders are capable, as disclosed in WO 97/18287, of additionally stabilizing a contained enzyme.
- Lower aliphatic alcohols but especially polyols such as glycerol, ethylene glycol, propylene glycol or sorbitol are other frequently used enzyme stabilizers.
- Di-glycerol phosphate also protects against denaturation due to physical influences.
- calcium and / or magnesium salts are used, such as calcium acetate or calcium formate.
- Polyamide oligomers or polymeric compounds such as lignin, water-soluble vinyl copolymers or cellulose ethers, acrylic polymers and / or polyamides stabilize the enzyme preparation, inter alia, against physical influences or pH fluctuations.
- Polyamine N-oxide containing polymers act simultaneously as enzyme stabilizers and as dye transfer inhibitors.
- polymeric stabilizers are linear C 8 -C 8 polyoxyalkylenes.
- alkylpolyglycosides can stabilize the enzymatic components of the agent according to the invention and are able, preferably, to additionally increase their performance.
- Crosslinked N-containing compounds preferably perform a dual function as soil release agents and as enzyme stabilizers.
- Hydrophobic, nonionic polymer stabilizes in particular an optionally contained cellulase.
- Reducing agents and antioxidants increase the stability of the enzymes to oxidative degradation;
- sulfur-containing reducing agents are familiar.
- Other examples are sodium sulfite and reducing sugars.
- peptide-aldehyde stabilizers for example of polyols, boric acid and / or borax, the combination of boric acid or borate, reducing salts and succinic acid or other dicarboxylic acids or the combination of boric acid or borate with polyols or polyamino compounds and with reducing salts.
- the effect of peptide-aldehyde stabilizers is favorably enhanced by the combination with boric acid and / or boric acid derivatives and polyols, and still further by the additional action of divalent cations, such as calcium ions.
- polypeptides according to the invention in all formulations suitable for addition to the respective compositions represent respective embodiments of the present invention. These include, for example, liquid formulations, solid granules or capsules.
- the encapsulated form lends itself to protecting the enzymes or other ingredients from other ingredients, such as bleaches, or to allow for controlled release.
- Such capsules are disclosed, for example, with the patent applications WO 97/24177 and DE 19918267.
- a possible encapsulation method is that the proteins are encapsulated in this substance, starting from a mixture of the protein solution with a solution or suspension of starch or a starch derivative. Such an encapsulation process is described in the application WO 01/38471.
- the proteins - polypeptides according to the invention as well as optionally contained further enzymes - for example in dried, granulated and / or encapsulated form can be used. They may be added separately, ie as a separate phase, or with other ingredients together in the same phase, with or without compaction. If microencapsulated enzymes are to be processed in solid form, the water can be removed by methods known from the prior art from the aqueous solutions resulting from the workup, such as spray drying, centrifuging or by solubilization. The particles obtained in this way usually have a particle size between 50 and 200 microns.
- the proteins may be added to liquid, gelatinous or pasty agents according to the invention in a concentrated aqueous or non-aqueous solution, suspension or emulsion starting from a protein recovery and preparation carried out in the prior art, but also in gel form or encapsulated or as a dried powder.
- Such detergents or cleaners according to the invention are generally prepared by simple mixing of the ingredients which can be added in bulk or as a solution in an automatic mixer.
- a cleaning agent according to the invention in particular a hard surface cleaner according to the invention, may also contain one or more propellants (INCI propellants), usually in an amount of 1 to 80% by weight, preferably 1 to 5 to 30% by weight, in particular 2 to 10 wt .-%, particularly preferably 2.5 to 8 wt .-%, most preferably 3 to 6 wt .-%, contained.
- one or more propellants ICI propellants
- a particular embodiment of the present invention represents the use of a polypeptide according to the invention for the activation, deactivation or release of ingredients of detergents or cleaners.
- a special subject matter of the invention furthermore relates to processes for the purification of textiles or of hard surfaces in which a polypeptide according to the invention is used at least in one of the process steps.
- a further subject of the invention is the use of an alkaline protease according to the invention for cleaning textiles or hard surfaces.
- Another object of the present invention is also a product comprising a composition according to the invention or a detergent or cleaning agent according to the invention, in particular a hard surface cleaner according to the invention, and a spray dispenser.
- the product may be both a single chamber and a single chamber to act a multi-chamber container, in particular a two-chamber container.
- the spray dispenser is preferably a manually activated spray dispenser, in particular selected from the group consisting of aerosol spray dispensers (pressurized gas containers, also known as spray can), pressure-building spray dispensers, pump spray dispensers and trigger spray dispensers, in particular pump spray dispensers and trigger spray dispensers with a container made of transparent polyethylene or polyethylene terephthalate.
- Spray dispensers are described in more detail in WO 96/04940 (Procter & Gamble) and the US patents cited therein about spray dispensers, to which reference is made in this regard and the contents of which are hereby incorporated by reference.
- Triggersprühspender and pump sprayer have over compressed gas tanks the advantage that no propellant must be used.
- the enzyme in this embodiment may optionally also be added to the composition in a form immobilized on particles and thus metered as cleaning foam.
- the gene for a mature protease is flanked with the fragments of DNA for a variable linker (linker P, length 1-40 amino acids) on both sides and the resulting construct cloned into a plasmid (the starting plasmid).
- linker P variable linker
- two coding for the linker P DNA fragments are located restriction enzyme cleavage sites that form after a restriction digest matching mounts.
- the construct obtained by restriction digestion is closed by a ligase to form a ring.
- the length of the linker P is chosen so that the distance between the C and N terminus in the native protein can be bridged.
- the ring is then enzymatically opened at a random site to yield a nucleic acid encoding a mature protease with novel C and N termini.
- a screening method then, by using a screening plasmid in a suitable host, those nucleic acids obtained by circular permutation can be identified, which code for an active protease with as far as possible improved properties.
- the nucleic acid coding for the prepropeptide of the protease is optionally provided at the 3 'end with a nucleic acid coding for a variable linker (linker L, length 0-40 amino acids) and cloned into a plasmid (the screening plasmid) which is a promoter for contains the expression of the constructs to be screened and is optionally equipped with a resistance gene.
- a variable linker linker L, length 0-40 amino acids
- restriction enzymes in the 3 'direction from the nucleic acid coding for the prepropeptide or, if present, in the 3' direction from the nucleic acid coding for the linker L for the nucleic acid coding for the prepropeptide Cleavage sites to allow blunt-end cloning to incorporate the circular permutation mutant obtained by the method described above and to subsequently label them.
- the length of the linker L depends on the distance between the new C-terminus of the mature protease and the prepropeptide's positioning relative to the new C-terminus required for correct preproprotein processing. According to the invention, it has surprisingly been found that the linker L can be dispensed with as a rule, since the preproprotein is generally processed successfully despite the changed position of the prepro peptide.
- the starting plasmid is digested with the appropriate enzymes as directed by the enzyme manufacturers to obtain the mature protein-encoding gene flanked by the nucleic acid encoding the linker P-fragments.
- the digest is separated in an agarose gel and then the desired band is excised. Gel elution is carried out with a kit according to the distributor's protocol.
- the ligation mixture is prepared with a concentration of DNA of 1-5.5 ng / ⁇ L in ligase buffer and started by addition of 1-40 units ligase.
- digestion with exonuclease III is performed at 37 ° C.
- the digestion product is separated in an agarose gel and the band of the desired size is excised. Gel elution is done with a kit according to protocol.
- the linearized DNA is cloned into a prepared screening vector and transformed into a protease-negative Bacillus strain. The resulting colonies are screened for protease activity.
- Example 2 Circular permutation of the BLAP protease using a 14 amino acid linker
- the gene of the mature BLAP protease was used, and a linker with a length of 14 amino acids of the sequence GAATSGKLNGSTAG (SEQ ID NO: 1) was used as linker for bridging N- and C-terminus.
- the flanked construct shown below was obtained (shown is not the DNA itself, but the protein sequence corresponding to the DNA):
- STNLYGSGLVNAEAATbAATSGK fSEQ ID NO: 7 The two linker fragments are underlined. The beginning and the end of the mature protein are framed by boxes.
- Holland o peanut oil pigment / ink on polyester / cotton product no. PC10 from CFT B.V.
- test tissues round pieces of the test tissues (diameter 10 mm) were incubated in a 24-well microtiter plate in 1 ml of wash liquor for 30 min at 37 ° C. and a shaking frequency of 100 rpm. Each experiment was carried out in triplicate.
- the whiteness of the washed fabrics was measured in comparison to a white standard (d / 8, 8mm, SCI / SCE) normalized to 100% (determination of L value).
- the measurement was carried out on a colorimeter (Minolta Cm508d) with a Light setting of 107D65. The results obtained are reported as percent power, with the difference in remission values from the base detergent without enzymes to that with WT protease normalized to 100%.
- the NHT04240353 variant surprisingly has around 50% better wholey / soot and cocoa cleaning performance than the wild-type BLAP, while the cleaning performance over grass and milk / oil is about as good as that of the wild type and cleaning performance Blood / milk / ink and chocolate milk / soot is slightly worse than the wild type.
- the figures show the results of the washing experiments with the circular permutation variant NHT04240353 according to Example 3.
- Fig. 1 the results of the washing tests with blood / milk / ink, whole / soot and chocolate milk / soot are shown.
- Fig. 2 the results of the washing tests with grass, milk / oil, cocoa and again blood / milk / ink are shown.
- the results with the wild type (WT), so BLAP, are set to 100%.
- Loops of BLAP (Bacillus lentus Alkaline Protease) The loops are in the following sequence sections:
- amino acid sequence of BLAP is as follows:
- the loops are in the following sequence sections:
- the loops are in the following sequence sections:
- subtilisin Carlsberg The amino acid sequence of subtilisin Carlsberg is as follows:
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Mycology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Enzymes And Modification Thereof (AREA)
- Detergent Compositions (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Cosmetics (AREA)
Abstract
The present invention relates to a process for obtaining novel protein variants by circular permutation and also the novel protein variants obtained by this process.
Description
„Neue Proteinvarianten durch zirkuläre Permutation" "New protein variants by circular permutation"
Die vorliegende Erfindung betrifft ein Verfahren zur Gewinnung neuer Proteinvarianten durch zirkuläre Permutation sowie die durch dieses Verfahren gewonnenen neuen Proteinvarianten.The present invention relates to a method for obtaining novel protein variants by circular permutation and the novel protein variants obtained by this method.
Zur Optimierung von Eigenschaften bekannter Waschmittel- Enzyme werden in der Regel Mutationsverfahren eingesetzt, bei denen entweder zielgerichtet oder durch Zufall Mutationen erzeugt werden oder durch Insertion oder Deletion Aminosäuren eingefügt oder entfernt werden.In order to optimize the properties of known detergent enzymes, mutation methods are generally used in which either targeted or random mutations are generated or amino acids are inserted or removed by insertion or deletion.
Alternativen zu herkömmlichen Mutationsverfahren stellen sogenannte zirkuläre Permutationsverfahren dar. Zirkulare Permutationsverfahren sind im Stand der Technik grundsätzlich schon seit längerem beschrieben. So ist etwa Graf und Schachmann (Proc. Natl. Acad. Sei. USA (1996) 93, 11591 -11596) eine Übersicht über Enzyme und andere Proteine zu entnehmen, mit denen zirkuläre Permutationsverfahren durchgeführt worden sind.Alternatives to conventional mutation methods are so-called circular permutation methods. Circular permutation methods have in principle been described for some time in the prior art. For example, Graf and Schachmann (Proc Natl Acad., USA (1996) 93, 11591-11596) provide an overview of enzymes and other proteins with which circular permutation methods have been carried out.
Bei Zirkularen Permutationsverfahren werden N- und C-Terminus des mutierten Proteins gentechnisch neu festgelegt. Man geht grundsätzlich davon aus, dass zirkuläre Permutationsverfahren nur bei solchen Proteinen durchführbar sind, bei denen N- und C-Terminus dicht bei einander liegen, so dass die zirkuläre Permutation die Gesamtstruktur des Proteins im Wesentlichen unverändert lässt.In circular permutation methods, the N- and C-terminus of the mutated protein are genetically engineered. It is generally assumed that circular permutation methods are feasible only for those proteins in which the N and C terminus are close to each other, so that the circular permutation leaves the overall structure of the protein substantially unchanged.
Den bislang bekannten Enzymen und Proteinen, mit denen Permutationsverfahren durchgeführt worden sind, ist des Weiteren gemeinsam, dass das Protein unmittelbar in aktiver Form exprimiert wird. Es gibt jedoch auch Gruppen von Proteinen, und insbesondere von Enzymen, die in einer inaktiven Vorform, als Präprotein, Proprotein oder Präproprotein, exprimiert werden und erst nach der Expression durch enzymatische Spaltung in die aktive Form überführt werden. Der „prä-Teil" des Proteins ist hierbei ein Signalpeptid, das für die Zielsteuerung des exprimierten Proteins in das richtige Zellkompartiment verantwortlich ist, während der „pro-Teil" des Proteins das Protein in inaktiver Form hält, bis es durch Aktivierung am Zielort am geeigneten Ort zur geeigneten Zeit in die aktive Form überführt wird.The hitherto known enzymes and proteins with which permutation methods have been carried out are also common in that the protein is expressed directly in active form. However, there are also groups of proteins, and in particular of enzymes, which are expressed in an inactive preform, as a preprotein, proprotein or preproprotein, and are converted into the active form only after the expression by enzymatic cleavage. The "pre-part" of the protein is a signal peptide responsible for targeting the expressed protein into the correct cell compartment, while the "pro-part" of the protein keeps the protein inactive until it is activated by activation at the target site suitable place is converted into the active form at the appropriate time.
Bislang ist davon ausgegangen worden, dass zirkuläre Permutationsverfahren erfolgreich nur mit Proteinen durchgeführt werden können, die zum einen nahe beieinander lokalisierte N- und C- Termini aufweisen und die zum anderen natürlicherweise mit maturer Aminosäuresequenz, also ohne Prä-, Pro- und/oder Präpropeptid, exprimiert werden, da die Lokalisierung von Prä-, Pro- und/oder Präpropeptid in Bezug auf das mature Protein als essentiell für die korrekte Prozessierung und Faltung angesehen wurden.So far, it has been assumed that circular permutation methods can be carried out successfully only with proteins which on the one hand have localized N- and C-termini and, on the other hand, naturally with a mature amino acid sequence, that is to say without prepro-, pro- and / or prepropeptide , because the localization of pre-, pro- and / or prepropeptide with respect to the mature protein were considered to be essential for correct processing and folding.
Überraschenderweise wurde nun gefunden, dass entgegen allen Erwartungen auch bei solchen Proteinen, und insbesondere Enzymen, die natürlicherweise als Präprotein, Proprotein und/oder
Präproprotein exprimiert werden, mit Hilfe des zirkulären Permutationsverfahrens neue Proteinvarianten erhalten werden können, wenn man das zirkuläre Permutationsverfahren an der DNA des maturen Proteins durchführt und anschließend an die durch Permutation erhaltene DNA die DNA für das entsprechende Signalpeptid, Propeptid und/oder Präpropeptid anhängt.Surprisingly, it has now been found that contrary to all expectations, even with such proteins, and in particular enzymes, naturally as a preprotein, proprotein and / or Preproprotein can be expressed using the circular permutation process new protein variants can be obtained by performing the circular permutation of the DNA of the mature protein and then attached to the DNA obtained by permutation the DNA for the corresponding signal peptide, propeptide and / or prepropeptide.
Dies war insofern überraschend, als nicht zu erwarten war, dass das künstliche Konstrukt zum einen durch das Signalpeptid in das vorgesehene Zellkompartiment erfolgreich zielgesteuert werden würde, zum anderen auch die Faltung des Proteins trotz Lokalisierung von Signalpeptid und Propeptid an der „falschen Stelle" des Proteins erfolgreich vonstatten gehen würden, und des Weiteren auch noch Aktivierung des Proteins wie erwünscht erfolgen würde.This was surprising in that it was not to be expected that the artificial construct would be successfully targeted by the signal peptide in the intended cell compartment, on the other hand, the folding of the protein despite localization of signal peptide and propeptide in the "wrong place" of the protein would be successful, and further also activation of the protein would be done as desired.
Überraschenderweise wurde erfindungsgemäß insbesondere herausgefunden, dass durch zirkuläre Permutationsverfahren an Waschmittel-Enzymen neue Waschmittel-Enzyme aufgefunden werden können, die gegenüber den Ausgangsmolekülen verbesserte Eigenschaften aufweisen.Surprisingly, it has in particular been found according to the invention that circular detergent permutation processes for detergent enzymes enable new detergent enzymes to be found which have improved properties compared with the starting molecules.
Ein erster Gegenstand der vorliegenden Erfindung ist daher ein Verfahren zur Herstellung der für eine zirkuläre Permutationsvariante des maturen Proteins eines natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteins, insbesondere Enzyms, dadurch gekennzeichnet, dass die für das mature Protein kodierende DNA einem zirkulären Permutationsverfahren unterworfen wird.A first subject of the present invention is therefore a process for producing the circular permutation variant of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, in particular an enzyme, characterized in that the DNA coding for the mature protein is a circular permutation method is subjected.
Gegenstand der vorliegenden Erfindung sind daher auch Polynukleotide ausgewählt aus a) für zirkuläre Permutationsvarianten des maturen Proteins von natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteinen, insbesondere Enzyme, kodierende Polynukleotide, b) Mutanten von Polynukleotiden gemäß (a) mit einer Sequenzhomologie und/oder -identität von mindestens 80, vorzugsweise mindestens 85 oder 90 %, besonders bevorzugt mindestens 95, 98 oder 99 % gegenüber einem Polynukleotid gemäß (a), wobei sich der Sequenzvergleich in einer Ausführungsform auf das zirkulär permutierte Polynukleotid ohne das für den verbrückenden Linker kodierende Polynukleotid bezieht und in einer anderen Ausführungsform auf das zirkulär permutierte Polynukleotid einschließlich des für den verbrückenden Linker kodierenden Polynukleotids bezieht, c) Mutanten von Polynukleotiden gemäß (a) mit Substitutionen, Insertionen, Deletionen oder Inversionen von bis zu 50, 40 oder 30, vorzugsweise bis zu 25, 20 oder 15, besonders bevorzugt bis zu 10, 9, 8, 7 oder 6, vor allem bis zu 5, 4, 3 oder 2 Nukleotiden, insbesondere mit Insertionen oder Deletionen von genau einem Nukleotid in Bezug auf die Polynukleotidsequenz eines Polynukleotids gemäß (a), wobei sich der Sequenzvergleich in einer Ausführungsform auf das zirkulär permutierte Polynukleotid ohne das für den verbrückenden Linker kodierende Polynukleotid bezieht und in einer anderen
Ausführungsform auf das zirkulär permutierte Polynukleotid einschließlich des für den verbrückenden Linker kodierenden Polynukleotids bezieht, d) Polynukleotide, die Polynukleotide gemäß (a), (b) oder (c) umfassen, e) Polynukleotide, die für erfindungsgemäße zirkuläre Permutatiosvarianten kodieren, f) Polynukleotdie, die eine zu den Polynukleotiden gemäß (a), (b), (c), (d) oder (e) komplementäre Sequenz aufweisen.The present invention therefore also provides polynucleotides selected from a) for circular permutation variants of the mature protein of proteins naturally expressed as preprotein, proprotein and / or preproprotein, in particular enzymes, coding polynucleotides, b) mutants of polynucleotides according to (a) having a sequence homology and / or identity of at least 80, preferably at least 85 or 90%, more preferably at least 95, 98 or 99% to a polynucleotide according to (a), wherein the sequence comparison in one embodiment is to the circularly permuted polynucleotide without that for the bridging linker In another embodiment, referring to the circularly permuted polynucleotide including the polynucleotide encoding the bridging linker, c) mutants of polynucleotides according to (a) having substitutions, insertions, deletions or inversions of up to 50, 40 or 30, preferably up to 25, 20 or 15, more preferably up to 10, 9, 8, 7 or 6, especially up to 5, 4, 3 or 2 nucleotides, in particular with insertions or deletions of exactly one nucleotide in relation to the polynucleotide sequence of a polynucleotide according to (a), wherein in one embodiment the sequence comparison relates to the circularly permuted polynucleotide without the polynucleotide encoding the bridging linker and in another D) polynucleotides which comprise polynucleotides according to (a), (b) or (c), e) polynucleotides which code for circular permutation variants according to the invention, f) polynucleotides which have a sequence complementary to the polynucleotides according to (a), (b), (c), (d) or (e).
