EP1910528A2 - Rna-abhängige rna-polymerase, verfahren und kits zur amplifikation und / oder markierung von rna - Google Patents

Rna-abhängige rna-polymerase, verfahren und kits zur amplifikation und / oder markierung von rna

Info

Publication number
EP1910528A2
EP1910528A2 EP06761834A EP06761834A EP1910528A2 EP 1910528 A2 EP1910528 A2 EP 1910528A2 EP 06761834 A EP06761834 A EP 06761834A EP 06761834 A EP06761834 A EP 06761834A EP 1910528 A2 EP1910528 A2 EP 1910528A2
Authority
EP
European Patent Office
Prior art keywords
rna
dependent
primer
polymerase
amplification
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP06761834A
Other languages
English (en)
French (fr)
Inventor
Jacques Rohayem
Wolfram Rudolph
Katrin JÄGER
Enno Jacobs
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
RiboxX GmbH
Original Assignee
Technische Universitaet Dresden
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Technische Universitaet Dresden filed Critical Technische Universitaet Dresden
Priority to EP09155974A priority Critical patent/EP2077322B1/de
Priority to EP09155984A priority patent/EP2098592A3/de
Priority to EP10158113A priority patent/EP2204445B1/de
Publication of EP1910528A2 publication Critical patent/EP1910528A2/de
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6844Nucleic acid amplification reactions
    • C12Q1/686Polymerase chain reaction [PCR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • C12N9/127RNA-directed RNA polymerase (2.7.7.48), i.e. RNA replicase

Definitions

  • RNA-dependent RNA polymerase methods and kits for amplification and / or labeling of RNA
  • the invention relates to an RNA-dependent RNA polymerase and to methods and kits for labeling and / or for the primer-dependent and -independent amplification of ribonucleic acid (RNA), in particular of viral, eukaryotic and prokaryotic and double-stranded ribonucleic acid (RNA) for use in biotechnology and the medicine.
  • RNA ribonucleic acid
  • the amplification method according to the invention is particularly suitable for microarray technology, for the production of siRNA and for the diagnosis of viral infections by the detection of viral RNA in patient material.
  • the labeling method according to the invention is particularly suitable for the purification of RNA by affinity binding, as well as for the labeling of RNA for use in molecular biological methods that are used in the characterization of the function and / or structure of viral, eukaryotic and prokaryotic and double-stranded ribonucleic acid (RNA). be used.
  • RNA ribonucleic acid
  • RNA is an important component of the eukaryotic and prokaryotic cells. It is involved in several vital functions: transcription, i. the description of the information of the genetic material (deoxyribonucleic acid, DNA), the transmission of this information from the nucleus to the cytoplasm (mRNA), and the translation, i. the translation of the rewritten information into amino acids or proteins.
  • the RNA also forms the so-called transfer RNA, an important building block for translation.
  • RNA is also an important component of ribosomes. These are structural units of the cytoplasm, at which the translation of the information into protein takes place.
  • RNA Ribonucleic acid
  • miRNA miRNA
  • siRNA small interfering RNA
  • siRNA in vitro has hitherto been carried out by chemical synthesis or by means of DNA-dependent RNA polymerases such as T7 RNA polymerase.
  • DNA-dependent RNA polymerases such as T7 RNA polymerase.
  • two complementary DNA strands are synthesized by PCR using a primer which also contains the sequence for a T7 promoter.
  • the resulting complementary RNA strands are hybridized and digested by RNAse I.
  • RNA amplification plays an important role in the detection of viral infections in patient material.
  • RNA viruses ie viral pathogens with an RNA-derived genetic material.
  • Important pathogens from this group of viruses include the human immunodeficiency virus (HIV), the hepatitis C virus (HCV), the hepatitis A virus, the flu virus (influenza A, B and C) but also the Avian influenza virus, the recently re-identified SARS virus, the polio virus (poliovirus), the measles virus Virus, the mumps virus, the rubella virus and the diarrhea viruses (rotavirus, sapovirus and norovirus).