In einer erfindungsgemäß bevorzugten Ausführungsform kodieren erfindungsgemäße Polynukleotide für zirkuläre Permutationsvarianten von BLAP ausgewählt aus Polypeptiden mit einer Sequenzhomologie und/oder -identität von mindestens 80 %, vorzugsweise mindestens 85 oder 90 %, besonders bevorzugt mindestens 95, 98 oder 99 %, zu einem Polypeptid gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6 und/oder ausgewählt aus Polypeptiden mit Insertionen, Deletionen oder Inversionen von bis zu 30, 25 oder 20, vorzugsweise bis zu 18, 16, 14 oder 12, besonders bevorzugt bis zu 10, 9, 8, 7 oder 6, vor allem bis zu 5, 4, 3 oder 2 Aminosäuren, insbesondere mit Insertionen oder Deletionen von genau einer Aminosäure in Bezug auf ein Polypeptid mit einer Polypeptidsequenz gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6.In a preferred embodiment according to the invention polynucleotides according to the invention for circular permutation variants of BLAP selected from polypeptides having a sequence homology and / or identity of at least 80%, preferably at least 85 or 90%, more preferably at least 95, 98 or 99%, to a polypeptide according to SEQ ID NO: 5 or according to SEQ ID NO: 6 and / or selected from polypeptides having insertions, deletions or inversions of up to 30, 25 or 20, preferably up to 18, 16, 14 or 12, particularly preferably up to 10, 9, 8, 7 or 6, in particular up to 5, 4, 3 or 2 amino acids, in particular with insertions or deletions of exactly one amino acid with respect to a polypeptide having a polypeptide sequence according to SEQ ID NO: 5 or according to SEQ ID NO: 6th
Die Polynukleotide können als Einzelstrang oder als Doppelstrang vorliegen. Erfindungsgegenstand sind neben den Desoxyribonukleinsäuren auch die homologen und komplementären Ribonukleinsäuren.The polynucleotides may be present as a single strand or as a double strand. Subject matter of the invention are, besides the deoxyribonucleic acids, also the homologous and complementary ribonucleic acids.
Gegenstand der vorliegenden Erfindung sind insbesondere auch solche Polynukleotide, in denen bestimmte Bereiche unter Berücksichtigung der differierenden Codon-Usage eines für die Expression herangezogenen Wirtsorganismus durch andere Bereiche ersetzt wurden, um die Expression des erfindungsgemäßen Polypeptids zu ermöglichen.The present invention also relates, in particular, to those polynucleotides in which certain regions have been replaced by other regions, taking into account the differing codon usage of a host organism used for expression, in order to enable the expression of the polypeptide according to the invention.
Weiterer Gegenstand der vorliegenden Erfindung ist ein Verfahren zur Herstellung einer zirkulären Permutationsvariante des maturen Proteins eines natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteins, insbesondere Enzyms, folgende Schritte umfassend: a) Durchführung eines zirkulären Permutationsverfahrens mit der DNA des maturen Proteins, b) Einbau der mit dem Verfahren gemäß (a) erhaltenen DNA in einen geeigneten Vektor in 3'- Richtung zu derfür ei n Signalpeptid und/oder Präpropeptid kodierenden DNA, c) Einbringen des Vektors in einen geeigneten Wirt zur Expression der DNA, sowie d) gegebenenfalls Reinigung des erhaltenen Proteins.Another object of the present invention is a method for producing a circular permutation variant of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, in particular enzyme, comprising the following steps: a) performing a circular permutation method with the DNA of the mature protein, b ) Incorporation of the DNA obtained by the method according to (a) into a suitable vector in the 3 'direction to the DNA coding for a signal peptide and / or prepropeptide, c) introduction of the vector into a suitable host for expression of the DNA, and if appropriate, purification of the protein obtained.
Ein weiterer Gegenstand der vorliegenden Erfindung sind daher auch Polypeptide ausgewählt aus a) Zirkularen Permutationsvarianten, die mit einem erfindungsgemäßen Verfahren erhalten wurden, also zirkuläre Permutationsvarianten des maturen Proteins eines natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteins, b) Varianten von zirkulären Permutationsvarianten gemäß (a) mit einer Sequenzhomologie und/oder -identität von mindestens 80 %, bevorzugt mindestens 85 oder 90 %, besonders
bevorzugt von mindestens 95, 98 oder 99 % gegenüber der Sequenz einer zirkulären Permutationsvariante gemäß (a), wobei sich der Sequenzvergleich in einer Ausführungsform auf die Polypeptidsequenz der zirkulären Permutationsvariante ohne die Sequenz des Linkers bezieht und in einer anderen Ausführungsform auf die Polypeptidsequenz der zirkluaren Permutationsvariante einschließlich der Sequenz des Linkers bezieht, c) Varianten von zirkulären Permutationsvarianten gemäß (a) mit Substitutionen, Insertionen, Deletionen oder Inversionen von bis zu 30, 25 oder 20, vorzugsweise bis zu 18, 16, 14 oder 12, besonders bevorzugt bis zu 10, 9, 8, 7 oder 6, vor allem bis zu 5, 4, 3 oder 2 Aminosäuren, insbesondere mit Insertionen oder Deletionen von genau einer Aminosäure in Bezug auf die Polypeptidsequenz eines Polypeptids gemäß (a) ohne die Sequenz des Linkers, wobei sich der Sequenzvergleich in einer Ausführungsform auf die Polypeptidsequenz der zirkulären Permutationsvariante ohne die Sequenz des Linkers bezieht und in einer anderen Ausführungsform auf die Polypeptidsequenz der zirkluaren Permutationsvariante einschließlich der Sequenz des Linkers bezieht, d) Polypeptide, die Proteinvarianten gemäß (a), (b) oder (c) umfassen.A further subject of the present invention are therefore also polypeptides selected from a) circular permutation variants obtained by a method according to the invention, ie circular permutation variants of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, b) variants of circular permutation variants according to (a) with a sequence homology and / or identity of at least 80%, preferably at least 85 or 90%, especially preferably of at least 95, 98 or 99% over the sequence of a circular permutation variant according to (a), wherein the sequence comparison in one embodiment relates to the polypeptide sequence of the circular permutation variant without the sequence of the linker and in another embodiment to the polypeptide sequence of the zirkluaren permutation variant including the sequence of the linker, c) variants of circular permutation variants according to (a) with substitutions, insertions, deletions or inversions of up to 30, 25 or 20, preferably up to 18, 16, 14 or 12, particularly preferred up to 10 , 9, 8, 7 or 6, especially up to 5, 4, 3 or 2 amino acids, in particular with insertions or deletions of exactly one amino acid with respect to the polypeptide sequence of a polypeptide according to (a) without the sequence of the linker the sequence comparison in one embodiment to the polypeptide sequence of the circular permutation variant without e relates to the sequence of the linker and in another embodiment relates to the polypeptide sequence of the zirkluaren permutation variant including the sequence of the linker, d) polypeptides comprising protein variants according to (a), (b) or (c).
Unter „maturem Protein" ist erfindungsgemäß das Protein ohne Berücksichtigung des Signalpeptids und Propeptids zu verstehen.By "mature protein" is meant according to the invention the protein without regard to the signal peptide and propeptide.
Grundsätzlich kann man sich vorstellen, dass die zirkuläre Permutation ebenso wie andere Mutationsverfahren Auswirkungen auf unterschiedliche Eigenschaften des Proteins haben könnte, wie etwa auf die Stabilität des Proteins oder - bei Enzymen - auf die Aktivität oder Selektivität.In principle, one can imagine that circular permutation, as well as other mutational methods, could have effects on different properties of the protein, such as the stability of the protein or, in the case of enzymes, the activity or selectivity.
Erfindungsgemäß wurde überraschenderweise gefunden, dass durch zirkuläre Permutation die Waschleistung von Waschmittel-Enzymen gegenüber bestimmten Anschmutzungen deutlich verbessert werden kann.According to the invention, it has surprisingly been found that by circular permutation the washing performance of detergent enzymes can be markedly improved with respect to certain soils.
Bei der erfindungsgemäßen zirkulären Permutationsvariante handelt es sich daher vorzugsweise um die zirkuläre Permutationsvariante eines Enzyms, besonders bevorzugt einer Protease, vor allem einer alkalischen Protease vom Subtilisin-Typ.The circular permutation variant according to the invention is therefore preferably the circular permutation variant of an enzyme, particularly preferably a protease, in particular an alkaline protease of the subtilisin type.
Beispiele für alkalische Proteasen vom Subtilisin-Typ sind die Alkalische Protease aus Bacillus lentus (BLAP) sowie die Subtilisine BPN' und Carlsberg, weiterhin die Protease PB92, die Subtilisine 147 und 309, Subtilisin DY und die den Subtilasen, nicht mehr jedoch den Subtilisinen im engeren Sinne zuzuordnenden Enzyme Thermitase, Proteinase K und die Proteasen TW3 und TW7. Subtilisin Carlsberg ist in weiterentwickelter Form unter dem Handelsnamen Alcalase® von der Firma Novozymes A/S, Bagsvaerd, Dänemark, erhältlich. Die Subtilisine 147 und 309 werden unter den Handelsnamen Esperase®, beziehungsweise Savinase® von der Firma Novozymes vertrieben. Von der Protease aus Bacillus lentus DSM 5483 (WO 91/02792 A1 ) leiten sich die unter der Bezeichnung BLAP® geführten Varianten ab, die insbesondere in WO 92/21760 A1 ,
WO 95/23221 A1 , WO 02/088340 A2 und WO 03/038082 A2 beschrieben werden. Weitere verwendbare Proteasen aus verschiedenen Bacillus sp - und B. gibsonii-Stämmen gehen aus den Patentanmeldungen WO 03/054185, WO 03/056017, WO 03/055974 und WO 03/054184 hervor.Examples of subtilisin-type alkaline proteases are the Bacillus lentus alkaline protease (BLAP) and the subtilisins BPN 'and Carlsberg, the protease PB92, the subtilisins 147 and 309, subtilisin DY and the subtilases, but not the subtilisins in the enzymes Thermitase, Proteinase K and the proteases TW3 and TW7. Subtilisin Carlsberg in a developed form under the trade names Alcalase ® from Novozymes A / S, Bagsvaerd, Denmark. The subtilisins 147 and 309 are sold under the trade names Esperase ®, or Savinase ® from Novozymes. Of the protease from Bacillus lentus DSM 5483 (WO 91/02792 A1) the listed under the name BLAP ® variants are derived from, in particular, in WO 92/21760 A1, WO 95/23221 A1, WO 02/088340 A2 and WO 03/038082 A2 are described. Other useful proteases from various Bacillus sp and B. gibsonii strains are found in the patent applications WO 03/054185, WO 03/056017, WO 03/055974 and WO 03/054184.
Weitere brauchbare Proteasen sind beispielsweise die unter den Handelsnamen Durazym®, Relase®, Everlase®, Nafizym, Natalase®, Kannase® und Ovozymes® von der Firma Novozymes, die unter den Handelsnamen, Purafect®, Purafect®OxP und Properase® von der Firma Genencor, das unter dem Handelsnamen Protosol® von der Firma Advanced Biochemicals Ltd., Thane, Indien, das unter dem Handelsnamen WuxP von der Firma Wuxi Snyder Bioproducts Ltd., China, die unter den Handelsnamen Proleather® und Protease P® von der Firma Amano Pharmaceuticals Ltd., Nagoya, Japan, und das unter der Bezeichnung Proteinase K-16 von der Firma Kao Corp., Tokyo, Japan, erhältlichen Enzyme.Other usable proteases are, for example, under the trade names Durazym ®, relase ®, Everlase® ®, Nafizym, Natalase ®, Kannase® ® and Ovozymes ® from Novozymes, under the trade names Purafect ®, Purafect ® OxP and Properase.RTM ® by the company Genencor, that under the trade name Protosol® ® from Advanced Biochemicals Ltd., Thane, India, under the trade name WuxP from Wuxi Snyder Bioproducts Ltd., China, under the trade names Proleather® ® and protease P ® from Amano Pharmaceuticals Ltd., Nagoya, Japan, and the enzyme available under the name Proteinase K-16 from Kao Corp., Tokyo, Japan.
Erfindungsgemäßer Gegenstand sind vorzugsweise zirkuläre Permutationsvarianten dieser Enzyme sowie Homologer hiervon, vorzugsweise mit den zuvor angegebenen Homologie- und Identitätswerten.The subject of the invention are preferably circular permutation variants of these enzymes as well as homologs thereof, preferably with the homology and identity values given above.
Bei dem zirkulär permutierten Subtilisin handelt es sich besonders bevorzugt um eine zirkulär permutierte BLAP-Protease mit einer Ausgangssequenz gemäß SEQ ID NO: 1 , eine zirkulär permutierte BPN'-Proease mit einer Ausgangssequenz gemäß SEQ ID NO: 2 oder um ein zirkulär permutiertes Subtilisin Carlsberg mit einer Ausgangssequenz gemäß SEQ ID NO: 3 sowie um Homologe davon.The circularly permutated subtilisin is particularly preferably a circularly permuted BLAP protease having an initial sequence according to SEQ ID NO: 1, a circularly permuted BPN '-proease having an initial sequence according to SEQ ID NO: 2 or a circularly permuted subtilisin Carlsberg with an initial sequence according to SEQ ID NO: 3 as well as homologs thereof.
In den erfindungsgemäßen zirkulären Permutationsvarianten sind die ursprünglichen Termini des maturen Ausgangsenzyms vorzugsweise durch einen beliebigen Linker einer Länge von 1 bis 40, besonders bevorzugt 5 bis 30, insbesondere 10 bis 20 Aminosäuren miteinander verknüpft. Zur Herstellung der zirkulär permutierten Subtilisine wird vorzugsweise ein Linker mit einer Länge von 10 bis 20 Aminosäuren, besonders bevorzugt ein Linker mit 12 bis 16 Aminosäuren, vor allem ein Linker mit 13, 14 oder 15 Aminosäuren verwendet, insbesondere der Linker GAATSGKLNGSTAG (SEQ ID NO: 4).In the circular permutation variants according to the invention, the original termini of the mature starting enzyme are preferably linked to one another by any linker of a length of 1 to 40, particularly preferably 5 to 30, in particular 10 to 20, amino acids. For the preparation of the circularly permutated subtilisins, preferably a linker with a length of 10 to 20 amino acids, particularly preferably a linker with 12 to 16 amino acids, especially a linker with 13, 14 or 15 amino acids is used, in particular the linker GAATSGKLNGSTAG (SEQ ID NO : 4).
Bei dem Linker kann es sich grundsätzlich um ein Oligo- bzw. Polypeptid mit einer beliebigen Sequenz handeln. Es ist gegebenenfalls darauf zu achten, dass die Sequenz des Linkers so gewählt wird, dass der Linker eine ausreichende Flexibilität besitzt, um die beiden originären Termini des Ausgangproteins miteinander zu verknüpfen. Als geeignet zur Verbrückung der BLAP- Proteasen hat sich beispielsweise der zuvor genannten Linker mit der Sequenz GAATSGKLNGSTAG herausgestellt. Grundsätzlich kann natürlich aber auch jeder beliebige andere Linker zur Verknüpfung der originären Terminie verwendet werden. Die Sequenz des Linkers ist insofern von untergeordneter Bedeutung für die Funktion eines Enzyms, da er sich weit entfernt vom aktiven Zentrum des Enzyms befindet.
Die neuen Termini der zirkulären Permutationsvariante sind vorzugsweise mindestens 10 Aminosäuren, besonders bevorzugt mindestens 20 Aminosäuren, insbesondere mindestens 30, 35 oder 40 Aminosäuren von den ursprünglichen Termini entfernt.The linker may in principle be an oligopeptide or polypeptide of any desired sequence. It may be necessary to ensure that the sequence of the linker is chosen so that the linker has sufficient flexibility to link the two original termini of the starting protein. For example, the previously mentioned linker with the sequence GAATSGKLNGSTAG has proven to be suitable for bridging the BLAP proteases. Basically, of course, any other linker can be used to link the original term. The sequence of the linker is of lesser importance for the function of an enzyme because it is far from the active site of the enzyme. The new terms of the circular permutation variant are preferably at least 10 amino acids, more preferably at least 20 amino acids, more preferably at least 30, 35 or 40 amino acids away from the original termini.
In einer bevorzugten Ausführungsform befinden sich die neuen Termini der zirkulären Permutationsvarianten außerhalb der eigentlichen Tertiärstruktur, insbesondere im Bereich von Loop-Strukturen des Ausgangsenzyms, also in Bereichen, die außerhalb der komplexen Faltung des Proteins liegen und stattdessen verbrückende Eigenschaften aufweisen.In a preferred embodiment, the new terms of the circular permutation variants are located outside the actual tertiary structure, in particular in the region of loop structures of the starting enzyme, ie in regions which lie outside the complex folding of the protein and instead have bridging properties.
Die Termini der zirkulär permutierten BLAP-Protease befinden sich daher in dieser Ausführungsform zwischen den Aminosäuren 1-4, 10-14, 18-26, 32-45, 49-62, 70-76, 78-87, 93- 102, 115-118, 122-131 , 142-146, 154-169, 175-179, 181 -183, 185-192, 196-199, 203-207, 211- 215, 231-237, 247-264 oder 267-268 des Ausgangsenzyms.The termini of the circularly permuted BLAP protease are therefore in this embodiment between the amino acids 1-4, 10-14, 18-26, 32-45, 49-62, 70-76, 78-87, 93-102, 115 -118, 122-131, 142-146, 154-169, 175-179, 181-183, 185-192, 196-199, 203-207, 211-215, 231-237, 247-264 or 267-268 of the starting enzyme.
Die Termini der zirkulär permutierten BPN'-Protease befinden sich daher entsprechend in dieser Ausführungsform zwischen den Aminosäuren 1-7, 10-14, 19-26, 32-46, 50-64, 95-104, 1 17-120, 124-133, 145-148, 156-175, 181 -185, 187-189, 191-198, 202-205, 209-213, 217-220, 237-243, 252-270 oder 273-275 des Ausgangsenzyms.The terms of the circularly permuted BPN 'protease are therefore correspondingly in this embodiment between the amino acids 1-7, 10-14, 19-26, 32-46, 50-64, 95-104, 17-120, 124- 133, 145-148, 156-175, 181-185, 187-189, 191-198, 202-205, 209-213, 217-220, 237-243, 252-270, or 273-275 of the parent enzyme.
Die Termini des zirkulär permutierten Subtilisins Carlsberg befinden sich daher entsprechend in dieser Ausführungsform zwischen den Aminosäuren 1-7, 9-13, 19-26, 32-46, 50-64, 72-89, 95-104, 116-121 , 124-134, 145-148, 156-175, 181-185, 187-189, 191 -198, 202-205, 209-213, 217-220, 237-243, 250-270 oder 274-275 des Ausgangsenzyms.The terms of the circularly permutated subtilisin Carlsberg are therefore correspondingly in this embodiment between amino acids 1-7, 9-13, 19-26, 32-46, 50-64, 72-89, 95-104, 116-121, 124 -134, 145-148, 156-175, 181-185, 187-189, 191-198, 202-205, 209-213, 217-220, 237-243, 250-270 or 274-275 of the parent enzyme.
Es hat sich erfindungsgemäß jedoch überraschenderweise gezeigt, dass die Lokalisierung der neuen Termini in einer Loop-Struktur oder in einem ähnlichen außerhalb der eigentlichen Tertiärstruktur des Ausgangsenzyms gelegenen Bereich für die Funktionsfähigkeit des Enzyms nicht erforderlich ist, sondern es ebenso möglich ist, dass die neuen Termini mitten in der Tertiär- und/oder Quartärstruktur des gefalteten Augangsproteins lokalisiert sind, ohne dass die Aktivität oder Stabilität des Enzyms gestört wird. Die Termini des zirkulär permutierten Proteins befinden sich daher in dieser Ausführungsform nicht im Bereich von Loop-Struktuten.However, it has surprisingly been found according to the invention that the localization of the new termini in a loop structure or in a similar region outside the actual tertiary structure of the parent enzyme is not required for the functionality of the enzyme, but it is also possible that the new termini in the middle of the tertiary and / or quaternary structure of the folded source protein without interfering with the activity or stability of the enzyme. The termini of the circularly permuted protein are therefore not in the range of loop structures in this embodiment.
Die Termini der zirkulär permutierten BLAP-Protease befinden sich daher in dieser Ausführungsform zwischen den Aminosäuren 4-10, 14-18, 26-32, 45-49, 62-70, 76-78, 87-93, 102- 115, 118-122, 131 -142, 146-154, 169-175, 179-181 , 183-185, 192-196, 199-203, 207-211 , 215- 231 , 237-247, 264-267 oder 268-Ende des Ausgangsenzyms.The termini of the circularly permuted BLAP protease are therefore in this embodiment between amino acids 4-10, 14-18, 26-32, 45-49, 62-70, 76-78, 87-93, 102-115, 118 -122, 131-142, 146-154, 169-175, 179-181, 183-185, 192-196, 199-203, 207-211, 215-231, 237-247, 264-267 or 268 end of the starting enzyme.
Die Termini der zirkulär permutierten BPN'-Protease befinden sich daher entsprechend in dieser Ausführungsform zwischen den Aminosäuren 7-10, 14-19, 26-32, 46-50, 64-95, 104-117, 120-124,
133-145, 148-156, 175-181 , 185-187, 189-191 , 198-202, 205-209, 213-217, 220-237, 243-252, 270-273 oder 275-Ende des Ausgangsgsenzyms.The terms of the circularly permuted BPN 'protease are therefore correspondingly in this embodiment between amino acids 7-10, 14-19, 26-32, 46-50, 64-95, 104-117, 120-124, 133-145, 148-156, 175-181, 185-187, 189-191, 198-202, 205-209, 213-217, 220-237, 243-252, 270-273 or 275 end of the parent enzyme.
Die Termini des zirkulär permutierten Subtilisins Carlsberg befinden sich daher entsprechend in dieser Ausführungsform zwischen den Aminosäuren 7-9, 13-19, 26-32, 46-50, 64-72, 89-95, 104- 116, 121-124, 134-145, 148-156, 175-181 , 185-187, 189-191 , 198-202, 205-209, 213-217, 220- 237, 243-250, 270-274 oder 275-Ende des Ausgangsenzyms.The terms of the circularly permutated subtilisin Carlsberg are therefore correspondingly in this embodiment between amino acids 7-9, 13-19, 26-32, 46-50, 64-72, 89-95, 104-116, 121-124, 134 -145, 148-156, 175-181, 185-187, 189-191, 198-202, 205-209, 213-217, 220-237, 243-250, 270-274 or 275 end of the parent enzyme.
In einer erfindungsgemäß besonders bevorzugten Ausführungsform sind die zirkulären Permutationsvarianten von BLAP ausgewählt aus Polypeptiden mit einer Sequenzhomologie und/oder -identität von mindestens 80 % , vorzugsweise mindestens 85 oder 90 %, besonders bevorzugt mindestens 95, 98 oder 99 %, zu einen Polypeptid gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6 und/oder aus Polypeptiden mit Insertionen, Deletionen oder Inversionen von bis zu 30, 25 oder 20, vorzugsweise bis zu 18, 16, 14 oder 12, besonders bevorzugt bis zu 10, 9, 8, 7 oder 6, vor allem bis zu 5, 4, 3 oder 2 Aminosäuren, insbesondere mit Insertionen oder Deletionen von genau einer Aminosäure in Bezug auf ein Polypeptid mit einer Polypeptidsequenz gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6.In a particularly preferred embodiment of the invention, the circular permutation variants of BLAP are selected from polypeptides having a sequence homology and / or identity of at least 80%, preferably at least 85 or 90%, more preferably at least 95, 98 or 99%, to a polypeptide according to SEQ ID NO: 5 or according to SEQ ID NO: 6 and / or of polypeptides having insertions, deletions or inversions of up to 30, 25 or 20, preferably up to 18, 16, 14 or 12, particularly preferably up to 10, 9, 8, 7 or 6, in particular up to 5, 4, 3 or 2 amino acids, in particular with insertions or deletions of exactly one amino acid with respect to a polypeptide having a polypeptide sequence according to SEQ ID NO: 5 or according to SEQ ID NO: 6.
Das Maß für die Homologie ist ein Prozentsatz an Identität, wie er beispielsweise nach der von D. J. Lipman und W. R. Pearson in Science 227 (1985), S. 1435-1441 angegebenen Methode bestimmt werden kann. Diese Angabe kann sich auf das gesamte Protein oder auf den jeweils zuzuordnenden Bereich beziehen. Ein weiter gefaßter Homologie-Begriff, die Ähnlichkeit, bezieht auch konservierte Variationen, also Aminosäuren mit ähnlicher chemischer Aktivität in die Betrachtung mit ein, da diese innerhalb des Proteins meist ähnliche chemische Aktivitäten ausüben. Bei Nukleinsäuren kennt man nur den Prozentsatz an Identität. Erfindungsgemäß ist als Maß für die Identität und/oder Homologie auf die vollständige Sequenz des jeweils betrachteten erfindungsgemäßen Polypeptids (oder Polynukleotids) bzw. auf die vollständige Sequenz des jeweils betrachteten erfindungsgemäßen Polypeptidbereichs (oder Polynukleotidbereichs) abzustellen und nicht nur auf den jeweils überlappenden Bereich zwischen erfindungsgemäßem Polypeptid (oder Polynukleotid) bzw. Polypeptidbereich (oder Polynukleotidbereich) und Vergleichsprotein (oder Vergleichsnukleotid). Sofern sich die Homologie- und Identitätsangaben auf ein erfindungsgemäßes Polypeptid ausschließlich des Linker-Peptids beziehen, ist die Polypeptidsequenz, die durch den Linker verbrückt wird, als durchgehende Sequenz anzusehen. Dies gilt analog ebenso für die für ein erfindungsgemäßes Polypeptid kodierende Polynukleotidsequenz.The measure of homology is a percentage of identity, such as can be determined, for example, according to the method given by D. J. Lipman and W. R. Pearson in Science 227 (1985), pp. 1435-1441. This indication may refer to the entire protein or to the respective region to be assigned. A broad homology term, similarity, also includes conserved variations, that is, amino acids with similar chemical activity, as these usually perform similar chemical activities within the protein. With nucleic acids one knows only the percentage of identity. According to the invention, as a measure of the identity and / or homology, the complete sequence of the particular polypeptide (or polynucleotide) according to the invention or the complete sequence of the particular polypeptide region (or polynucleotide region) of the invention is to be considered, and not just the overlapping region between them Polypeptide (or polynucleotide) or polypeptide region (or polynucleotide region) and comparative protein (or comparative nucleotide). If the homology and identity information relates to a polypeptide according to the invention excluding the linker peptide, the polypeptide sequence which is bridged by the linker is to be regarded as a continuous sequence. This also applies analogously to the polynucleotide sequence coding for a polypeptide according to the invention.
Ein weiterer Gegenstand der vorliegenden Erfindung sind Vektoren, insbesondere Klonierungsund Expressionsvektoren, die erfindungsgemäße Polynukleotide enthalten, sowie Zellen, insbesondere Wirtszellen, die erfindungsgemäße Polynukleotide, Vektoren und/oder Polypeptide enthalten.
In einer bevorzugten Ausführungsform sind die Zellen ausgewählt aus gramnegativen Bakterien, insbesondere solchen der Gattungen Escherichia coli oder Klebsiella, insbesondere aus den Stämmen von E. coli K12, E. coli B oder Klebsiella planticola, und ganz besonders aus Derivaten der Stämme Escherichia coli BL21 (DE3), E coli RV308, E. coli DH5α, E.coli JM 109, E coli XL-1 oder Klebsiella planticola (Rf).Another object of the present invention are vectors, in particular cloning and expression vectors containing polynucleotides of the invention, and cells, in particular host cells containing polynucleotides according to the invention, vectors and / or polypeptides. In a preferred embodiment, the cells are selected from Gram-negative bacteria, in particular those of the genera Escherichia coli or Klebsiella, in particular from the strains of E. coli K12, E. coli B or Klebsiella planticola, and more particularly from derivatives of the strains Escherichia coli BL21 ( DE3), E. coli RV308, E. coli DH5α, E. coli JM 109, E. coli XL-1 or Klebsiella planticola (Rf).
In einer weiteren bevorzugten Ausführungsform sind die Zellen ausgewählt aus grampositiven Bakterien, insbesondere solchen der Gattungen Bacillus, Staphylococcus oder Corynebacterien, ganz besonders der Species Bacillus lentus, B. licheniformis, B. amyloliquefaciens, B. subtilis, B. globigii, B. gibsonii, B. pumilus oder B. alcalophilus, Staphylococcus carnosus oder Corynebacterium glutamicum.In a further preferred embodiment, the cells are selected from Gram-positive bacteria, especially those of the genera Bacillus, Staphylococcus or Corynebacteria, more particularly of the species Bacillus lentus, B. licheniformis, B. amyloliquefaciens, B. subtilis, B. globigii, B. gibsonii, B. pumilus or B. alcalophilus, Staphylococcus carnosus or Corynebacterium glutamicum.
Mittel enthaltend erfindungsgemäße PolypeptideAgent containing polypeptides according to the invention
Einen weiteren Erfindungsgegenstand stellen Mittel dar, die zuvor genannte erfind ungsgemäßeA further subject of the invention are agents which form the aforementioned invention
Polypeptide enthalten.Contain polypeptides.
Hiermit werden alle Arten von Mitteln, insbesondere Gemische, Rezepturen, Lösungen etc., deren Einsetzbarkeit durch Zugabe eines oben beschriebenen, erfindungsgemäßen Proteins verbessert wird, in den Schutzbereich der vorliegenden Erfindung eingeschlossen. Es kann sich dabei je nach Einsatzgebiet beispielsweise um feste Gemische, beispielsweise Pulver mit gefriergetrockeneten oder verkapselten Proteinen, oder um gelförmige oder flüssige Mittel handeln. Bevorzugte Rezepturen enthalten beispielsweise Puffersubstanzen, Stabilisatoren, Reaktionspartner und/oder Cofaktoren der Proteasen und/oder andere mit den Proteasen synergistische Inhaltsstoffe. Insbesondere sind darunter Mittel für die weiter unten ausgeführten Einsatzgebiete zu verstehen. Weitere Einsatzgebiete gehen aus dem Stand der Technik hervor. Mögliche Einsatzgebiete sind hierbei insbesondere die Verwendung zur Gewinnung oder Behandlung von Rohmaterialien oder Zwischenprodukten in der Textilherstellung, insbesondere zum Entfernen von Schutzschichten auf Geweben, insbesondere auf Wolle oder Seide, sowie die Verwendung zur Pflege von Textilien, die natürliche Fasern, insbesondere Wolle oder Seide, enthalten.This includes all types of compositions, especially mixtures, formulations, solutions, etc., the utility of which is improved by addition of a protein of the invention described above, within the scope of the present invention. Depending on the field of application, these may be, for example, solid mixtures, for example powders with freeze-dried or encapsulated proteins, or gel or liquid agents. Preferred formulations contain, for example, buffer substances, stabilizers, reaction partners and / or cofactors of the proteases and / or other ingredients synergistic with the proteases. In particular, this appropriation is to be understood as the areas of application set out below. Further applications emerge from the prior art. Possible fields of use here are, in particular, the use for obtaining or treating raw materials or intermediates in textile production, in particular for removing protective layers on fabrics, in particular wool or silk, and the use for the care of textiles, the natural fibers, in particular wool or silk, contain.
Erfindungsgegenstand sind entsprechend auch Verfahren zur Behandlung von Textilrohstoffen und zur Textilpflege, bei denen in wenigstens einem der Verfahrensschritte erfindungsgemäße Polypeptide verwendet werden. Hierunter sind Verfahren für Textilrohstoffe, Fasern oder Textilien mit natürlichen Bestandteilen bevorzugt, insbesondere für solche mit Wolle oder Seide. Es kann sich dabei beispielsweise um Verfahren handeln, in denen Materialien zur Verarbeitung in Textilien
vorbereitet werden, etwa zur Antifilzausrüstung, oder beispielsweise um Verfahren, welche die Reinigung getragener Textilien um eine pflegende Komponente bereichern.Accordingly, the invention also relates to processes for the treatment of textile raw materials and for textile care, in which polypeptides according to the invention are used in at least one of the process steps. These include processes for textile raw materials, fibers or textiles with natural constituents, in particular those with wool or silk. These may be, for example, processes in which materials for processing in textiles be prepared, for example, the anti-fungal equipment, or for example methods that enrich the cleaning of worn textiles to a nourishing component.
Weitere mögliche Einsatzgebiete sind etwaOther possible uses include
- die Verwendung zur biochemischen Analyse oder zur Synthese von niedermolekularen Verbindungen oder von Proteinen, darunter bevorzugt die Verwendung zur Endgruppenbestimmung im Rahmen einer Peptid-Sequenzanalyse;the use for biochemical analysis or for the synthesis of low molecular weight compounds or of proteins, including preferably the use for end group determination in the context of a peptide sequence analysis;
- die Verwendung zur Präparation, Reinigung oder Synthese von Naturstoffen oder biologischen Wertstoffen;- the use for the preparation, purification or synthesis of natural substances or biologically valuable substances;
- die Verwendung zur Behandlung von natürlichen Rohstoffen, insbesondere zur Oberflächenbehandlung, ganz besonders in einem Verfahren zur Behandlung von Leder, insbesondere zur Enthaarung von Leder;the use for the treatment of natural raw materials, in particular for surface treatment, more particularly in a process for the treatment of leather, in particular for the depilation of leather;
- die Verwendung zur Behandlung von photographischen Filmen, insbesondere zur Entfernung von gelatinhaltigen oder ähnlichen Schutzschichten; undthe use for the treatment of photographic films, in particular for the removal of gelatin-containing or similar protective layers; and
- die Verwendung zur Herstellung von Lebensmitteln oder von Futtermitteln, insbesondere zur enzymatischen Behandlung von Sojamilch und/oder Sojamilchprodukten.the use for the production of food or feed, in particular for the enzymatic treatment of soymilk and / or soymilk products.
Grundsätzlich wird der Einsatz der zuvor genannten erfindungsgemäßen Polypeptide in allen weiteren Technikgebieten, für die er sich als geeignet herausstellt, in den Schutzbereich der vorliegenden Anmeldung eingeschlossen.In principle, the use of the abovementioned polypeptides according to the invention in all other fields of technology for which it proves to be suitable is included in the scope of protection of the present application.
Eine weitere erfindungsgemäße Verwendungsmöglichkeit ist der Einsatz der erfindungsgemäßen Polypeptide in kosmetischen Mitteln. Hierunter werden alle Arten von reinigenden und pflegenden Mitteln für menschliche Haut oder menschliches Haar verstanden, insbesondere reinigende Mittel. Bei dem Mittel kann es sich je nach Anwendungszweck auch um ein pharmazeutisches Mittel handeln.Another use according to the invention is the use of the polypeptides according to the invention in cosmetic agents. This is understood to mean all types of cleansing and conditioning agents for human skin or hair, in particular cleansing agents. The agent may also be a pharmaceutical agent depending on the purpose of use.
Als Beispiele für erfindungsgemäße kosmetische und/oder pharmazeutische Mittel seien Shampoos, Seifen, Waschlotionen, Cremes, Peelings sowie Mund-, Zahn- oder Zahnprothesenpflegemittel genannt. Diese Mittel können insbesondere auch Bestandteile enthalten, wie sie weiter unten für Wasch- und Reinigungsmittel genannt werden.Examples of cosmetic and / or pharmaceutical compositions according to the invention are shampoos, soaps, washing lotions, creams, peels and mouth, tooth or denture care agents. In particular, these compositions may also contain constituents, as mentioned below for detergents and cleaners.
Einen erfindungsgemäß besonders bevorzugten Gegenstand stellen Wasch- und Reinigungsmittel dar, die erfindungsgemäße Polypeptide enthalten. Denn wie in den Ausführungsbeispielen der vorliegenden Anmeldung gezeigt wird, konnte für Wasch- und Reinigungsmittel mit einer erfindungsgemäß bevorzugten Protease überraschenderweise eine Steigerung der Waschleistung gegenüber Mitteln mit herkömmlicherweise eingesetzten Proteasen festgestellt werden.A particularly preferred subject according to the invention are detergents and cleaners containing polypeptides according to the invention. As is shown in the exemplary embodiments of the present application, washing and cleaning agents with a protease preferred according to the invention surprisingly found an increase in the washing performance compared to agents with conventionally employed proteases.
Unter der Waschleistung oder der Reinigungsleistung eines Wasch- beziehungsweise Reinigungsmittels ist im Sinne der vorliegenden Anmeldung der Effekt zu verstehen, den das
betrachtete Mittel auf die verschmutzten Artikel, beispielsweise Textilien oder Gegenstände mit harten Oberflächen ausübt. Einzelne Komponenten solcher Mittel, insbesondere die erfindungsgemäßen Enzyme, werden hinsichtlich ihres Beitrags zur Wasch- oder Reinigungsleistung des gesamten Wasch- beziehungsweise Reinigungsmittels beurteilt. Es ist hierbei insbesondere zu berücksichtigen, dass aus den enzymatischen Eigenschaften eines Enzyms nicht ohne weiteres auf seinen Beitrag zur Waschleistung eines Mittels geschlossen werden kann. Vielmehr spielen hier neben der enzymatischen Aktivität insbesondere auch Faktoren wie Stabilität, Substratbindung, Bindung an das Reinigungsgut oder Wechselwirkungen mit anderen Inhaltsstoffen der Wasch- oder Reinigungsmittel, insbesondere auch mögliche Synergieeffekte bei der Entfernung der Verschmutzungen, eine Rolle.For the purposes of the present application, the washing performance or the cleaning performance of a washing or cleaning agent is to be understood as meaning the effect that the considered means on the soiled articles, for example, textiles or objects with hard surfaces exerts. Individual components of such agents, in particular the enzymes according to the invention, are assessed with regard to their contribution to the washing or cleaning performance of the entire detergent or cleaning agent. It should be noted in particular that from the enzymatic properties of an enzyme can not be readily deduced to its contribution to the washing performance of an agent. Rather, in addition to the enzymatic activity, factors such as stability, substrate binding, binding to the items to be cleaned or interactions with other ingredients of the detergents or cleaning agents, in particular possible synergy effects in the removal of the contaminants, also play a role here.
Ein weiterer Gegenstand der vorliegenden Erfindung sind daher Wasch- und Reinigungsmittel, insbesondere Tensid- und/oder Bleichmittel-haltige, die ein erfindungsgemäßes Polypeptid enthalten.Another object of the present invention are therefore detergents and cleaning agents, in particular surfactant and / or bleach-containing, containing a polypeptide of the invention.
Bei den erfindungsgemäßen Wasch- und Reinigungsmitteln kann es sich um alle denkbaren Reinigungsmittelarten handeln, sowohl um Konzentrate als auch um unverdünnt anzuwendende Mittel, zum Einsatz im kommerziellen Maßstab, in der Waschmaschine oder bei der Hand-Wäsche, beziehungsweise -Reinigung. Dazu gehören beispielsweise Waschmittel für Textilien, Teppiche, oder Naturfasern, für die nach der vorliegenden Erfindung die Bezeichnung Waschmittel verwendet wird. Dazu gehören beispielsweise auch Geschirrspülmittel für Geschirrspülmaschinen oder manuelle Geschirrspülmittel oder Reiniger für harte Oberflächen wie Metall, Glas, Porzellan, Keramik, Kacheln, Stein, lackierte Oberflächen, Kunststoffe, Holz oder Leder; für solche wird nach der vorliegenden Erfindung die Bezeichnung Reinigungsmittel verwendet. Im weiteren Sinne sind auch Sterilisations- und Desinfektionsmittel als Wasch- und Reinigungsmittel im erfindungsgemäßen Sinne anzusehen.The detergents and cleaning agents according to the invention may be any conceivable type of cleaning agent, both concentrates and agents to be used undiluted, for use on a commercial scale, in the washing machine or in hand washing or cleaning. These include, for example, detergents for textiles, carpets, or natural fibers, for which according to the present invention the term laundry detergent is used. These include, for example, dishwashing detergents for dishwashers or manual dishwashing detergents or cleaners for hard surfaces such as metal, glass, porcelain, ceramics, tiles, stone, painted surfaces, plastics, wood or leather; for such according to the present invention, the term cleaning agent is used. In a broader sense sterilizing and disinfecting agents are to be regarded as detergents and cleaners in the sense of the invention.