  • HCV human immunodeficiency virus
  • HCV hepatitis C virus
  • HCV hepatitis A virus
  • flu virus influenza A, B and C
  • Avian influenza virus the recently re-identified SARS virus
  • polio virus poliovirus
  • measles virus Virus the measles virus Virus
  • RNA in patient material is currently taking place in four steps. After recovering the RNA from the specimen, follow the steps:
  • RNA-dependent DNA polymerases the so-called reverse transcriptases. This requires the use of a primer. Primers are oligonucleotides specific for the sequence to be amplified. Primer and the RNA-dependent DNA polymerase allow the targeted amplification of the genome, but in DNA form.
  • RNA-dependent RNA polymerases e.g. the T7 polymerase.
  • RNA-dependent RNA polymerases e.g. the bacteriophage Q ⁇ RNA polymerase (also called Q ⁇ replicase), poliovirus or hepatitis C virus RNA polymerase.
  • the genome of bacteriophage Q ⁇ consists of a single-stranded (+) RNA that is replicated by the RNA-dependent RNA polymerase.
  • the Q ⁇ replicase produces a (-) strand RNA copy of the (+) strand, which as well as (+) strands can function as a template. In this way an exponential duplication can be achieved.
  • the Q ⁇ system is already used to detect analytes such as nucleic acids (Chu et al (1986), Nucleic Acids Research 14, 5591-5603, Lizardi et al (1988), Biotechnology 6, 1197-1202).
  • RNA-dependent RNA polymerases require specific RNA sequences for the initiation of RNA replication. In addition, they are also dependent on certain auxiliary proteins for the amplification of RNA. Therefore, these RNA-dependent RNA polymerases are unable to amplify heterologous RNA.
  • RNA at the 3'-terminus is possible in the prior art only with ATP by the use of E. coli po) y (A) -transferase.
  • Methods for labeling RNA with CTP, UTP and GTP are not known. It is therefore an object of the invention to provide an RNA-dependent RNA polymerase and methods and kits for labeling and / or amplifying viral, eukaryotic and prokaryotic single and double-stranded ribonucleic acid (RNA) that are more efficient and faster.
  • RNA-dependent RNA polymerase for the amplification and / or labeling of RNA
  • the RNA-dependent RNA polymerase belongs to the viruses of the family Caliciviridae and has a "right hand conformation" and the amino acid sequence of the RNA-dependent RNA polymerase comprises the following sequence sections:
  • a so-called "right-hand conformation” is understood to mean that the tertiary structure (conformation) of the protein has a folding according to a right hand with finger (finger), palm (palm) and thumb (thumb).
  • the sequence section "XXDYS" is the so-called A motif, the A motif is for the
  • GXPSG is the so-called B motif, the B motif is in all
  • sequence section "YGDD" is the so-called C motif, the C motif represents the active one
  • the sequence section "XXYGL” is the so-called D motif, the D motif is a
  • the sequence section "XXXXFLXRXX" is the so-called E-motif
  • the E-motif is a feature of RNA-dependent RNA polymerases and does not occur in DNA-dependent RNA polymerases.
  • RNA-dependent RNA polymerase has the following functions:
  • Terminal transferase activity with a preference for UTP and CTP, resulting in "labeling" of the 3 'end of a single-stranded RNA template.
  • the primer-dependent amplification of the RNA takes place only in the presence of a sequence-specific primer.
  • the amplification is sequence-dependent and occurs by incorporation of AMP, GMP, CMP or UMP.
  • Primer-independent amplification of the RNA occurs in the absence of a sequence-specific primer.
  • the amplification is sequence-dependent and occurs by incorporation of AMP, GMP, CMP or UMP.
  • RNA strand Due to the terminal transferase activity, several nucleotides of the same kind are attached at the 3 ' end of an RNA strand (eg ATP or UTP or CTP or GTP), regardless of the sequence of the RNA strand.
  • RNA strand eg ATP or UTP or CTP or GTP
  • the RNA-dependent RNA polymerase according to the invention is able to use in vitro heterologous viral, eukaryotic and prokaryotic RNA as a template for the amplification reaction. Both positive-stranded and negative-stranded single-stranded and double-stranded RNA can be used as a template for amplification.