Ausführungsformen der vorliegenden Erfindung umfassen alle nach dem Stand der Technik etablierten und/oder alle zweckmäßigen Darreichungsformen der erfindungsgemäßen Wasch- oder Reinigungsmittel. Dazu zählen beispielsweise feste, pulverförmige, flüssige, gelförmige oder pastöse Mittel, gegebenenfalls auch aus mehreren Phasen, komprimiert oder nicht komprimiert; ferner gehören beispielsweise dazu: Extrudate, Granulate, Tabletten oder Pouches, sowohl in Großgebinden als auch portionsweise abgepackt.Embodiments of the present invention include all of the prior art and / or all suitable administration forms of the washing or cleaning agents according to the invention. These include, for example, solid, powdery, liquid, gelatinous or pasty agents, optionally also of several phases, compressed or uncompressed; further include, for example: extrudates, granules, tablets or pouches, packed both in large containers and in portions.
Neben einem erfindungsgemäßen Polypeptid enthält ein erfindungsgemäßes Wasch- oder Reinigungsmittel gegebenenfalls weitere Inhaltsstoffe wie weitere Enzyme, Enzymstabilisatoren, Tenside, z. B. nichtionische, anionische und/oder amphotere Tenside, Bleichmittel, Bleichaktivatoren, Bleichkatalysatoren, Builder, Lösungsmittel, Verdicker, Sequestrierungsmittel, Elektrolyte, optische Aufheller, Vergrauungsinhibitoren, Silberkorrosionsinhibitoren, Farbüber- tragungsinhibitoren, Schaum inhibitoren, Abrasivstoffe, Farbstoffe, Duftstoffe, antimikrobielle
Wirkstoffe, UV-Absorbenzien, sogenannte Soil-Release-Wirkstoffe oder Soil-Repellents, sowie gegebenenfalls weitere übliche Inhaltsstoffe . Hinsichtlich erfindungsgemäß verwendbarer Inhaltsstoffe der zuvor genannten Gruppen wird insbesondere auch auf die Anmeldung DE 102007049830.8 verwiesen.In addition to a polypeptide according to the invention, a washing or cleaning agent according to the invention optionally contains further ingredients such as further enzymes, enzyme stabilizers, surfactants, for. Nonionic, anionic and / or amphoteric surfactants, bleaching agents, bleach activators, bleach catalysts, builders, solvents, thickeners, sequestering agents, electrolytes, optical brighteners, grayness inhibitors, silver corrosion inhibitors, color transfer inhibitors, foam inhibitors, abrasives, dyes, fragrances, antimicrobial Active ingredients, UV absorbents, so-called soil release agents or soil repellents, and optionally other conventional ingredients. With regard to constituents of the abovementioned groups which can be used according to the invention, reference is also made in particular to the application DE 102007049830.8.
Tenside sind in erfindungsgemäßen Reinigungs- oder Waschmitteln insgesamt vorzugsweise in einer Menge von 5 bis 50 Gew.-%, besonders bevorzugt von 8 bis 30 Gew.-%, bezogen auf das fertige Mittel, enthalten, wobei in einer bevorzugten Ausführungsform mindestens ein nichtionisches Tensid zur Anwendung kommt.Surfactants are present in cleaning agents or detergents according to the invention as a whole preferably in an amount of from 5 to 50% by weight, particularly preferably from 8 to 30% by weight, based on the finished composition, wherein in a preferred embodiment at least one nonionic surfactant is used.
Der Gehalt der Wasch- oder Reinigungsmittel an Bleichmitteln kann 1 bis 40 Gew.-% und insbesondere 10 bis 20 Gew.-%, betragen, wobei vorteilhafterweise Perboratmonohydrat oder Percarbonat als Bleichmittel eingesetzt wird.The content of detergents or cleaning agents in bleaching agents may be from 1 to 40% by weight and in particular from 10 to 20% by weight, it being advantageous to use perborate monohydrate or percarbonate as the bleaching agent.
Buildersubstanzen können in den erfindungsgemäßen Wasch- oder Reinigungsmitteln gegebenenfalls in Mengen bis zu 90 Gew.-% enthalten sein. Sie sind vorzugsweise in Mengen bis zu 75 Gew.-% enthalten.Builder substances may optionally be present in the detergents or cleaners according to the invention in amounts of up to 90% by weight. They are preferably contained in amounts of up to 75% by weight.
Verdicker sind in erfindungsgemäßen Mitteln vorzugsweise in einer Menge bis zu 5 Gew.-%, insbesondere von 0,05 bis 2 Gew.-% und besonders bevorzugt von 0,1 bis 1 ,5 Gew.-%, bezogen auf die fertige Zusammensetzung, enthalten.Thickeners are preferably present in compositions according to the invention in an amount of up to 5% by weight, in particular from 0.05 to 2% by weight and more preferably from 0.1 to 1.5% by weight, based on the finished composition, contain.
Erfindungsgemäße Mittel können zur Steigerung der Wasch-, beziehungsweise Reinigungsleistung neben den erfindungsgemäßen Polypeptiden weitere Enzyme enthalten, wobei prinzipiell alle im Stand der Technik für diese Zwecke etablierten Enzyme einsetzbar sind. Hierzu gehören insbesondere weitere Proteasen, Amylasen, Lipasen, Hemicellulasen, Cellulasen oder Oxidoreduktasen, sowie vorzugsweise deren Gemische. Diese Enzyme sind im Prinzip natürlichen Ursprungs; ausgehend von den natürlichen Molekülen stehen für den Einsatz in Wasch- und Reinigungsmitteln verbesserte Varianten zur Verfügung, die entsprechend bevorzugt eingesetzt werden. Erfindungsgemäße Mittel enthalten diese weiteren Enzyme vorzugsweise in Gesamtmengen von 1 x 10~6 bis 5 Gewichts- Prozent bezogen auf aktives Protein.Compositions according to the invention may comprise further enzymes in addition to the polypeptides according to the invention for increasing the washing or cleaning performance, it being possible in principle to use all enzymes established for this purpose in the prior art. These include in particular other proteases, amylases, lipases, hemicellulases, cellulases or oxidoreductases, and preferably mixtures thereof. These enzymes are basically of natural origin; Starting from the natural molecules, improved variants are available for use in detergents and cleaners, which are preferably used accordingly. Agents according to the invention preferably contain these further enzymes in total amounts of 1 × 10 -6 to 5 percent by weight, based on active protein.
Unter den weiteren Proteasen sind die nativen Formen der Enzyme vom Subtilisin-Typ bevorzugt, die bereits zuvor beschrieben wurden, sowie weitere Waschmittel-Proteasen, die ebenfalls bereits zuvor beschrieben wurden.Among the other proteases, the native forms of the subtilisin-type enzymes which have been described previously are preferred, as well as other detergent proteases which have also been described previously.
Beispiele hierfür sind die bereits zuvor genannten Enzyme Alkalische Protease aus Bacillus lentus, die Subtilisine BPN' und Carlsberg, die Protease PB92, die Subtilisine 147 und 309, Subtilisin DY und die den Subtilasen, nicht mehr jedoch den Subtilisinen im engeren Sinne zuzuordnenden Enzyme Thermitase, Proteinase K und die Proteasen TW3 und TW7. Subtilisin Carlsberg ist in
weiterentwickelter Form unter dem Handelsnamen Alcalase® von der Firma Novozymes A/S, Bagsvaerd, Dänemark, erhältlich. Die Subtilisine 147 und 309 werden unter den Handelsnamen Esperase®, beziehungsweise Savinase® von der Firma Novozymes vertrieben. Von der Protease aus Bacillus lentus DSM 5483 (WO 91/02792 A1 ) leiten sich die unter der Bezeichnung BLAP® geführten Varianten ab, die insbesondere in WO 92/21760 A1 , WO 95/23221 A1 , WO 02/088340 A2 und WO 03/038082 A2 beschrieben werden. Weitere verwendbare Proteasen aus verschiedenen Bacillus sp.- und B. gibsonii-Stämmen gehen aus den Patentanmeldungen WO 03/054185, WO 03/056017, WO 03/055974 und WO 03/054184 hervor.Examples of these are the enzymes mentioned above: alkaline protease from Bacillus lentus, the subtilisins BPN 'and Carlsberg, the protease PB92, the subtilisins 147 and 309, subtilisin DY and the enzymes thermitase which can no longer be assigned to the subtilisins in the narrower sense, Proteinase K and the proteases TW3 and TW7. Subtilisin Carlsberg is in developed form under the trade names Alcalase ® from Novozymes A / S, Bagsvaerd, Denmark. The subtilisins 147 and 309 are sold under the trade names Esperase ®, or Savinase ® from Novozymes. Listed under the name BLAP ® variants of the protease from Bacillus lentus DSM 5483 (WO 91/02792 A1) to derive, in particular, in WO 92/21760 A1, WO 95/23221 A1, WO 02/088340 A2 and WO 03 / 038082 A2. Further useful proteases from various Bacillus sp. And B. gibsonii strains are found in the patent applications WO 03/054185, WO 03/056017, WO 03/055974 and WO 03/054184.
Weitere brauchbare Proteasen sind beispielsweise die unter den Handelsnamen Durazym®, Relase®, Everlase®, Nafizym, Natalase®, Kannase® und Ovozymes® von der Firma Novozymes, die unter den Handelsnamen, Purafect®, Purafect®OxP und Properase® von der Firma Genencor, das unter dem Handelsnamen Protosol® von der Firma Advanced Biochemicals Ltd., Thane, Indien, das unter dem Handelsnamen WuxP von der Firma Wuxi Snyder Bioproducts Ltd., China, die unter den Handelsnamen Proleather® und Protease P® von der Firma Amano Pharmaceuticals Ltd., Nagoya, Japan, und das unter der Bezeichnung Proteinase K-16 von der Firma Kao Corp., Tokyo, Japan, erhältlichen Enzyme.Other usable proteases are, for example, under the trade names Durazym ®, relase ®, Everlase® ®, Nafizym, Natalase ®, Kannase® ® and Ovozymes ® from Novozymes, under the trade names Purafect ®, Purafect ® OxP and Properase.RTM ® by the company Genencor, that under the trade name Protosol® ® from Advanced Biochemicals Ltd., Thane, India, under the trade name WuxP from Wuxi Snyder Bioproducts Ltd., China, under the trade names Proleather® ® and protease P ® from Amano Pharmaceuticals Ltd., Nagoya, Japan, and the enzyme available under the name Proteinase K-16 from Kao Corp., Tokyo, Japan.
Beispiele für erfindungsgemäß einsetzbare Amylasen sind die α-Amylasen aus Bacillus licheniformis, aus B. amyloliquefaciens oder aus B. stearothermophilus sowie deren für den Einsatz in Wasch- und Reinigungsmitteln verbesserte Weiterentwicklungen. Das Enzym aus B. licheniformis ist von der Firma Novozymes unter dem Namen Termamyl® und von der Firma Genencor unter dem Namen Purastar®ST erhältlich. Weiterentwicklungsprodukte dieser α- Amylase sind von der Firma Novozymes unter den Handelsnamen Duramyl® und Termamyl®ultra, von der Firma Genencor unter dem Namen Purastar®OxAm und von der Firma Daiwa Seiko Inc., Tokyo, Japan, als Keistase® erhältlich. Die α-Amylase von B. amyloliquefaciens wird von der Firma Novozymes unter dem Namen BAN® vertrieben, und abgeleitete Varianten von der α-Amylase aus B. stearothermophilus unter den Namen BSG® und Novamyl®, ebenfalls von der Firma Novozymes. Weitere einsetzbare Handelsprodukte sind beispielsweise die Amylase-LT® und Stainzyme®, letztere ebenfalls von der Firma Novozymes.Examples of amylases which can be used according to the invention are the α-amylases from Bacillus licheniformis, B. amyloliquefaciens or B. stearothermophilus and also their further developments improved for use in detergents and cleaners. The enzyme from B. licheniformis is available from Novozymes under the name Termamyl ® and from Genencor under the name Purastar® ® ST. Development products of this α- amylase are available from Novozymes under the trade names Duramyl ® and Termamyl ® ultra, from Genencor under the name Purastar® ® OxAm and from Daiwa Seiko Inc., Tokyo, Japan, as Keistase ®. The α-amylase from B. amyloliquefaciens is marketed by Novozymes under the name BAN ®, and variants derived from the α-amylase from B. stearothermophilus under the names BSG ® and Novamyl ®, likewise from Novozymes. Further usable commercial products are, for example, the amylase LT® and Stainzyme®, the latter also from Novozymes.
Desweiteren sind für diesen Zweck die in der Anmeldung WO 02/10356 A2 offenbarte α-Amylase aus Bacillus sp. A 7-7 (DSM 12368) und die in der Anmeldung WO 02/44350 A2 beschriebene Cyclodextrin-Glucanotransferase (CGTase) aus B. agaradherens (DSM 9948) hervorzuheben. Ferner sind die amylolytischen Enzyme einsetzbar, die dem Sequenzraum von α-Amylasen angehören, der in der Anmeldung WO 03/002711 A2 definiert wird, und die, die in der Anmeldung WO 03/054177 A2 beschrieben werden. Ebenso sind Fusionsprodukte der genannten Moleküle einsetzbar, beispielsweise die aus der Anmeldung DE 10138753 A1.
I OFurthermore, the α-amylase from Bacillus sp. Disclosed in the application WO 02/10356 A2 for this purpose. A 7-7 (DSM 12368) and the cyclodextrin glucanotransferase (CGTase) from B. agaradherens (DSM 9948) described in the application WO 02/44350 A2. Furthermore, the amylolytic enzymes which belong to the sequence space of α-amylases, which is defined in the application WO 03/002711 A2, and those which are described in the application WO 03/054177 A2 can be used. Likewise, fusion products of the molecules mentioned can be used, for example those from application DE 10138753 A1. IO
Darüber hinaus sind die unter den Handelsnamen Fungamyl® von der Firma Novozymes erhältlichen Weiterentwicklungen der α-Amylase aus Aspergillus n/gerund A. oryzae geeignet. Ein weiteres Handelsprodukt ist beispielsweise die Amylase-LT" .Moreover, the further development of the α-amylase available under the tradename Fungamyl ® from Novozymes from Aspergillus n / gerund A. oryzae are also suitable. Another commercial product is, for example, the amylase LT ".
Erfindungsgemäße Mittel können Lipasen oder Cutinasen, insbesondere wegen ihrer Triglycerid- spaltenden Aktivitäten enthalten, aber auch, um aus geeigneten Vorstufen in situ Persäuren zu erzeugen. Hierzu gehören beispielsweise die ursprünglich aus Humicola lanuginosa (Thermomyces lanuginosus) erhältlichen, beziehungsweise weiterentwickelten Lipasen, insbesondere solche mit dem Aminosäureaustausch D96L. Sie werden beispielsweise von der Firma Novozymes unter den Handelsnamen Lipolase®, Lipolase®Ultra, LipoPrime®, Lipozyme® und Lipex® vertrieben. Desweiteren sind beispielsweise die Cutinasen einsetzbar, die ursprünglich aus Fusarium solani pisi und Humicola insolens isoliert worden sind. Ebenso brauchbare Lipasen sind von der Firma Amano unter den Bezeichnungen Lipase CE®, Lipase P®, Lipase B®, beziehungsweise Lipase CES®, Lipase AKG®, Bacillis sp. Lipase®, Lipase AP®, Lipase M-AP® und Lipase AML® erhältlich. Von der Firma Genencor sind beispielsweise die Lipasen, beziehungsweise Cutinasen einsetzbar, deren Ausgangsenzyme ursprünglich aus Pseudomonas mendocina und Fusarium so/an/V isoliert worden sind. Als weitere wichtige Handelsprodukte sind die ursprünglich von der Firma Gist-Brocades vertriebenen Präparationen M1 Lipase® und Lipomax® und die von der Firma Meito Sangyo KK, Japan, unter den Namen Lipase MY-30®, Lipase OF® und Lipase PL® vertriebenen Enzyme zu erwähnen, ferner das Produkt Lumafast® von der Firma Genencor.Compositions according to the invention may contain lipases or cutinases, in particular because of their triglyceride-cleaving activities, but also in order to generate in situ peracids from suitable precursors. These include, for example, the lipases originally obtainable from Humicola lanuginosa (Thermomyces lanuginosus) or further developed, in particular those with the amino acid exchange D96L. They are sold, for example, by Novozymes under the trade names Lipolase ®, Lipolase Ultra ®, LipoPrime® ®, Lipozyme® ® and Lipex ®. Furthermore, for example, the cutinases can be used, which were originally isolated from Fusarium solani pisi and Humicola insolens. Likewise useable lipases are available from Amano under the designations Lipase CE ®, Lipase P ®, Lipase B ®, or lipase CES ®, Lipase AKG ®, Bacillis sp. Lipase® , Lipase AP® , Lipase M- AP® and Lipase AML® are available. From the company Genencor, for example, the lipases, or cutinases can be used, the initial enzymes were originally isolated from Pseudomonas mendocina and Fusarium so / an / V. Other important commercial products are the originally marketed by Gist-Brocades preparations M1 Lipase ® and Lipomax® ® and the enzymes marketed by Meito Sangyo KK, Japan under the names Lipase MY-30 ®, Lipase OF ® and lipase PL ® to mention also the product Lumafast® ® from Genencor.
Erfindungsgemäße Mittel können, insbesondere wenn sie für die Behandlung von Textilien gedacht sind, Cellulasen enthalten, je nach Zweck als reine Enzyme, als Enzympräparationen oder in Form von Mischungen, in denen sich die einzelnen Komponenten vorteilhafterweise hinsichtlich ihrer verschiedenen Leistungsaspekte ergänzen. Zu diesen Leistungsaspekten zählen insbesondere Beiträge zur Primärwaschleistung, zur Sekundärwaschleistung des MittelsDetergents according to the invention, especially if they are intended for the treatment of textiles, may contain cellulases, depending on the purpose, as pure enzymes, as enzyme preparations or in the form of mixtures in which the individual components advantageously supplement each other in terms of their various performance aspects. These performance aspects include in particular contributions to the primary washing performance, to the secondary washing performance of the agent
(Antiredepositionswirkung oder Vergrauungsinhibition) und Avivage (Gewebewirkung), bis hin zum Ausüben eines „stone washed'-Effekts.(Anti-redeposition effect or graying inhibition) and softening (tissue effect), up to the exercise of a "stone washed" effect.
Eine brauchbare pilzliche, Endoglucanase(EG)-reiche Cellulase-Präparation, beziehungsweise deren Weiterentwicklungen werden von der Firma Novozymes unter dem Handelsnamen Celluzyme® angeboten. Die ebenfalls von der Firma Novozymes erhältlichen Produkte Endolase® und Carezyme® basieren auf der 50 kD-EG, beziehungsweise der 43 kD-EG aus H. insolens DSM 1800. Weitere einsetzbare Handelsprodukte dieser Firma sind Cellusoft® und Renozyme®. Letzteres basiert auf der Anmeldung WO 96/29397 A1. Leistungsverbesserte Cellulase-Varianten gehen beispielsweise aus der Anmeldung WO 98/12307 A1 hervor. Ebenso sind die in der Anmeldung WO 97/14804 A1 offenbarten Cellulasen einsetzbar; beispielsweise die darin offenbarte 20 kD-EG aus Melanocarpus, die von der Firma AB Enzymes, Finnland, unter den Handelsnamen Ecostone® und Biotouch® erhältlich ist. Weitere Handelprodukte der Firma
AB Enzymes sind Econase® und Ecopulp®. Weitere geeignete Cellulasen aus Bacillus sp. CBS 670.93 und CBS 669.93 werden in WO 96/34092 A2 offenbart, wobei die aus Bacillus sp. CBS 670.93 von der Firma Genencor unter dem Handelsnamen Puradax® erhältlich ist. Weitere Handelsprodukte der Firma Genencor sind „Genencor detergent cellulase L" und lndiAge®Neutra.A useful fungal, endoglucanase (EG) -rich cellulase preparation, or its further developments are offered by Novozymes under the trade name Celluzyme ®. The products Endolase® ® and Carezyme ®, likewise available from Novozymes, are based on the 50 kD EG and 43 kD EG from H. insolens DSM 1800. Further commercial products of this company are Cellusoft® ® and Renozyme ®. The latter is based on the application WO 96/29397 A1. Performance-enhanced cellulase variants are disclosed, for example, in the application WO 98/12307 A1. Likewise, the cellulases disclosed in the application WO 97/14804 A1 can be used; For example, it revealed 20 kD EG Melanocarpus, available from AB Enzymes, Finland, under the trade names Ecostone® ® and Biotouch ®. Other commercial products of the company AB Enzymes are Econase ® and Ecopulp ® . Other suitable cellulases from Bacillus sp. CBS 670.93 and CBS 669.93 are disclosed in WO 96/34092 A2, wherein those derived from Bacillus sp. CBS 670.93 from the company Genencor under the trade name Puradax ® is available. Further commercial products of the company Genencor are "Genencor detergent cellulase L" and lndiAge ® Neutra.
Erfindungsgemäße Mittel können insbesondere zur Entfernung bestimmter Problemanschmutzungen neben den erfindungsgemäßen Polypeptiden weitere Enzyme enthalten, die unter dem Begriff Hemicellulasen zusammengefaßt werden. Hierzu gehören beispielsweise Mannanasen, Xanthanlyasen, Pektinlyasen (=Pektinasen), Pektinesterasen, Pektatlyasen, Xyloglucanasen (=Xylanasen), Pullulanasen und ß-Glucanasen. Geeignete Mannanasen sind beispielsweise unter den Namen Gamanase® und Pektinex AR® von der Firma Novozymes, unter dem Namen Rohapec® B1 L von der Firma AB Enzymes und unter dem Namen Pyrolase® von der Firma Diversa Corp., San Diego, CA, USA erhältlich. Eine geeignete ß-Glucanase aus einem B. alcalophilus geht beispielsweise aus der Anmeldung WO 99/06573 A1 hervor. Die aus B. subtilis gewonnene ß-Glucanase ist unter dem Namen Cereflo® von der Firma Novozymes erhältlich.Compositions according to the invention may, in particular for the removal of certain problem soiling, comprise, in addition to the polypeptides according to the invention, further enzymes which are combined under the term hemicellulases. These include, for example, mannanases, xanthan lyases, pectin lyases (= pectinases), pectin esterases, pectate lyases, xyloglucanases (= xylanases), pullulanases and β-glucanases. Suitable mannanases are available, for example under the name Gamanase ® and Pektinex AR ® from Novozymes, under the name Rohapec ® B1 L from AB Enzymes and under the name Pyrolase® ® from Diversa Corp., San Diego, CA, USA , A suitable β-glucanase from a B. alcalophilus is disclosed, for example, in the application WO 99/06573 A1. The obtained from B. subtilis beta-glucanase is available under the name Cereflo ® from Novozymes.
Zur Erhöhung der bleichenden Wirkung können erfindungsgemäße Wasch- und Reinigungsmittel Oxidoreduktasen, beispielsweise Oxidasen, Oxygenasen, Katalasen, Peroxidasen, wie HaIo-, Chloro-, Bromo-, Lignin-, Glucose- oder Mangan-peroxidasen, Dioxygenasen oder Laccasen (Phenoloxidasen, Polyphenoloxidasen) enthalten. Als geeignete Handelsprodukte sind Denilite® 1 und 2 der Firma Novozymes zu nennen. Vorteilhafterweise werden zusätzlich vorzugsweise organische, besonders bevorzugt aromatische, mit den Enzymen wechselwirkende Verbindungen zugegeben, um die Aktivität der betreffenden Oxidoreduktasen zu verstärken (Enhancer) oder um bei stark unterschiedlichen Redoxpotentialen zwischen den oxidierenden Enzymen und den Anschmutzungen den Elektronenfluß zu gewährleisten (Mediatoren).To increase the bleaching effect, detergents and cleaners according to the invention may be oxidoreductases, for example oxidases, oxygenases, catalases, peroxidases, such as halo, chloro, bromo, lignin, glucose or manganese peroxidases, dioxygenases or laccases (phenol oxidases, polyphenol oxidases) contain. Suitable commercial products Denilite® ® 1 and 2 from Novozymes should be mentioned. Advantageously, it is additionally preferred to add organic, particularly preferably aromatic, compounds which interact with the enzymes in order to enhance the activity of the relevant oxidoreductases (enhancers) or to ensure the flow of electrons (mediators) at greatly varying redox potentials between the oxidizing enzymes and the soils.
Erfindungsgemäßen Mitteln können die erfindungsgemäßen Polypeptide ebenso wie die zusätzlich eingesetzten Enzyme in jeder nach dem Stand der Technik etablierten Form zugesetzt werden. Hierzu gehören beispielsweise die durch Granulation, Extrusion oder Lyophilisierung erhaltenen festen Präparationen oder, insbesondere bei flüssigen oder gelförmigen Mitteln, Lösungen der Enzyme, vorteilhafterweise möglichst konzentriert, wasserarm und/oder mit Stabilisatoren versetzt.Agents according to the invention can be added to the polypeptides according to the invention as well as the additionally used enzymes in any form established according to the prior art. These include, for example, the solid preparations obtained by granulation, extrusion or lyophilization or, especially in the case of liquid or gel-form detergents, solutions of the enzymes, advantageously as concentrated as possible, sparing in water and / or added with stabilizers.
Alternativ können diese Proteine sowohl für die feste als auch für die flüssige Darreichungsform verkapselt werden, beispielsweise durch Sprühtrocknung oder Extrusion der Enzymlösung zusammen mit einem, vorzugsweise natürlichen Polymer oder in Form von Kapseln, beispielsweise solchen, bei denen die Enzyme wie in einem erstarrten Gel eingeschlossen sind oder in solchen vom Kern-Schale-Typ, bei dem ein enzymhaltiger Kern mit einer Wasser-, Luft- und/oder Chemikalien-undurchlässigen Schutzschicht überzogen ist. In aufgelagerten Schichten können zusätzlich weitere Wirkstoffe, beispielsweise Stabilisatoren, Emulgatoren, Pigmente, Bleich- oder Farbstoffe aufgebracht werden. Derartige Kapseln werden nach an sich bekannten
Methoden, beispielsweise durch Schüttel- oder Rollgranulation oder in Fluid-bed-Prozessen aufgebracht. Vorteilhafterweise sind derartige Granulate, beispielsweise durch Aufbringen polymerer Filmbildner, staubarm und aufgrund der Beschichtung lagerstabil.Alternatively, these proteins can be encapsulated for both the solid and liquid dosage forms, for example, by spray-drying or extruding the enzyme solution together with a preferably natural polymer or in the form of capsules, for example those in which the enzymes are entrapped as in a solidified gel or in those of the core-shell type, in which an enzyme-containing core is coated with a water, air and / or chemical impermeable protective layer. In deposited layers, further active ingredients, for example stabilizers, emulsifiers, pigments, bleaches or dyes, may additionally be applied. Such capsules are known per se Methods, for example, by shaking or rolling granulation or applied in fluid-bed processes. Advantageously, such granules, for example by applying polymeric film-forming agent, low in dust and storage stable due to the coating.
Weiterhin ist es möglich, zwei oder mehrere Enzyme, etwa ein erfindungsgemäßes Polypeptid und ein weiteres Enzym, zusammen zu konfektionieren, so dass ein einzelnes Granulat mehrere Enzymaktivitäten aufweist.Furthermore, it is possible to assemble two or more enzymes together, such as a polypeptide according to the invention and another enzyme, so that a single granulate has a plurality of enzyme activities.
Ein in einem erfindungsgemäßen Mittel enthaltenes Protein, insbesondere auch das erfindungsgemäße Polypeptid, kann besonders während der Lagerung gegen Schädigungen wie beispielsweise Inaktivierung, Denaturierung oder Zerfall etwa durch physikalische Einflüsse, Oxidation oder proteolytische Spaltung geschützt werden. Bei mikrobieller Gewinnung der Proteine und/oder Enzyme ist eine Inhibierung der Proteolyse besonders bevorzugt, insbesondere wenn auch die Mittel Proteasen enthalten. Bevorzugte erfindungsgemäße Mittel enthalten zu diesem Zweck Stabilisatoren.A protein contained in an agent according to the invention, in particular also the polypeptide according to the invention, can be protected against damage, for example inactivation, denaturation or decomposition, for example by physical influences, oxidation or proteolytic cleavage, especially during storage. In microbial recovery of proteins and / or enzymes, inhibition of proteolysis is particularly preferred, especially if the agents also contain proteases. Preferred agents according to the invention contain stabilizers for this purpose.
Eine Gruppe von Stabilisatoren sind reversible Proteaseinhibitoren. Häufig werden hierfür Benzamidin-Hydrochlorid, Borax, Borsäuren, Boronsäuren oder deren Salze oder Ester eingesetzt, darunter vor allem Derivate mit aromatischen Gruppen, etwa ortho-, meta- oder para-substituierte Phenylboronsäuren, insbesondere 4-Formylphenyl-Boronsäure, beziehungsweise die Salze oder Ester der genannten Verbindungen. Auch Peptidaldehyde, das heißt Oligopeptide mit reduziertem C-Terminus, insbesondere solche aus 2 bis 50 Monomeren werden zu diesem Zweck eingesetzt. Zu den peptidischen reversiblen Proteaseinhibitoren gehören unter anderem Ovomucoid und Leu- peptin. Auch spezifische, reversible Peptid-Inhibitoren für die Protease Subtilisin sowie Fusionsproteine aus Proteasen und spezifischen Peptid-Inhibitoren sind hierfür geeignet.One group of stabilizers are reversible protease inhibitors. Benzamidine hydrochloride, borax, boric acids, boronic acids or their salts or esters are frequently used for this purpose, including, in particular, derivatives with aromatic groups, for example ortho, meta or para-substituted phenylboronic acids, in particular 4-formylphenylboronic acid, or the salts or Esters of the compounds mentioned. Also, peptide aldehydes, that is oligopeptides with a reduced C-terminus, especially those of 2 to 50 monomers are used for this purpose. The peptidic reversible protease inhibitors include, among others, ovomucoid and leupeptin. Also, specific, reversible peptide inhibitors for the protease subtilisin and fusion proteins from proteases and specific peptide inhibitors are suitable.
Weitere Enzymstabilisatoren sind Aminoalkohole wie Mono-, Di-, Triethanol- und -Propanolamin und deren Mischungen, aliphatische Carbonsäuren bis zu C12, wie beispielsweise Bernsteinsäure, andere Dicarbonsäuren oder Salze der genannten Säuren. Auch endgruppenverschlossene Fettsäureamidalkoxylate sind für diesen Zweck geeignet. Bestimmte als Builder eingesetzte organische Säuren vermögen, wie in WO 97/18287 offenbart, zusätzlich ein enthaltenes Enzym zu stabilisieren.Other enzyme stabilizers are amino alcohols such as mono-, di-, triethanol- and -propanolamine and mixtures thereof, aliphatic carboxylic acids up to C12, such as succinic acid, other dicarboxylic acids or salts of said acids. End-capped fatty acid amide alkoxylates are also suitable for this purpose. Certain organic acids used as builders are capable, as disclosed in WO 97/18287, of additionally stabilizing a contained enzyme.
Niedere aliphatische Alkohole, vor allem aber Polyole, wie beispielsweise Glycerin, Ethylenglykol, Propylenglykol oder Sorbit sind weitere häufig eingesetzte Enzymstabilisatoren. Auch Di- Glycerinphosphat schützt gegen Denaturierung durch physikalische Einflüsse. Ebenso werden Calcium- und/oder Magnesiumsalze eingesetzt, wie beispielsweise Calciumacetat oder Calcium- Formiat.
Polyamid-Oligomere oder polymere Verbindungen wie Lignin, wasserlösliche Vinyl-Copolymere oder Cellulose-Ether, Acryl-Polymere und/oder Polyamide stabilisieren die Enzym-Präparation unter anderem gegenüber physikalischen Einflüssen oder pH-Wert-Schwankungen. Polyamin-N- Oxid-enthaltende Polymere wirken gleichzeitig als Enzymstabilisatoren und als Farbübertragungsinhibitoren. Andere polymere Stabilisatoren sind lineare C8-Ci8 Polyoxyalkylene. Auch Alkylpolyglycoside können die enzymatischen Komponenten des erfindungsgemäßen Mittels stabilisieren und vermögen vorzugsweise diese zusätzlich in ihrer Leistung zu steigern. Vernetzte N-haltige Verbindungen erfüllen vorzugsweise eine Doppelfunktion als Soil-Release-Agentien und als Enzym-Stabilisatoren. Hydrophobes, nichtionisches Polymer stabilisiert insbesondere eine gegebenenfalls enthaltene Cellulase.Lower aliphatic alcohols, but especially polyols such as glycerol, ethylene glycol, propylene glycol or sorbitol are other frequently used enzyme stabilizers. Di-glycerol phosphate also protects against denaturation due to physical influences. Likewise, calcium and / or magnesium salts are used, such as calcium acetate or calcium formate. Polyamide oligomers or polymeric compounds such as lignin, water-soluble vinyl copolymers or cellulose ethers, acrylic polymers and / or polyamides stabilize the enzyme preparation, inter alia, against physical influences or pH fluctuations. Polyamine N-oxide containing polymers act simultaneously as enzyme stabilizers and as dye transfer inhibitors. Other polymeric stabilizers are linear C 8 -C 8 polyoxyalkylenes. Also, alkylpolyglycosides can stabilize the enzymatic components of the agent according to the invention and are able, preferably, to additionally increase their performance. Crosslinked N-containing compounds preferably perform a dual function as soil release agents and as enzyme stabilizers. Hydrophobic, nonionic polymer stabilizes in particular an optionally contained cellulase.
Reduktionsmittel und Antioxidantien erhöhen die Stabilität der Enzyme gegenüber oxidativem Zerfall; hierfür sind beispielsweise schwefelhaltige Reduktionsmittel geläufig. Andere Beispiele sind Natrium-Sulfit und reduzierende Zucker.Reducing agents and antioxidants increase the stability of the enzymes to oxidative degradation; For example, sulfur-containing reducing agents are familiar. Other examples are sodium sulfite and reducing sugars.
Besonders bevorzugt werden Kombinationen von Stabilisatoren eingesetzt, beispielsweise aus Polyolen, Borsäure und/oder Borax, die Kombination von Borsäure oder Borat, reduzierenden Salzen und Bernsteinsäure oder anderen Dicarbonsäuren oder die Kombination von Borsäure oder Borat mit Polyolen oder Polyaminoverbindungen und mit reduzierenden Salzen. Die Wirkung von Peptid-Aldehyd-Stabilisatoren wird günstigerweise durch die Kombination mit Borsäure und/oder Borsäurederivaten und Polyolen gesteigert und noch weiter durch die zusätzliche Wirkung von zweiwertigen Kationen, wie zum Beispiel Calcium-Ionen.Particular preference is given to using combinations of stabilizers, for example of polyols, boric acid and / or borax, the combination of boric acid or borate, reducing salts and succinic acid or other dicarboxylic acids or the combination of boric acid or borate with polyols or polyamino compounds and with reducing salts. The effect of peptide-aldehyde stabilizers is favorably enhanced by the combination with boric acid and / or boric acid derivatives and polyols, and still further by the additional action of divalent cations, such as calcium ions.
Da erfindungsgemäße Mittel in allen denkbaren Formen angeboten werden können, stellen erfindungsgemäße Polypeptide in allen für die Zugabe zu den jeweiligen Mitteln zweckmäßigen Formulierungen jeweilige Ausführungsformen der vorliegenden Erfindung dar. Dazu gehören beispielsweise flüssige Formulierungen, feste Granulate oder Kapseln.Since agents according to the invention can be offered in all conceivable forms, polypeptides according to the invention in all formulations suitable for addition to the respective compositions represent respective embodiments of the present invention. These include, for example, liquid formulations, solid granules or capsules.
Die verkapselte Form bietet sich an, um die Enzyme oder andere Inhaltsstoffe vor anderen Bestandteilen, wie beispielsweise Bleichmitteln, zu schützen oder um eine kontrollierte Freisetzung (controlled release) zu ermöglichen. Je nach der Größe dieser Kapseln wird nach MiIIi-, Mikro- und Nanokapseln unterschieden, wobei Mikrokapseln für Enzyme besonders bevorzugt sind. Solche Kapseln werden beispielsweise mit den Patentanmeldungen WO 97/24177 und DE 19918267 offenbart. Eine mögliche Verkapselungsmethode besteht darin, dass die Proteine, ausgehend von einer Mischung der Proteinlösung mit einer Lösung oder Suspension von Stärke oder einem Stärkederivat, in dieser Substanz verkapselt werden. Ein solches Verkapselungsverfahren wird mit der Anmeldung WO 01/38471 beschrieben.The encapsulated form lends itself to protecting the enzymes or other ingredients from other ingredients, such as bleaches, or to allow for controlled release. Depending on the size of these capsules, a distinction is made to MiIIi-, micro- and nanocapsules, with microcapsules for enzymes being particularly preferred. Such capsules are disclosed, for example, with the patent applications WO 97/24177 and DE 19918267. A possible encapsulation method is that the proteins are encapsulated in this substance, starting from a mixture of the protein solution with a solution or suspension of starch or a starch derivative. Such an encapsulation process is described in the application WO 01/38471.
Im Fall fester Mittel können die Proteine - erfindungsgemäße Polypeptide ebenso wie gegebenenfalls enthaltene weitere Enzyme - beispielsweise in getrockneter, granulierter und/oder
verkapselter Form eingesetzt werden. Sie können separat, das heißt als eigene Phase, oder mit anderen Bestandteilen zusammen in derselben Phase, mit oder ohne Kompaktierung zugesetzt werden. Sollen mikroverkapselte Enzyme in fester Form verarbeitet werden, so kann das Wasser mit aus dem Stand der Technik bekannten Verfahren aus den sich aus der Aufarbeitung ergebenden wäßrigen Lösungen entfernt werden, wie Sprühtrocknung, Abzentrifugieren oder durch Umsolubilisieren. Die auf diese Weise erhaltenen Teilchen haben üblicherweise eine Teilchengröße zwischen 50 und 200 μm.In the case of solid agents, the proteins - polypeptides according to the invention as well as optionally contained further enzymes - for example in dried, granulated and / or encapsulated form can be used. They may be added separately, ie as a separate phase, or with other ingredients together in the same phase, with or without compaction. If microencapsulated enzymes are to be processed in solid form, the water can be removed by methods known from the prior art from the aqueous solutions resulting from the workup, such as spray drying, centrifuging or by solubilization. The particles obtained in this way usually have a particle size between 50 and 200 microns.
Flüssigen, gelförmigen oder pastösen erfindungsgemäßen Mitteln können die Proteine ausgehend von einer nach dem Stand der Technik durchgeführten Proteingewinnung und Präparation in konzentrierter wäßriger oder nichtwäßriger Lösung, Suspension oder Emulsion zugesetzt werden, aber auch in Gelform oder verkapselt oder als getrocknetes Pulver. Derartige erfindungsgemäße Wasch- oder Reinigungsmittel werden in der Regel durch einfaches Mischen der Inhaltsstoffe hergestellt, die in Substanz oder als Lösung in einen automatischen Mischer gegeben werden können.The proteins may be added to liquid, gelatinous or pasty agents according to the invention in a concentrated aqueous or non-aqueous solution, suspension or emulsion starting from a protein recovery and preparation carried out in the prior art, but also in gel form or encapsulated or as a dried powder. Such detergents or cleaners according to the invention are generally prepared by simple mixing of the ingredients which can be added in bulk or as a solution in an automatic mixer.