  • the RNA-dependent RNA polymerase according to the invention is an RNA-dependent RNA polymerase of a virus from the family Calicivi ⁇ dae.
  • the genome of Caliciviridae consists of a polyadenylated (+) - stranded RNA single strand.
  • the RNA-dependent RNA polymerase of the calicivirus in viral replication writes the genomic calicivirus RNA into a (-) - stranded antisense RNA (aRNA) to. This results in an RNA aRNA hybrid.
  • the (-) - stranded aRNA then serves as a template for the synthesis of new (+) - stranded genomic virus RNA.
  • the RNA-dependent RNA polymerase is an RNA-dependent RNA polymerase of a human and / or non-human pathogenic calicivirus. Most preferably, it is an RNA-dependent RNA polymerase of a norovirus, sapovirus, vesivirus or a lagovirus, e.g. the RNA-dependent RNA polymerase of the norovirus strain HuCV / NL / Dresden174 / 1997 / GE or the sapovirus strain pJG-SapO1 or the Vesivir ⁇ s strain FCV / Dresden / 2006 / GE.
  • the RNA-dependent RNA polymerase is a protein having an amino acid sequence according to SEQ ID NO 1, SEQ ID NO 2 or SEQ ID NO 3.
  • SEQ ID NO 1 is the amino acid sequence of a norovirus RdRP.
  • SEQ ID NO 2 is the amino acid sequence of a sapovirus RdRP.
  • SEQ ID NO 3 is the amino acid sequence of a vesivirus RdRP.
  • RNA-dependent RNA polymerases of norovirus, sapovirus and vesivirus are produced recombinantly by cloning the nucleic acid encoding the norovirus, sapovirus or vesivirus RdRP into a suitable expression vector, for example pET-28 (Novagen).
  • a suitable expression vector for example pET-28 (Novagen).
  • the expression vector with the gene sequence coding for the virus RdRP is introduced into a suitable host organism for expression.
  • the host organism is preferably selected from the prokaryotic, preferably Escherichia coli, or eukaryotic host organisms, preferably Sacharomyces cerevisae or insect cells (preferably Sf9 cells) which have been infected with recombinant baculoviruses, which are commonly used for protein expression.
  • This host organism contains at least one expression vector with a gene sequence coding for the virus RdRP.
  • the norovirus, sapovirus, or vesivirus calicivirus RdRP is fused at the N- or C-terminus to a protein sequence that facilitates purification of the RdRP fusion protein after expression in a host organism.
  • this sequence is a so-called histidine marker consisting of a sequence of at least 6 consecutive histidines (His or H).
  • Histidine marker allows in a known manner the purification of the protein by affinity chromatography on a nickel or cobalt column.
  • RNA-dependent RNA polymerase fused to a histidine marker are the proteins having an amino acid sequence according to SEQ ID NO 4, SEQ ID NO 5 or SEQ ID NO 6.
  • SEQ ID NO 4 is the amino acid sequence of a Norovirus RdRP with a histidine tag (His-tag).
  • SEQ ID NO 5 is the amino acid sequence of a sapovirus RdRP with a histidine tag (His-tag).
  • SEQ ID NO 6 is the amino acid sequence of a vesivirus RdRP with a histidine tag (His-tag).
  • the invention also relates to the use of an RNA-dependent RNA polymerase according to the invention for the amplification and / or labeling of RNA.
  • a component of the invention is also a method for the amplification of RNA by means of an RNA-dependent RNA polymerase according to the invention with the steps a. Attachment of the RNA-dependent RNA polymerase to the RNA template in the presence or absence of an oligonucleotide primer, for example an oligo-RNA primer or oligo-DNA primer, b. Rewriting the RNA template into antisense RNA by the RNA-dependent RNA polymerase, c. Separation of the RNA / antisense RNA duplex into individual RNA strands
  • RNA-dependent RNA polymerase a RNA-dependent RNA polymerase according to the invention
  • a suitable reaction buffer a suitable reaction buffer
  • NTPs a suitable reaction buffer
  • RNase inhibitor e. if necessary stop solution
  • the RNA template is preferably used in amounts of from 1 ⁇ g to 4 ⁇ g per 50 ⁇ l reaction mixture.