Ein erfindungsgemäßes Reinigungsmittel, insbesondere ein erfindungsgemäßer Reiniger für harte Oberflächen, kann auch ein oder mehrere Treibmittel (INCI Propellants), üblicherweise in einer Menge von 1 bis 80 Gew.-%, vorzugsweise 1 ,5 bis 30 Gew.-%, insbesondere 2 bis 10 Gew.-%, besonders bevorzugt 2,5 bis 8 Gew.-%, äußerst bevorzugt 3 bis 6 Gew.-%, enthalten.A cleaning agent according to the invention, in particular a hard surface cleaner according to the invention, may also contain one or more propellants (INCI propellants), usually in an amount of 1 to 80% by weight, preferably 1 to 5 to 30% by weight, in particular 2 to 10 wt .-%, particularly preferably 2.5 to 8 wt .-%, most preferably 3 to 6 wt .-%, contained.
Eine besondere erfindungsgemäße Ausführungsform der vorliegenden Erfindung stellt die Verwendung eines erfindungsgemäßen Polypeptids zur Aktivierung, Deaktivierung oder Freisetzung von Inhaltsstoffen von Wasch- oder Reinigungsmitteln dar.A particular embodiment of the present invention represents the use of a polypeptide according to the invention for the activation, deactivation or release of ingredients of detergents or cleaners.
Einen besonderen Erfindungsgegenstand stellen weiterhin Verfahren zur Reinigung von Textilien oder von harten Oberflächen dar, bei denen wenigstens in einem der Verfahrensschritte ein erfindungsgemäßes Polypeptid verwendet wird.A special subject matter of the invention furthermore relates to processes for the purification of textiles or of hard surfaces in which a polypeptide according to the invention is used at least in one of the process steps.
Hierunter fallen sowohl manuelle als auch maschinelle Verfahren, wobei maschinelle Verfahren aufgrund ihrer präziseren Steuerbarkeit, was beispielsweise die eingesetzten Mengen und Einwirkzeiten angeht, bevorzugt sind.This includes both manual and mechanical processes, with mechanical processes being preferred on account of their more precise controllability, for example with regard to the quantities and reaction times used.
Einen weiteren Erfindungsgegenstand stellt die Verwendung einer erfindungsgemäßen Alkalische Protease zur Reinigung von Textilien oder von harten Oberflächen dar.A further subject of the invention is the use of an alkaline protease according to the invention for cleaning textiles or hard surfaces.
Ein weiterer Gegenstand der vorliegenden Erfindung ist auch ein Erzeugnis, enthaltend eine erfindungsgemäße Zusammensetzung bzw. ein erfindungsgemäßes Wasch- oder Reinigungsmittel, insbesondere einen erfindungsgemäßen Reiniger für harte Oberflächen, und einen Sprühspender. Bei dem Erzeugnis kann es sich hierbei sowohl um ein Einkammer- als auch
um ein Mehrkammerbehältnis, insbesondere ein Zweikammerbehältnis handeln. Bevorzugt ist der Sprühspender hierbei ein manuell aktivierter Sprühspender, insbesondere ausgewählt aus der Gruppe umfassend Aerosolsprühspender (Druckgasbehälter; auch u.a. als Spraydose bezeichnet), selbst Druck aufbauende Sprühspender, Pumpsprühspender und Triggersprühspender, insbesondere Pumpsprühspender und Triggersprühspender mit einem Behälter aus transparentem Polyethylen oder Polyethylenterephthalat. Sprühspender werden ausführlicher in der WO 96/04940 (Procter & Gamble) und den darin zu Sprühspendern zitierten US-Patenten, auf die in dieser Hinsicht sämtlich Bezug genommen und deren Inhalt hiermit in diese Anmeldung aufgenommen wird, beschrieben. Triggersprühspender und Pumpzerstäuber besitzen gegenüber Druckgasbehältern den Vorteil, daß kein Treibmittel eingesetzt werden muß. Durch geeignete, partikelgängige Aufsätze, Düsen etc. (sog. "nozzle- Ventile") auf dem Sprühspender kann das Enzym in dieser Ausführungsform gegebenenfalls auch in auf Partikeln immobilisierter Form dem Mittel beigefügt werden und so als Reinigungsschaum dosiert werden.Another object of the present invention is also a product comprising a composition according to the invention or a detergent or cleaning agent according to the invention, in particular a hard surface cleaner according to the invention, and a spray dispenser. The product may be both a single chamber and a single chamber to act a multi-chamber container, in particular a two-chamber container. The spray dispenser is preferably a manually activated spray dispenser, in particular selected from the group consisting of aerosol spray dispensers (pressurized gas containers, also known as spray can), pressure-building spray dispensers, pump spray dispensers and trigger spray dispensers, in particular pump spray dispensers and trigger spray dispensers with a container made of transparent polyethylene or polyethylene terephthalate. Spray dispensers are described in more detail in WO 96/04940 (Procter & Gamble) and the US patents cited therein about spray dispensers, to which reference is made in this regard and the contents of which are hereby incorporated by reference. Triggersprühspender and pump sprayer have over compressed gas tanks the advantage that no propellant must be used. By means of suitable particles-passing attachments, nozzles, etc. (so-called "nozzle valves") on the spray dispenser, the enzyme in this embodiment may optionally also be added to the composition in a form immobilized on particles and thus metered as cleaning foam.
Die nachfolgenden Beispiele erläutern die Erfindung weiter, ohne sie darauf zu beschränken.The following examples further illustrate the invention without being limited thereto.
Ausführungsbeispieleembodiments
Beispiel 1 : Durchführung der zirkulären PermutationExample 1: Carrying out the circular permutation
Das Gen für eine mature Protease wird mit den Fragmenten der DNA für einen variablen Linker (Linker P; Länge 1-40 Aminsäuren) auf beiden Seiten flankiert und das so erhaltene Konstrukt in ein Plasmid kloniert (das Ausgangsplasmid). Am 5'-Ende der in 5'-Richtung flankierenden sowie am 3'-Ende der in 3'-Richtung flankierenden beiden für den Linker P kodierenden DNA-Fragmente sind Restriktionsenzym-Schnittstellen lokalisiert, die nach einem Restriktionsverdau zueinander passende Überhänge ausbilden. Auf diese Weise können nach dem Restrikionsverdau die beiden das Gen des maturen Proteins flankierenden für den Linker P kodierenden DNA-Fragmente miteinander ligiert und somit auch die für den C- und den N-Terminus des maturen Proteins kodierenden Nukleinsäuren miteinander verknüpft werden. Das durch Restrikionsverdau erhaltene Konstrukt wird hierfür durch eine Ligase zu einem Ring geschlossen. Die Länge des Linker P wird so gewählt, dass die Distanz zwischen C- und N-Terminus im nativen Protein überbrückt werden kann.The gene for a mature protease is flanked with the fragments of DNA for a variable linker (linker P, length 1-40 amino acids) on both sides and the resulting construct cloned into a plasmid (the starting plasmid). At the 5 'end of the flanking in the 5' direction and at the 3 'end of the flanking in the 3' direction two coding for the linker P DNA fragments are located restriction enzyme cleavage sites that form after a restriction digest matching mounts. In this way, after the restriction digestion, the two DNA fragments flanking the gene of the mature protein can be ligated to one another and thus also the nucleic acids coding for the C- and the N-terminus of the mature protein can be linked to one another. The construct obtained by restriction digestion is closed by a ligase to form a ring. The length of the linker P is chosen so that the distance between the C and N terminus in the native protein can be bridged.
Nach der Ligation der für die C- und N-Termini kodierenden DNA wird der Ring dann enzymatisch an einer zufälligen Stelle geöffnet, so dass eine Nukleinsäure entsteht, die für eine mature Protease mit neuen C- und N-Termini kodiert. Mittels eines Screeningverfahrens können dann unter Verwendung eines Screeningplasmids in einem geeigneten Wirt solche durch zirkuläre Permutation erhaltene Nukleinsäuren identifiziert werden, die für eine aktive Protease mit nach Möglichkeit verbesserten Eigenschaften kodieren.
Die für das Präpro-Peptid der Protease kodierende Nukleinsäure wird gegebenenfalls am 3'-Ende mit einer für einen variablen Linker (Linker L; Länge 0-40 Aminosäuren) kodierenden Nukleinsäure versehen und in ein Plasmid kloniert (das Screeningplasmid), welches einen Promoter für die Expression der zu screenenden Konstrukte enthält und gegebenenfalls mit einem Resistenzgen ausgestattet ist. In 3'-Richtung von der für das Präpro-Peptid kodierenden Nukleinsäure bzw. - sofern vorhanden - in 3'-Richtung von der sich an die für das Präpro-Peptid kodierenden Nukleinsäure anschließenden für den Linker L kodierenden Nukleinsäure befinden sich eine oder mehrere Restriktionsenzym-Schnittstellen, um durch Blunt-End-Klonierung den Einbau der nach dem zuvor beschriebenen Verfahren erhaltenen zirkulären Permutationsmutante sowie deren anschließende Expression zu ermöglichen.After ligation of the C- and N-termini-encoding DNA, the ring is then enzymatically opened at a random site to yield a nucleic acid encoding a mature protease with novel C and N termini. By means of a screening method, then, by using a screening plasmid in a suitable host, those nucleic acids obtained by circular permutation can be identified, which code for an active protease with as far as possible improved properties. The nucleic acid coding for the prepropeptide of the protease is optionally provided at the 3 'end with a nucleic acid coding for a variable linker (linker L, length 0-40 amino acids) and cloned into a plasmid (the screening plasmid) which is a promoter for contains the expression of the constructs to be screened and is optionally equipped with a resistance gene. There are one or more restriction enzymes in the 3 'direction from the nucleic acid coding for the prepropeptide or, if present, in the 3' direction from the nucleic acid coding for the linker L for the nucleic acid coding for the prepropeptide Cleavage sites to allow blunt-end cloning to incorporate the circular permutation mutant obtained by the method described above and to subsequently label them.
Die Länge des Linker L hängt von der Distanz zwischen dem neuen C-Terminus der maturen Protease und der für die korrekte Prozessierung des Präproproteins erforderliche Positionierung des Präpro-Peptides in Bezug auf den neuen C-Terminus ab. Erfindungsgemäß wurde überraschenderweise herausgefunden, dass auf den Linker L in der Regel verzichtet werden kann, da die Prozessierung des Präproproteins in der Regel trotz der veränderten Position des Präpro- Peptids erfolgreich vonstatten geht.The length of the linker L depends on the distance between the new C-terminus of the mature protease and the prepropeptide's positioning relative to the new C-terminus required for correct preproprotein processing. According to the invention, it has surprisingly been found that the linker L can be dispensed with as a rule, since the preproprotein is generally processed successfully despite the changed position of the prepro peptide.
Im folgenden sind die einzelnen Verfahrensschritte noch mal in der Übersicht dargestellt.In the following, the individual process steps are shown again in the overview.
Verfahrensschritte:Steps:
1. Restriktion des Plasmids1. Restriction of the plasmid
Das Ausgangsplasmid wird mit den entsprechenden Enzymen gemäß Anleitung der Enzym-Hersteller verdaut, um das für das mature Protein kodierende, mit den für die Linker P-Fragmente kodierenden Nukleinsäuren flankierte Gen zu erhalten.The starting plasmid is digested with the appropriate enzymes as directed by the enzyme manufacturers to obtain the mature protein-encoding gene flanked by the nucleic acid encoding the linker P-fragments.
2. Agarose-Gelelektrophorese und Gelelution2. Agarose gel electrophoresis and gel elution
Der Verdau wird in einem Agarosegel aufgetrennt und anschließend wird die gewünschte Bande ausgeschnitten. Gelelution wird mit einem Kit nach Protokoll des Vertreibers durchgeführt.The digest is separated in an agarose gel and then the desired band is excised. Gel elution is carried out with a kit according to the distributor's protocol.
3. Circularisierung der DNA mit T4-Ligase3. Circularization of the DNA with T4 ligase
Der Ligationsansatz wird mit einer Konzentration an DNA von 1-5,5 ng/μL in Ligase- Puffer angesetzt und durch Zugabe von 1-40 Units Ligase gestartet.The ligation mixture is prepared with a concentration of DNA of 1-5.5 ng / μL in ligase buffer and started by addition of 1-40 units ligase.
4. Ethanolfällung4. ethanol precipitation
Um das Volumen zu verringern, wird eine Ethanolfällung durchgeführt.To reduce the volume, an ethanol precipitation is carried out.
5. Verdau der noch linearen DNA mit Exonuclease IM5. Digestion of the still linear DNA with exonuclease IM
Um die noch vorhandene lineare DNA abzubauen, wird ein Verdau mit Exonuclease III bei 37°C durchgeführt.To digest the remaining linear DNA, digestion with exonuclease III is performed at 37 ° C.
6. QIAquick Purification6. QIAquick Purification
Umpuffern der Probe nach dem PCR-Purification Protokoll des QIAquick Purification- Kit (Qiagen, Hilden, Deutschland)Buffering the sample according to the PCR Purification Protocol of the QIAquick Purification Kit (Qiagen, Hilden, Germany)
7. Partialer Verdau mit DNase I, gestoppt durch Zugabe von EDTA, zur Linearisierung des
circulierten Gens7. Partial digestion with DNase I, stopped by addition of EDTA, to linearize the circulated gene
Um die DNA zufällig zu linearisieren, wird diese mit sehr verdünnter DNasel beiTo randomize the DNA, it is supplemented with very dilute DNase
Raumtemperatur behandelt.Room temperature treated.
8. QIAquick Purification8. QIAquick Purification
Umpuffern der Probe nach dem PCR-Purification ProtokollBuffer the sample according to the PCR-Purification protocol
9. Reparation der linearisierten DNA mit T4 DNA Polymerase und T4 DNA Ligase bei Zugabe von dNTP's9. Repair of the linearized DNA with T4 DNA polymerase and T4 DNA ligase upon addition of dNTP ' s
Da beim DNase I-Verdau nicht immer perfekte blunt-Enden entstehen, werden diese in diesem Schritt generiert.Since DNase I digestion does not always produce perfect blunt ends, they are generated in this step.
10. Agarose-Gelelektrophorese und Gelelution10. Agarose gel electrophoresis and gel elution
Der Verdauungsprodukt wird in einem Agarosegel aufgetrennt und die Bande der gewünschten Größe wird ausgeschnitten. Gelelution wird mit einem Kit nach Protokoll durchgeführt.The digestion product is separated in an agarose gel and the band of the desired size is excised. Gel elution is done with a kit according to protocol.
11. Klonierung und Screening der linearisierten DNA11. Cloning and screening of the linearized DNA
Die linearisierte DNA wird in einen vorbereiteten Screening- Vektor kloniert und in einen Protease-negativen Bacillus Stamm transformiert. Mit den erhaltenen Kolonien wird ein Screening auf Protease-Aktivität durchgeführt.The linearized DNA is cloned into a prepared screening vector and transformed into a protease-negative Bacillus strain. The resulting colonies are screened for protease activity.
Hinsichtlich der Durchführung des zirkulären Permutationsverfahren wird des Weiteren auf folgende Literaturstellen verwiesen :With regard to the implementation of the circular permutation method, reference is also made to the following references:
Qian, Z. , Lutz, S. (2005) Journal of the American Chemical Society 127(39), S. 13466-13467;Qian, Z., Lutz, S. (2005) Journal of the American Chemical Society 127 (39), pp. 13466-13467;
Beernink et al. (2001 ) Protein Science, 10 (3), S. 528-537 ; Baird et al. (1999) Proceedings of theBeernink et al. (2001) Protein Science, 10 (3), pp. 528-537; Baird et al. (1999) Proceedings of the
National Academy of Sciences of the United States of America, 96 (20), S. 11241-11246.National Academy of Sciences of the United States of America, 96 (20), pp. 11241-11246.
Graf, R., Schachman, H. K. (1996) Proceedings ofthe National Academy of Sciences of the UnitedGraf, R., Schachman, H.K. (1996) Proceedings of the National Academy of Sciences of the United
States of America, 93 (21 ), S. 1 1591-11596.States of America, 93 (21), pages 1 1591-11596.
Beispiel 2: Zirkulare Permutation der BLAP-Protease unter Verwendung eines aus 14 Aminosäuren bestehenden LinkersExample 2: Circular permutation of the BLAP protease using a 14 amino acid linker
Zur Durchführung der zirkulären Permutation wurde das Gen der maturen BLAP-Protease verwendet, als Linker zur Verbrückung von N- und C-Terminus wurde ein Linker mit einer Länge von 14 Aminosäuren der Sequenz GAATSGKLNGSTAG (SEQ ID NO: 1 ) verwendet. Auf diese Weise wurde das im Folgenden dargestellte flankierte Konstrukt erhalten (dargestellt ist nicht die DNA selbst, sondern die zu der DNA korrespondierende Proteinsequenz):To carry out the circular permutation, the gene of the mature BLAP protease was used, and a linker with a length of 14 amino acids of the sequence GAATSGKLNGSTAG (SEQ ID NO: 1) was used as linker for bridging N- and C-terminus. In this way, the flanked construct shown below was obtained (shown is not the DNA itself, but the protein sequence corresponding to the DNA):
LNGSTAGKQSVPWGISRIVQAP AAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQD GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVANLS LGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFSQYG AGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGLNGSTAGKQSVPWGISRIVQAP AAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQD GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVANLS LGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFSQYG AGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLG
STNLYGSGLVNAEAATbAATSGK fSEQ ID NO: 7)
Die beiden Linker-Fragmente sind unterstrichen. Anfang und Ende des maturen Proteins sind durch Kästchen eingerahmt.STNLYGSGLVNAEAATbAATSGK fSEQ ID NO: 7) The two linker fragments are underlined. The beginning and the end of the mature protein are framed by boxes.
Nach Durchführung der zirkulären Permutation wurden unter anderem die beiden im Folgenden dargestellten zirkulären Permutationsvarianten NHT04240353 und NHT04241867 erhalten, die anschließend auf ihre Waschleistung überprüft wurden.After the circular permutation was carried out, inter alia, the following two circular permutation variants NHT04240353 and NHT04241867 were obtained, which were then tested for their washing performance.
Permutationsvariante NHT04240353:Permutation variant NHT04240353:
GEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNG MHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNR ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNG MHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNR ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQINNHLK
NTATSLGSTNLYGSkBLVNAEAATGAATSGKLNGSTAGKQSVPWGISRVQAPAAHNRGLTGSGVK VAVLDTGISTHPDLNIRGGASFVP (SEQ ID NO: 5)NTATSLGSTNLYGSkBLVNAEAATGAATSGKLNGSTAGKQSVPWGISRVQAPAAHNRGLTGSGVK VAVLDTGISTHPDLNIRGGASFVP (SEQ ID NO: 5)
Permutationsvariante NHT04241867:Permutation variant NHT04241867:
YASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSlGLVNAEAATGAATYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSlGLVNAEAATGAAT
SGKI NGSTAGKQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPS TQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVA NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFS QYGAGLDIVAPGVNVQSTYPGST (SEQ ID NO: 6)SGKI NGSTAGKQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPS TQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVA NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFS QYGAGLDIVAPGVNVQSTYPGST (SEQ ID NO: 6)
Beispiel 3: Waschversuche mit der zirkulären Permutationsvariante NHT04240353Example 3 Washing Experiments with the Circular Permutation Variant NHT04240353
Zur Überprüfung der Waschleistung des Klons NHT04240353 wurden folgende Anschmutzungen getestet: o Blut-Milch/Tusche auf Baumwolle: Produkt Nr. C5 von CFT B.V. Viaardingen, Holland o Voll-Ei/Pigment auf Baumwolle: Produkt Nr. 10N erhältlich von der Firma wfk TestgewebeTo check the washing performance of the clone NHT04240353, the following soils were tested: o Blood milk / ink on cotton: Product No. C5 from CFT B.V. Viaardingen, Holland o Full egg / pigment on cotton: Product No. 10N available from the company wfk Testgewebe
GmbH; Brüggen-Bracht, Deutschland, in kleine Stücke geschnitten o Shokolade-Milch/Tusche auf Baumwolle: Produkt Nr. C3 von CFT B.V. Viaardingen,GmbH; Brüggen-Bracht, Germany, cut into small pieces o Chocolate milk / ink on cotton: Product No. C3 from CFT B.V. Vlaardingen,
Holland o Erdnuss Öl-Pigment/Tusche auf Polyester/Baumwolle: Produkt Nr. PC10 von CFT B.V.Holland o peanut oil pigment / ink on polyester / cotton: product no. PC10 from CFT B.V.