  • concentration of the ribonucleotides ATP 1 CTP, GTP and UTP (NTPs) used is preferably between 0.1 ⁇ mol / l and 1 ⁇ mol / l, particularly preferably 0.4 ⁇ mol / l.
  • NTP analogs can also be used in the RNA amplification method according to the invention, for example fluorescently labeled NTPs, biotin-labeled NTPs or radioactively labeled NTPs such as [P 32 ] -labeled NTPs.
  • concentration of the RdRP according to the invention is preferably between 1 ⁇ mol / l and 3 ⁇ mol / l.
  • the kit contains a. 150 ⁇ mol / l recombinantly produced norovirus RdRP according to SEQ ID NO 1 or SEQ ID NO 4 and / or sapovirus RdRP according to SEQ ID NO 2 or SEQ ID NO 5 and / or Vesivirus RdRP according to SEQ ID NO 3 or SEQ ID NO 6 b. as buffer: 50 mmol / l HEPES, pH 8.0, 3 mmol / l magnesium acetate or manganese chloride (MnCl 2 ), 4 mM DTT c.
  • buffer 50 mmol / l HEPES, pH 8.0, 3 mmol / l magnesium acetate or manganese chloride (MnCl 2 ), 4 mM DTT c.
  • the process is preferably carried out at a pH between 6.5 and 8.5 and at a temperature between 20 0 C and 4O 0 C.
  • a preferred embodiment of the method for RNA amplification is carried out at 3O 0 C with norovirus RdRP or at 37 ° C with sapovirus RdRP under the following buffer conditions: 50 mmol / l HEPES, pH 8.0, 3 mmol / l magnesium acetate or manganese chloride, 4 mmol / l DTT.
  • the RNA / antisense RNA duplex is separated into individual RNA strands by heat denaturation, by chemical denaturation, and / or enzymatically, eg, by an enzyme capable of resolving double-stranded RNA into single-stranded RNA, such as: , a helicase.
  • an enzyme capable of resolving double-stranded RNA into single-stranded RNA such as: , a helicase.
  • the reaction can be kept isothermal.
  • a component of the invention is a corresponding kit for the amplification of RNA which, in addition to the kit according to the invention, comprises an enzyme with the ability to separate double-stranded RNA into single-stranded RNA, such as e.g. a helicase containing.
  • One embodiment of the invention is a method for primer-dependent amplification of RNA, wherein at least one primer which hybridizes with a section of the RNA template is used, and after the attachment of the RNA-dependent RNA polymerase according to the invention the primer by the RNA-dependent RNA Polymerase is extended according to the sequence of the RNA template.
  • an RNA primer or a DNA primer e.g. with a length of 20 to 25 bases, preferably used in a concentration of 0.1 to 1 ⁇ mol / l.
  • an RNA template e.g. viral, prokaryotic and eukaryotic RNA can be used.
  • polyadenylated RNA polyurydylated RNA, polyguanylated RNA or polycytidylylated RNA
  • the poly-U-RNA primer With the help of the poly-U-RNA primer, a specific amplification of the entire cellular mRNA is possible.
  • a poly-U primer of 20 to 24 bases in length is used for this purpose.
  • the amplified cellular mRNA can be examined, for example, by means of the so-called microarray method.
  • the method according to the invention for sequence-specific RNA amplification is also advantageously used for detecting viral RNA in patient material.
  • RNA primer that specifically hybridizes to a particular portion of viral RNA
  • CSF CSF
  • blood plasma or body fluids are used as patient material.
  • kits for carrying out the method for the primer-dependent amplification of RNA at least consisting of a. an RNA-dependent RNA polymerase according to the invention b. a suitable reaction buffer c. NTPs d. optionally RNase inhibitor e. if necessary stop solution f. primer
  • the kit contains
  • RNase inhibitor e. as stop solution: 4 mol / l ammonium acetate, 100 mmol / l EDTA f. 0.1 to 3 ⁇ M primer (homopolymeric or heteropolymeric RNA or DNA oligonucleotide of 15 to 20 bases in length)
  • Also part of the invention is a method for primer-independent amplification of RNA, wherein no primer that hybridizes to a portion of the RNA template is inserted and extended by the RNA-dependent RNA polymerase corresponding to the sequence of the RNA template, and a kit for the primer-independent amplification of RNA, at least consisting of
  • RNA-dependent RNA polymerase a. an RNA-dependent RNA polymerase according to the invention b. a suitable reaction buffer c. NTPs d. optionally RNase inhibitor e. if necessary stop solution.
  • the attachment of the RNA-dependent RNA polymerase to the RNA template is primer-independent.
  • the sequence of the sequence-independent RNA amplification of a single-stranded RNA template without the use of an RNA primer is shown schematically in FIG.
  • Another embodiment of the invention is a method for primer-independent amplification of poly (C) RNA, characterized in that no primer hybridizing to a portion of the RNA template is used, using GTP, preferably 50 ⁇ M, as the sole nucleotide is extended by the RNA-dependent RNA polymerase according to the sequence of the RNA template.
  • RNA primer-independent amplification of the RNA The possible applications of the method according to the invention for the amplification of RNA are manifold.
  • the direct detection of viral genome in patient material is possible.
  • the entire cellular RNA is obtained and amplified using an RNA primer, any RNA sequence specifically.
  • the detection of the viral nucleic acid is then carried out by hybridization to specific probes.
  • Another application concerns the nonspecific (RNA primer-independent) amplification of the RNA, which can make it possible to identify previously unidentified viruses or new viral variants.
  • Another application concerns microarray technology. This has the differential detection of cellular expression as the goal. This is done by detecting the so-called cellular transcripts, i. the mRNA.
  • the invention makes it possible to specifically amplify the mRNA by the use of a poly (U) -oligonucleotide in order subsequently to detect microarrays by hybridization.
  • siRNA in vitro Another field of application of the invention is the production of siRNA in vitro. This is done so far with the help of T7 polymerase. It will be for that
  • the invention enables the direct, efficient and simple preparation in 1.5 hours and starting from an RNA sequence double-stranded RNA, without the need for a PCR step, in vitro transcription and hybridization of the RNA (which may possibly be sub-optimal).
  • a component of the invention is also a method for labeling RNA by means of an RNA-dependent RNA polymerase according to the invention with the steps a. Attachment of the RNA-dependent RNA polymerase to the RNA to be labeled, b. Attaching at least one nucleotide to the 3 'end of the RNA to be labeled.
  • RNA at least consisting of
  • RNA-dependent RNA polymerase a. an RNA-dependent RNA polymerase according to the invention b. a suitable reaction buffer c. CTP or UTP or ATP or GTP d. optionally RNase inhibitor e. if necessary stop solution.
  • the kit contains
  • FIG. 1 Schematic sequence of the sequence-dependent RNA amplification
  • FIG. 2 Schematic representation of the sequence-independent RNA amplification
  • FIG. 3 Schematic procedure for labeling the 3 'end of the RNA template
  • Figure 4 Schematic sequence of the sequence-independent RNA synthesis starting from a poly (C) RNA in the presence of 50 ⁇ W! GTP
  • FIG. 5 Expression and purification of Norovirus 3D pD1 in E. coli.
  • FIG. 6 RNA synthesis with Norovirus 3D po1 .
  • RNA synthesis was carried out in the presence of a synthetic subgenomic RNA (sG-RNA) as a template and in the presence of wild-type norovirus 3D po1 or a norovirus 3D po 'with a mutation in the active site (YGD 343G D 344 G) as indicated.
  • the reaction products were analyzed on a non-denaturing agarose gel and visualized by autoradiography. 17, synthetic subgenomic RNA prepared by in vitro transcription at 17.
  • sG-RNA synthetic subgenomic RNA
  • reaction products were visualized on nondenaturing (0.5 M, left) and denaturing (1.25 M, right) formaldehyde agarose gels.
  • T7 synthetic subgenomic RNA produced by in vitro transcription with T7.
  • M RNA molecular weight marker.
  • FIG. 7 Northern blot analysis of the Norovirus 3D po1 synthesis products.