Viaardingen, Holland o Gras auf Baumwolle: Produkt Nr. 164 von erhältlich von der Firma EidgenössischeViaardingen, Holland o Grass on cotton: Product No. 164 from available from the company Eidgenössische
Material- und Prüfanstalt (EMPA) Testmaterialien AG, St. Gallen, Schweiz o Kakao auf Baumwolle: Produkt Nr. 112 von erhältlich von der Firma EidgenössischeMaterials Testing Institute (EMPA) Test Materials AG, St. Gallen, Switzerland o Cocoa on cotton: Product No. 112 from available from Eidgenössische
Material- und Prüfanstalt (EMPA) Testmaterialien AG, St. Gallen, SchweizMaterials Testing Institute (EMPA) Test Materials AG, St. Gallen, Switzerland
Die zirkuläre Permutationsvariante wurde in die im Folgenden dargestellte Rahmenrezeptur eingearbeitet und ihre Waschleistung im Vergleich zu dem Ausgangsenzym BLAP überprüft.
Tabelle 1 : Rahmenrezeptur für ein TextilwaschmittelThe circular permutation variant was incorporated into the framework formulation presented below and its washing performance compared to the starting enzyme BLAP checked. Table 1: Frame formulation for a laundry detergent
Testansatz (1 ml) in 48-well-Platten:Test batch (1 ml) in 48-well plates:
Inkubation: 60 Min., 400C, ca. 600rpmIncubation: 60 min, 40 0 C, about 600rpm.
Nach der Inkubation: Spülen (3x) der Anschmutzungen, trocknen und fixieren Helligkeitsmessung mit Farbmessgerät Cm508d (Minolta)After incubation: Rinse (3x) the stains, dry and fix Brightness measurement with colorimeter Cm508d (Minolta)
Zur Durchführung dieses Tests wurden runde Stücke der Testgewebe (Durchmesser 10 mm) in einer 24-well-Mikrotiterplatte in 1 ml Waschlauge für 30 min bei 37°C und einer Schüttelfrequenz von 100 rpm inkubiert. Jeder Versuch wurde als Dreifachbestimmung durchgeführt.To carry out this test, round pieces of the test tissues (diameter 10 mm) were incubated in a 24-well microtiter plate in 1 ml of wash liquor for 30 min at 37 ° C. and a shaking frequency of 100 rpm. Each experiment was carried out in triplicate.
Nach dem Waschen wurde der Weißgrad der gewaschenen Textilien im Vergleich zu einem Weißstandard (d/8, 8mm, SCI/SCE) gemessen, der auf 100% normiert worden war (Bestimmung des L-Werts). Die Messung erfolgte an einem Farbmessgerät (Minolta Cm508d) mit einer
Lichtarteinstellung von 107D65. Die erhaltenen Ergebnisse werden als Prozent Leistung angegeben, wobei die Differenz der Remissionswerte vom Basiswaschmittel ohne Enzyme zu dem mit WT Protease auf 100% normiert wurde.After washing, the whiteness of the washed fabrics was measured in comparison to a white standard (d / 8, 8mm, SCI / SCE) normalized to 100% (determination of L value). The measurement was carried out on a colorimeter (Minolta Cm508d) with a Light setting of 107D65. The results obtained are reported as percent power, with the difference in remission values from the base detergent without enzymes to that with WT protease normalized to 100%.
Es wurde so herausgefunden, dass die Variante NHT04240353 überraschenderweise eine um etwa 50 % bessere Reinigungsleistung gegenüber Ganzei/Ruß und Kakao aufweist als der Wildtyp BLAP, während die Reinigungsleistung gegenüber Gras und Milch/Öl etwa genauso gut ist wie die des Wildtyps und die Reinigungsleistung gegenüber Blut/Milch/Tusche und Schokomilch/Ruß etwas schlechter ist als die des Wildtyps.It has thus been found that the NHT04240353 variant surprisingly has around 50% better wholey / soot and cocoa cleaning performance than the wild-type BLAP, while the cleaning performance over grass and milk / oil is about as good as that of the wild type and cleaning performance Blood / milk / ink and chocolate milk / soot is slightly worse than the wild type.
Abbildungenpictures
In den Abbildungen sind die Ergebnisse der Waschversuche mit der zirkulären Permutationsvariante NHT04240353 gemäß Beispiel 3 dargestellt. In Fig. 1 sind die Ergebnisse aus den Waschversuchen mit Blut/Milch/Tusche, Ganzei/Ruß sowie Schokomilch/Ruß dargestellt. In Fig. 2 sind die Ergebnisse aus den Waschversuchen mit Gras, Milch/Öl, Kakao sowie erneut Blut/Milch/Tusche dargestellt. Die Ergebnisse mit dem Wildtyp (WT), also BLAP, sind jeweils auf 100 % gesetzt.The figures show the results of the washing experiments with the circular permutation variant NHT04240353 according to Example 3. In Fig. 1, the results of the washing tests with blood / milk / ink, whole / soot and chocolate milk / soot are shown. In Fig. 2, the results of the washing tests with grass, milk / oil, cocoa and again blood / milk / ink are shown. The results with the wild type (WT), so BLAP, are set to 100%.
Beispiel 4: Lokalisierung der Loops spezieller ProteasenExample 4: Localization of Loops of Special Proteases
a) Loops von BLAP (Bacillus lentus Alkalische Protease) Die Loops befinden sich in folgenden Sequenzabschnitten:a) Loops of BLAP (Bacillus lentus Alkaline Protease) The loops are in the following sequence sections:
AIa 1-VaI 4, Arg 10 - Pro 14, Asn 18 - VaI 26, Asp 32 - GIy 45, Phe 49 - His 62, He 70 - Ser 76, GIy 78 - GIu 87, VaI 93 - He 102, Asn 1 15 - His 118, Leu 122 - AIa 131 , Ser 142 - Leu 146, Ser 154 - Met 169, Asp 175 - Asn 179, AIa 181 - Phe 183, GIy 185 - He 192, GIy 196 - VaI 199, Tyr 203 - Thr 207, Leu 211 - Ser 215, Lys 231 - Asn 237, Thr 247 - AIa 264 und AIa 267 - ThrAla 1-VaI 4, Arg 10-Pro 14, Asn 18-Val 26, Asp 32-Gly 45, Phe 49-His 62, He 70-Ser 76, Gly 78-Glu 87, Val 93-He 102, Asn 1 15 - His 118, Leu 122 - Ala 131, Ser 142 - Leu 146, Ser 154 - Met 169, Asp 175 - Asn 179, Ala 181 - Phe 183, Gly 185 - He 192, Gly 196 - VaI 199, Tyr 203 - Thr 207, Leu 211 - Ser 215, Lys 231 - Asn 237, Thr 247 - Ala 264 and Ala 267 - Thr
268.268th
Die Aminosäuresequenz von BLAP ist wie folgt:The amino acid sequence of BLAP is as follows:
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGT HVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVANLSLGSPSPS ATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAP GVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGS GLVNAEAATR (SEQ ID NO: 1 )AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGT HVAGTIAALNNSIGVLGVAPSAELYAVKVLGADGRGAISSIAQGLEWAGNNGMHVANLSLGSPSPS ATLEQAVNSATSRGVLVVAASGNSGASSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAP GVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGS GLVNAEAATR (SEQ ID NO: 1)
b) Loops von BPN'b) Loops of BPN '
Die Loops befinden sich in folgenden Sequenzabschnitten:The loops are in the following sequence sections:
AIa 1 - GIy 7 , GIn 10 - Pro 14, GIn 19 - VaI 26 , Asp 32 - GIy 46, Phe 50 - His 64, VaI 95 - TyrAIa 1 - Gly 7, GIn 10 - Pro 14, GIn 19 - VaI 26, Asp 32 - Gly 46, Phe 50 - His 64, VaI 95 - Tyr
104, Asn 1 17 - Asp 120, Met 124 - AIa 133, Ser 145 - VaI 148, GIu 156 - He 175, Asp 181 - GIn
185, AIa 187 - Phe 189, Ser 191 - VaI 198, GIy 202 - He 205, Leu 209 - Lys 213, Lys 217 - Thr 220, Lys 237 - Asn 243, Asn 252 - VaI 270 und AIa 273 - GIn 275.104, Asn 1 17 - Asp 120, Met 124 - Ala 133, Ser 145 - Val 148, Glu 156 - He 175, Asp 181 - GIn 185, Ala 187 - Phe 189, Ser 191 - VaI 198, Gly 202 - He 205, Leu 209 - Lys 213, Lys 217 - Thr 220, Lys 237 - Asn 243, Asn 252 - VaI 270 and Ala 273 - GIn 275.
Die Aminosäuresequenz von BPN' ist wie folgt:The amino acid sequence of BPN 'is as follows:
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPALKVAGGASFVPSETNPFQDNNSHG THVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVD KAVASGVWVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSI WSTLPGNKYGAKSGTCMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINV EAAAQ (SEQ ID NO: 2)AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPALKVAGGASFVPSETNPFQDNNSHG THVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVD KAVASGVWVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSI WSTLPGNKYGAKSGTCMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINV EAAAQ (SEQ ID NO: 2)
c) Loops von Subtilisin Carlsberg / P300:c) Loops of Subtilisin Carlsberg / P300:
Die Loops befinden sich in folgenden Sequenzabschnitten:The loops are in the following sequence sections:
AIa 1 - GIy 7, Pro 9 - AIa 13, GIn 19 - VaI 26, Asp 32 - GIy 46, Phe 50 - His 64, VaI 72 - Ser 89,AIa 1 - Gly 7, Pro 9 - Ala 13, GIn 19 - VaI 26, Asp 32 - Gly 46, Phe 50 - His 64, VaI 72 - Ser 89,
VaI 95 - Tyr 104, Thr 116 - VaI 121 , Met 124 - AIa 134, Arg 145 - VaI 148, Ser 156 - He 175, AspVaI 95 - Tyr 104, Thr 116 - VaI 121, Met 124 - Ala 134, Arg 145 - VaI 148, Ser 156 - He 175, Asp
181 - Asn 185, AIa 187 - Phe 189, Ser 191 - VaI 198, GIy 202 - VaI 205, Tyr 209 - Thr 213, Leu181 - Asn 185, Ala 187 - Phe 189, Ser 191 - VaI 198, Gly 202 - VaI 205, Tyr 209 - Thr 213, Leu
217 - Thr 220, Lys 237 - AIa 243, Leu 250 - VaI 270 und AIa 274 - GIn 275.217 - Thr 220, Lys 237 - Ala 243, Leu 250 - VaI 270 and Ala 274 - GIn 275.
Die Aminosäuresequenz von Subtilisin Carlsberg ist wie folgt:The amino acid sequence of subtilisin Carlsberg is as follows:
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNWGGASFVAGEAYNTDGNGHGT HVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASG STAMKQAVDNAYARGWWAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAEL EVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSF YYGKGLINVEAAAQ (SEQ ID NO: 3)
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNWGGASFVAGEAYNTDGNGHGT HVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASG STAMKQAVDNAYARGWWAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAEL EVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSF YYGKGLINVEAAAQ (SEQ ID NO: 3)
Claims
1. Polypeptide ausgewählt aus a) Zirkularen Permutationsvarianten des maturen Proteins eines natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteins, b) Varianten von zirkulären Permutationsvarianten gemäß (a) mit einer Sequenzhomologie und/oder -identität von mindestens 80 % gegenüber der Sequenz einer zirkulären Permutationsvariante gemäß (a) einschließlich und/oder ausschließlich der Sequenz des verbrückenden Linkers, c) Varianten von zirkulären Permutationsvarianten gemäß (a) mit Substitutionen, Insertionen, Deletionen oder Inversionen von bis zu 30 Aminosäuren in Bezug auf die Polypeptidsequenz eines Polypeptids gemäß (a) einschließlich und/oder ausschließlich der Sequenz des verbrückenden Linkers, d) Polypeptide, die Proteinvarianten gemäß (a), (b) oder (c) umfassen.1. Polypeptides selected from a) circular permutation variants of the mature protein of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, b) variants of circular permutation variants according to (a) with a sequence homology and / or identity of at least 80% with respect to the sequence a circular permutation variant according to (a) including and / or excluding the sequence of the bridging linker, c) variants of circular permutation variants according to (a) with substitutions, insertions, deletions or inversions of up to 30 amino acids with respect to the polypeptide sequence of a polypeptide according to ( a) including and / or excluding the sequence of the bridging linker, d) polypeptides comprising protein variants according to (a), (b) or (c).
2. Polypeptide gemäß Anspruch 1 , dadurch gekennzeichnet, dass es sich bei dem natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Protein um ein Enyzm handelt.2. Polypeptides according to claim 1, characterized in that it is in the naturally expressed as a preprotein, proprotein and / or preproprotein protein is an enzyme.
3. Polypeptide gemäß Anspruch 2, dadurch gekennzeichnet, dass es sich bei dem Enyzm um eine Protease handelt.3. polypeptides according to claim 2, characterized in that it is the enzyme is a protease.
4. Polypeptide gemäß Anspruch 3, dadurch gekennzeichnet, dass es sich bei der Protease um eine alkalische Protease vom Subtilisin-Typ handelt.4. Polypeptides according to claim 3, characterized in that the protease is an alkaline protease of the subtilisin type.
5. Polypeptide gemäß Anspruch 4, dadurch gekennzeichnet, dass die alkalische Protease vom Subtilisin-Typ ausgewählt ist aus BLAP, BPN' und Subtilisin Carlsberg und Homologen davon.5. Polypeptides according to claim 4, characterized in that the subtilisin-type alkaline protease is selected from BLAP, BPN 'and subtilisin Carlsberg and homologs thereof.
6. Polypeptide gemäß Anspruch 5, dadurch gekennzeichnet, dass die zirkulären Permutationsvarianten von BLAP ausgewählt sind aus Polypeptiden mit einer Sequenzhomologie und/oder Identität von mindestens 80 % zu einen Polypeptid gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6 und/oder aus Polypeptiden mit Insertionen, Deletionen oder Inversionen von bis zu 30 Aminosäuren in Bezug auf ein Polypeptid mit einer Polypeptidsequenz gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6.6. Polypeptides according to claim 5, characterized in that the circular permutation variants of BLAP are selected from polypeptides having a sequence homology and / or identity of at least 80% to a polypeptide according to SEQ ID NO: 5 or according to SEQ ID NO: 6 and / or from polypeptides having insertions, deletions or inversions of up to 30 amino acids with respect to a polypeptide having a polypeptide sequence according to SEQ ID NO: 5 or according to SEQ ID NO: 6.
7. Polypeptide nach einem der Ansprüche 1 bis 6, dadurch gekennzeichnet, dass die originären Termini des maturen Proteins durch einen Linker einer Länge von 1 bis 40 Aminsoäuren miteinander verbrückt sind . 7. Polypeptides according to one of claims 1 to 6, characterized in that the original termini of the mature protein are bridged together by a linker of a length of 1 to 40 amino acids.
8. Polypeptide nach einem der Ansprüche 1 bis 7, dadurch gekennzeichnet, dass die neuen Termini der zirkulären Permutationsvariante mindestens 10 Aminosäuren von den ursprünglichen Termini entfernt sind.8. polypeptides according to one of claims 1 to 7, characterized in that the new terms of the circular permutation variant at least 10 amino acids are removed from the original termini.
9. Polypeptide nach einem der Ansprüche 1 bis 8, dadurch gekennzeichnet, dass sich die neuen Termini der zirkulären Permutationsvariante im Bereich eines Loops des Ausgangsproteins befinden.9. Polypeptides according to one of claims 1 to 8, characterized in that the new terms of the circular permutation variant are in the region of a loop of the starting protein.
10. Polypeptide nach einem der Ansprüche 1 bis 8, dadurch gekennzeichnet, dass sich die neuen Termini der zirkulären Permutationsvariante nicht im Bereich eines Loops des Ausgangsproteins befinden.10. polypeptides according to one of claims 1 to 8, characterized in that the new terms of the circular permutation variant are not in the range of a loop of the source protein.
11. Verfahren zur Herstellung einer zirkulären Permutationsvariante eines natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteins, folgende Schritte umfassend: a) Durchführung eines zirkulären Permutationsverfahrens mit der DNA des maturen Proteins, b) Einbau der mit dem Verfahren gemäß (a) erhaltenen DNA in einen geeigneten Vektor in 3'-Richtung zu der für ein Signalpeptid, Propeptid und/oder Präpropeptid kodierenden DNA, c) Einbringen des Vektors in einen geeigneten Wirt zur Expression der DNA sowie gegebenenfalls Reinigung des erhaltenen Proteins.11. A process for producing a circular permutation variant of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, comprising the following steps: a) carrying out a circular permutation process with the DNA of the mature protein, b) incorporating the obtained with the method according to (a) DNA in a suitable vector in the 3 'direction to the DNA coding for a signal peptide, propeptide and / or prepropeptide, c) introduction of the vector into a suitable host for expression of the DNA and optionally purification of the protein obtained.
12. Polynukleotide ausgewählt aus a) für zirkuläre Permutationsvarianten des maturen Proteins von natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteinen kodierende Polynukleotide, b) Mutanten von Polynukleotiden gemäß (a) mit einer Sequenzhomologie und/oder - identität von mindestens 80 % gegenüber einem Polynukleotid gemäß (a) einschließlich und/oder ausschließlich derfür den verbrückenden Linker kodierenden Sequenz, c) Mutanten von Polynukleotiden gemäß (a) mit Substitutionen, Insertionen, Deletionen oder Inversionen von bis zu 50 Nukleotiden, insbesondere mit Insertionen oder Deletionen von genau einem Nukleotid in Bezug auf die Polynukleotidsequenz eines Polynukleotids gemäß (a) einschließlich und/oder ausschließlich derfür den verbrückenden Linker kodierenden Sequenz, d) Polynukleotide, die Polynukleotide gemäß (a), (b) oder (c) umfassen, e) Polynukleotide, die für Polypeptide gemäß einem der Ansprüche 1 bis 8 kodieren, f) Polynukleotide, die zu Polynukleotiden gemäß (a), (b), (c), (d) oder (e) komplementär sind. 12. Polynucleotides selected from a) for circular Permutationsvarianten the mature protein of naturally expressed as preprotein, protein and / or preproprotein proteins encoded polynucleotides, b) mutants of polynucleotides according to (a) with a sequence homology and / or - identity of at least 80% a polynucleotide according to (a) inclusive and / or excluding the bridging linker coding sequence, c) mutants of polynucleotides according to (a) with substitutions, insertions, deletions or inversions of up to 50 nucleotides, in particular with insertions or deletions of exactly one nucleotide d) polynucleotides comprising polynucleotides according to (a), (b) or (c), e) polynucleotides coding for polypeptides according to one of claims 1 to 8 encode f) polynucleotides which are complementary to polynucleotides according to (a), (b), (c), (d) or (e).
13. Polynukleotide gemäß Anspruch 12, dadurch gekennzeichnet, dass es sich bei dem natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Protein um ein Enyzm handelt.13. polynucleotides according to claim 12, characterized in that it is in the naturally expressed as a preprotein, proprotein and / or preproprotein protein is an enzyme.
14. Polynukleotide gemäß Anspruch 13, dadurch gekennzeichnet, dass es sich bei dem Enzym um eine Protease handelt.14. polynucleotides according to claim 13, characterized in that it is the enzyme is a protease.
15. Polynukleotide gemäß Anspruch 14, dadurch gekennzeichnet, dass es sich bei der Protease um eine alkalische Protease vom Subtilisin-Typ handelt.15. Polynucleotides according to claim 14, characterized in that the protease is an alkaline protease of the subtilisin type.
16. Polynukleotide gemäß Anspruch 15, dadurch gekennzeichnet, dass die alkalische Protease vom Subtilisin-Typ ausgewählt ist aus BLAP, BPN' und Subtilisin Carlsberg.16. polynucleotides according to claim 15, characterized in that the subtilisin-type alkaline protease is selected from BLAP, BPN 'and subtilisin Carlsberg.
17. Polynukleotide gemäß Anspruch 16, kodierend für eine zirkuläre Permutationsvariante von BLAP ausgewählt aus Polypeptiden mit einer Sequenzhomologie und/oder -identität von mindestens 80 % zu einem Polypeptid gemäß SEQ ID NO: 5 oder gemäß SEQ ID NO: 6.17. Polynucleotides according to claim 16, encoding a circular permutation variant of BLAP selected from polypeptides having a sequence homology and / or identity of at least 80% to a polypeptide according to SEQ ID NO: 5 or according to SEQ ID NO: 6.
18. Vektor, enthaltend ein Polynukleotid nach einem der Ansprüche 12 bis 17.18. A vector containing a polynucleotide according to any one of claims 12 to 17.
19. Wirtszelle, enthaltend ein Polypeptid nach einem der Ansprüche 1 bis 10, ein Polynukleotid nach einem der Ansprüche 12 bis 17 und/oder einen Vektor nach Anspruch 18.19. A host cell containing a polypeptide according to any one of claims 1 to 10, a polynucleotide according to any one of claims 12 to 17 and / or a vector according to claim 18.
20. Verfahren zur Herstellung der für eine zirkuläre Permutationsvariante eines natürlicherweise als Präprotein, Proprotein und/oder Präproprotein exprimierten Proteins, dadurch gekennzeichnet, dass die für das mature Protein kodierende DNA einem Zirkularen Permutationsverfahren unterworfen wird.20. A process for the preparation of the circular permutation variant of a protein naturally expressed as a preprotein, proprotein and / or preproprotein, characterized in that the DNA coding for the mature protein is subjected to a circular permutation process.
21. Mittel enthaltend ein Polypeptid nach einem der Ansprüche 1 bis 10.21. A composition comprising a polypeptide according to one of claims 1 to 10.
22. Mittel nach Anspruch 21 , dadurch gekennzeichnet, dass es sich um Wasch- und/oder Reinigungsmittel handelt.22. Composition according to claim 21, characterized in that it is washing and / or cleaning agent.
23. Mittel nach Anspruch 21 , dadurch gekennzeichnet, dass es sich um eine kosmetische oder pharmazeutische Zubereitung handelt. 23. Composition according to claim 21, characterized in that it is a cosmetic or pharmaceutical preparation.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE102007049830A DE102007049830A1 (en) | 2007-10-16 | 2007-10-16 | New protein variants by circular permutation |
PCT/EP2008/062937 WO2009050022A1 (en) | 2007-10-16 | 2008-09-26 | Novel protein variants by circular permutation |
Publications (1)
Publication Number | Publication Date |
---|---|
EP2197904A1 true EP2197904A1 (en) | 2010-06-23 |
Family
ID=40269664
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP08804812A Withdrawn EP2197904A1 (en) | 2007-10-16 | 2008-09-26 | Novel protein variants by circular permutation |
Country Status (6)
Country | Link |
---|---|
US (1) | US20100196991A1 (en) |
EP (1) | EP2197904A1 (en) |
JP (1) | JP2011500042A (en) |
CN (1) | CN101821285A (en) |
DE (1) | DE102007049830A1 (en) |
WO (1) | WO2009050022A1 (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE102009029513A1 (en) * | 2009-09-16 | 2011-03-24 | Henkel Ag & Co. Kgaa | Storage-stable liquid washing or cleaning agent containing proteases |
DE102011118032A1 (en) | 2011-05-31 | 2012-12-06 | Henkel Ag & Co. Kgaa | Expression vectors for improved protein secretion |
RS61391B1 (en) | 2012-06-08 | 2021-02-26 | Alkermes Pharma Ireland Ltd | Ligands modified by circular permutation as agonists and antagonists |
US11359182B2 (en) | 2017-09-12 | 2022-06-14 | Ginkgo Bioworks, Inc. | Protective enzymes |
CN110846299B (en) * | 2019-11-22 | 2021-09-24 | 江南大学 | Leader peptide mutant and application thereof in keratinase production |
Family Cites Families (69)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1154730A (en) | 1965-10-08 | 1969-06-11 | Ici Ltd | Improvements in the Laundering of Synthetic Polymeric Textile Materials |
GB1377092A (en) | 1971-01-13 | 1974-12-11 | Unilever Ltd | Detergent compositions |
CA989557A (en) | 1971-10-28 | 1976-05-25 | The Procter And Gamble Company | Compositions and process for imparting renewable soil release finish to polyester-containing fabrics |
US4116885A (en) | 1977-09-23 | 1978-09-26 | The Procter & Gamble Company | Anionic surfactant-containing detergent compositions having soil-release properties |
CA1190695A (en) | 1981-05-14 | 1985-07-16 | George J. Stockburger | Anionic textile treating compositions |
DE3324258A1 (en) | 1982-07-09 | 1984-01-12 | Colgate-Palmolive Co., 10022 New York, N.Y. | NON-IONOGENIC DETERGENT COMPOSITION WITH IMPROVED DIRWASHABILITY |
DE3413571A1 (en) | 1984-04-11 | 1985-10-24 | Hoechst Ag, 6230 Frankfurt | USE OF CRYSTALLINE LAYERED SODIUM SILICATES FOR WATER SOFTENING AND METHOD FOR WATER SOFTENING |
DE3585505D1 (en) | 1984-12-21 | 1992-04-09 | Procter & Gamble | BLOCK POLYESTER AND SIMILAR COMPOUNDS, USED AS A DETOIL REMOVER IN DETERGENT COMPOSITIONS. |
US4713194A (en) | 1986-04-15 | 1987-12-15 | The Procter & Gamble Company | Block polyester and like compounds having branched hydrophilic capping groups useful as soil release agents in detergent compositions |
US4711730A (en) | 1986-04-15 | 1987-12-08 | The Procter & Gamble Company | Capped 1,2-propylene terephthalate-polyoxyethylene terephthalate polyesters useful as soil release agents |
GB8617255D0 (en) | 1986-07-15 | 1986-08-20 | Procter & Gamble Ltd | Laundry compositions |
GB8629936D0 (en) | 1986-12-15 | 1987-01-28 | Procter & Gamble | Laundry compositions |
US4721580A (en) | 1987-01-07 | 1988-01-26 | The Procter & Gamble Company | Anionic end-capped oligomeric esters as soil release agents in detergent compositions |
DE68925765T2 (en) | 1988-08-26 | 1996-10-02 | Procter & Gamble | Soil repellents with sulphonated end groups derived from allyl groups |
DK0493398T3 (en) | 1989-08-25 | 2000-05-22 | Henkel Research Corp | Alkaline, proteolytic enzyme and process for its preparation |
IT1249883B (en) | 1990-08-13 | 1995-03-30 | Ferruzzi Ricerca & Tec | CALCIUM SEQUESTRING AGENTS BASED ON OXIDIZED CARBOHYDRATES AND THEIR USE AS BUILDER FOR DETERGENTS |
US5230891A (en) | 1990-08-20 | 1993-07-27 | Kanebo Limited | Modified protease, method of producing the same and cosmetic products containing the modified protease |
US5340735A (en) | 1991-05-29 | 1994-08-23 | Cognis, Inc. | Bacillus lentus alkaline protease variants with increased stability |
ATE155165T1 (en) | 1991-07-31 | 1997-07-15 | Ausimont Spa | METHOD FOR INCREASING THE BLEACHING EFFECTIVENESS OF AN INORGANIC PER SALT |
CN1057117C (en) | 1993-05-20 | 2000-10-04 | 普罗格特-甘布尔公司 | Bleaching compositions comprising N-acyl caprolactam activators |
AU6833394A (en) | 1993-05-20 | 1994-12-20 | Procter & Gamble Company, The | Bleaching compounds comprising n-acyl caprolactam for use in hand-wash or other low-water cleaning systems |
DE69412092T2 (en) | 1993-05-20 | 1999-04-01 | Procter & Gamble | FIBER WHICH CONTAINS A SUBSTITUTED BENZOYL CAPROLACTAM BLEACH ACTIVATOR |
US5405413A (en) | 1993-06-24 | 1995-04-11 | The Procter & Gamble Co. | Bleaching compounds comprising acyl valerolactam bleach activators |
DE4338922A1 (en) | 1993-11-15 | 1995-05-18 | Degussa | Activators for inorganic peroxygen compounds |
ES2133710T3 (en) | 1993-11-25 | 1999-09-16 | Warwick Int Group | WHITENING COMPOSITIONS. |
US5534196A (en) | 1993-12-23 | 1996-07-09 | The Procter & Gamble Co. | Process for making lactam bleach activator containing particles |
DE4344215A1 (en) | 1993-12-23 | 1995-06-29 | Cognis Bio Umwelt | Silver corrosion inhibitor-containing enzyme preparation |
ATE512226T1 (en) | 1994-02-24 | 2011-06-15 | Henkel Ag & Co Kgaa | IMPROVED ENZYMES AND DETERGENTS WITH IT |
ES2149364T3 (en) | 1994-05-20 | 2000-11-01 | Henkel Kgaa | POLYESTERS WITH THE CAPACITY TO RELEASE THE DIRT. |
US5602004A (en) | 1994-07-20 | 1997-02-11 | Novo Nordisk Biotech, Inc. | Thermophilic fungal expression system |
DE4426216A1 (en) | 1994-07-23 | 1996-01-25 | Merck Patent Gmbh | Benzylidene Norcampher Derivatives |
DE4426215A1 (en) | 1994-07-23 | 1996-01-25 | Merck Patent Gmbh | Ketotricyclo [5.2.1.0] decane derivatives |
RU2149025C1 (en) | 1994-08-12 | 2000-05-20 | Дзе Проктер Энд Гэмбл Компани | Composition for elimination of unpleasant odor on article surface, industrial article and method of treatment of article surface |
DE4443177A1 (en) | 1994-12-05 | 1996-06-13 | Henkel Kgaa | Activator mixtures for inorganic per compounds |
GB9503474D0 (en) | 1995-02-22 | 1995-04-12 | Ciba Geigy Ag | Compounds and their use |
DE19601063A1 (en) | 1995-03-06 | 1996-09-12 | Hoechst Ag | Crystalline layered sodium silicate |
CN1182451A (en) | 1995-03-17 | 1998-05-20 | 诺沃挪第克公司 | Novel endoglucanases |
DE69632910T3 (en) | 1995-04-28 | 2009-09-24 | Henkel Ag & Co. Kgaa | CELLULASES CONTAINING DETERGENT |
GB9514090D0 (en) | 1995-07-11 | 1995-09-13 | Cerestar Holding Bv | Non-catalysed oxidation of maltodextrin with an oxygen containing oxidant |
DE19530816A1 (en) | 1995-08-23 | 1997-02-27 | Cognis Bio Umwelt | Use of mutant subtilisin protease in cosmetic products |
DK0857216T3 (en) | 1995-10-17 | 2014-12-15 | Ab Enzymes Oy | Cellulases, GENES ENCODING THEM AND USES THEREOF |
US5741767A (en) | 1995-11-16 | 1998-04-21 | Lever Brothers Company, Division Of Conopco, Inc. | Peracid based dishwashing detergent composition |
EP0873183B1 (en) | 1995-12-29 | 2001-09-26 | Novozymes A/S | Enzyme-containing particles and liquid detergent concentrate |
DE19600018A1 (en) | 1996-01-03 | 1997-07-10 | Henkel Kgaa | Detergent with certain oxidized oligosaccharides |
FR2745014B1 (en) | 1996-02-20 | 1998-04-03 | Rhone Poulenc Chimie | ANTI-FOULING TREATMENT PROCESS FOR ARTICLES BASED ON WOVEN COTTON |
DE19616693A1 (en) | 1996-04-26 | 1997-11-06 | Henkel Kgaa | Enol esters as bleach activators for detergents and cleaning agents |
DE19616769A1 (en) | 1996-04-26 | 1997-11-06 | Henkel Kgaa | Acylacetals as bleach activators for detergents and cleaning agents |
DE19616767A1 (en) | 1996-04-26 | 1997-11-06 | Henkel Kgaa | Bleach activators for detergents and cleaning agents |
DE19616770A1 (en) | 1996-04-26 | 1997-11-06 | Henkel Kgaa | Acyl lactams as bleach activators for detergents and cleaning agents |
DE59709127D1 (en) | 1996-07-08 | 2003-02-20 | Ciba Sc Holding Ag | Triazine derivatives as UV filters in sunscreens |
CN100362100C (en) | 1996-09-17 | 2008-01-16 | 诺沃奇梅兹有限公司 | Cellulase variants |
DE19709284A1 (en) | 1997-03-07 | 1998-09-10 | Henkel Kgaa | Bleach activator combination e.g for use in dishwashing machines |
DE19712033A1 (en) | 1997-03-21 | 1998-09-24 | Basf Ag | Use of enamine derivatives as ultraviolet-A filters |
DE19732751A1 (en) | 1997-07-30 | 1999-02-04 | Henkel Kgaa | New Bacillus beta glucanase |
DE19918267A1 (en) | 1999-04-22 | 2000-10-26 | Henkel Kgaa | Surfactant-containing material, e.g., a washing-up liquid, which includes microcapsules in which incompatible or sensitive components are enclosed |
DE19956382A1 (en) | 1999-11-24 | 2001-05-31 | Henkel Kgaa | Microencapsulated enzymes retaining their activity in detergents are obtained by dispersing an aqueous enzyme solution in a starch solution and/or emulsion |
DE10019881A1 (en) | 2000-04-20 | 2001-11-15 | Gerhard Miksch | Process for overexpression and extracellular production of bacterial phytases in Escherichia coli |
KR20030037267A (en) | 2000-07-28 | 2003-05-12 | 헨켈 코만디트게젤샤프트 아우프 악티엔 | Novel amylolytic enzyme extracted from bacillus sp. a 7-7 (dsm 12368) and washing and cleaning agents containing this novel amylolytic enzyme |
PL361363A1 (en) * | 2000-11-28 | 2004-10-04 | Henkel Kommanditgesellschaft Auf Aktien | Novel cyclodextrin glucanotransferase (cgtase), obtained from bacillus agaradherens (dsm 9948) and detergents and cleaning agents containing said novel cyclodextrin glucanotransferase |
DE10121463A1 (en) | 2001-05-02 | 2003-02-27 | Henkel Kgaa | New alkaline protease variants and washing and cleaning agents containing these new alkaline protease variants |
DE10131441A1 (en) | 2001-06-29 | 2003-01-30 | Henkel Kgaa | A new group of alpha amylases and a method for identifying and obtaining new alpha amylases |
DE10138753B4 (en) * | 2001-08-07 | 2017-07-20 | Henkel Ag & Co. Kgaa | Detergents and cleaners with hybrid alpha-amylases |
DE10153792A1 (en) | 2001-10-31 | 2003-05-22 | Henkel Kgaa | New alkaline protease variants and washing and cleaning agents containing these new alkaline protease variants |
US7795388B2 (en) * | 2001-11-08 | 2010-09-14 | The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration (Nasa) | Versatile platform for nanotechnology based on circular permutations of chaperonin protein |
DE10162727A1 (en) | 2001-12-20 | 2003-07-10 | Henkel Kgaa | New alkaline protease from Bacillus gibsonii (DSM 14391) and washing and cleaning agents containing this new alkaline protease |
DE10162728A1 (en) * | 2001-12-20 | 2003-07-10 | Henkel Kgaa | New alkaline protease from Bacillus gibsonii (DSM 14393) and washing and cleaning agents containing this new alkaline protease |
DE10163748A1 (en) * | 2001-12-21 | 2003-07-17 | Henkel Kgaa | New glycosyl hydrolases |
DE10163884A1 (en) * | 2001-12-22 | 2003-07-10 | Henkel Kgaa | New alkaline protease from Bacillus sp. (DSM 14392) and detergents and cleaning agents containing this new alkaline protease |
DE10163883A1 (en) | 2001-12-22 | 2003-07-10 | Henkel Kgaa | New alkaline protease from Bacillus sp. (DSM 14390) and detergents and cleaning agents containing this new alkaline protease |
-
2007
- 2007-10-16 DE DE102007049830A patent/DE102007049830A1/en not_active Ceased
-
2008
- 2008-09-26 JP JP2010529331A patent/JP2011500042A/en active Pending
- 2008-09-26 CN CN200880111476A patent/CN101821285A/en active Pending
- 2008-09-26 WO PCT/EP2008/062937 patent/WO2009050022A1/en active Application Filing
- 2008-09-26 EP EP08804812A patent/EP2197904A1/en not_active Withdrawn
-
2010
- 2010-04-15 US US12/760,581 patent/US20100196991A1/en not_active Abandoned
Non-Patent Citations (1)
Title |
---|
See references of WO2009050022A1 * |
Also Published As
Publication number | Publication date |
---|---|
DE102007049830A1 (en) | 2009-04-23 |
WO2009050022A1 (en) | 2009-04-23 |
CN101821285A (en) | 2010-09-01 |
US20100196991A1 (en) | 2010-08-05 |
JP2011500042A (en) | 2011-01-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1737952B1 (en) | Novel alkaline proteases, and detergents and cleaners containing the same | |
EP1385943B1 (en) | Novel alkaline protease variants and detergents and cleaning agents containing said novel alkaline protease variants | |
EP1456366B1 (en) | Novel alkali protease formed by bacillus gibsonii (dsm 14393) and washing and cleaning agents containing said novel alkali protease | |
DE102007003143A1 (en) | New alkaline protease from Bacillus gibsonii and detergents and cleaners containing this novel alkaline protease | |
WO2007131656A1 (en) | Subtilisin from bacillus pumilus and washing and cleaning agents containing said novel subtilisin | |
WO2007131657A2 (en) | Novel alkaline protease from bacillus gibsonii and washing and cleaning agents containing said novel alkaline protease | |
WO2004058961A1 (en) | Subtilisin variants, with improved perhydrolase activity | |
EP1456367A1 (en) | Novel alkaline protease from bacillus gibsonii (dsm 14391) and washing and cleaning agents containing said novel alkaline protease | |
WO2007128542A2 (en) | Amadoriases in washing and cleaning products | |
WO2005118793A2 (en) | Alkaline protease variants having improved performance and washing and cleaning agents containing said alkaline protease variants having improved performance | |
DE102007036756A1 (en) | New proteases and detergents and cleaners containing these new proteases | |
DE102005037659A1 (en) | Use of esterases for splitting plastics | |
EP2197904A1 (en) | Novel protein variants by circular permutation | |
DE102007044415A1 (en) | Performance-enhanced proteases and detergents and cleaners containing these proteases | |
WO2007045398A2 (en) | Novel choline oxidases with modified substrate specificity | |
DE102015215591A1 (en) | Low-water, two-phase liquid detergent with acidic pH | |
WO2020002187A1 (en) | Laccase-containing detergent having improved cleaning power | |
WO2009053157A1 (en) | Subtilisin made from bacillus pumilus and washing agent and detergent containing said subtilisin | |
WO2024037686A1 (en) | Performance-enhanced protease variants x | |
WO2024037685A1 (en) | Performance-enhanced protease variants ix | |
WO2024125930A1 (en) | Detergents and cleaning agents containing protease | |
WO2024125929A1 (en) | Detergents and cleaning agents containing protease | |
DE102022205594A1 (en) | PERFORMANCE-IMPROVED AND STORAGE-STABLE PROTEASE VARIANTS | |
DE102022208891A1 (en) | PERFORMANCE IMPROVED PROTEASE VARIANTS | |
DE102022209245A1 (en) | DETERGENT AND CLEANING PRODUCT CONTAINING TANNASE I |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20100108 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MT NL NO PL PT RO SE SI SK TR |
|
AX | Request for extension of the european patent |
Extension state: AL BA MK RS |
|
DAX | Request for extension of the european patent (deleted) | ||
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20120403 |