  • RNA synthesis was carried out in the presence of a synthetic subgenomic RNA (sG-RNA) as a template and in the presence of wild-type norovirus 3D po1 or a norovirus 3D po1 with a mutation in the active site (YGD 343 QD 344G ). performed as specified.
  • the reaction products were analyzed on a non-denaturing agarose gel and visualized after ethidium bromide staining by UV transillumination.
  • T7 synthetic subgenomic RNA produced by in vitro transcription with T7.
  • M RNA molecular weight marker. The remaining band visible in the reaction with m3D po1 instead of wild-type 3D po1 is derived from the template used in the reaction.
  • T7 synthetic subgenomic RNA produced by in vitro transcription with T7.
  • sG-RNA synthetic subgenomic RNA used as template.
  • 3D po1 wild-type norovirus 3D po1 .
  • RNA synthesis was 2 h at 30 0 C in the presence of 3 uM norovirus 3D PDL subgenomic RNA and increasing concentrations (0.5 to 3 mM) as template (0.024 uM) of MgAGO, MnCl 2 or FeSC ⁇ . Incorporation of [ ⁇ - 32 P] UMP as indicated. For each concentration, the mean and standard deviation of three independent experiments are shown.
  • FIG. 9 Primer-dependent initiation of RNA synthesis at higher temperature.
  • RNA synthesis was performed in the presence (black bars) or in the absence (gray bars) of a complementary RNA oligonucleotide primer. Incorporation of [ ⁇ - 32 P] CMP, [ ⁇ - 32 P] AMP, [ ⁇ - 32 P] GMP, or [ ⁇ - 32 P] UMP was measured after TCA precipitation and collection of G / C glass fiber filters. The installation values are given.
  • FIG. 10 Terminal transferase activity of Norovirus 3D po1
  • synthetic subgenomic polyadenylated RNA was used as template.
  • the reaction products were analyzed on formaldehyde agarose gels and visualized by autoradiography.
  • RNA oligonucleotide primer concentration mM
  • M marker (in vitro transcribed subgenomic polyadenylated RNA).
  • FIG. 12 De novo initiation of RNA synthesis on norovirus anti-subgenomic RNA.
  • RNA reaction products were analyzed on native agarose gels and visualized after ethidium bromide staining by UV transillumination.
  • Lanes 1 to 3 RNA synthesis in the presence of wild-type 3D po1 , mutant 3D po1 or in the absence of 3D po1 .
  • Lanes 4 to 6 RNA synthesis in the presence of wild-type 3D po1 and an RNA oligonucleotide complementary to the 3 ' terminus, mutated 3D po1 and an RNA oligonucleotide complementary to the 3 ' terminus or with an RNA oligonucleotide complementary to the 3 ' ' Term, but without norovirus 3D po1 .
  • T template RNA.
  • R replication product.
  • M RNA molecular weight marker (Kb).
  • B Strand separation analysis of replication products. The reaction products were analyzed on formaldehyde agarose gels and visualized after ethidium bromide staining by UV transillumination. Lanes 1 and 2, template (anti-subgenomic RNA) and norovirus 3D pDl replication product .
  • M RNA molecular weight marker (Kb).
  • FIG. 13 Primer-independent de novo initiation of RNA synthesis on homopoietmer
  • RNA synthesis was performed in the presence (black bars) or in the absence (gray bars) of cold CTP 1 ATP, GTP, and UTP for poly (rG), poly (rU), poly (rC), and poly (rA), respectively. Templates performed. The incorporation of [ ⁇ - 32 P] CMP, [OC- 32 P] AMP, [ ⁇ - 32 P] GMP, or [ ⁇ - 32 P] UMP was measured after TCA precipitation and collection of G / C glass fiber filters. The installation values are given.
  • FIG. 14 Ampiification of viral and eukaryotic RNA with the norovirus RNA
  • reaction 7 Subgenomic astrovirus RNA (serotype 1); Reaction 8; Subgenomic astrovirus RNA (serotype 2); Reaction 9, eukaryotic RNA of the elF4 gene of Xenopus Laevf, reaction 10, sub-genomic norovirus DNA; Reaction 11; T7 transcribed RNA of the elF4 gene of Xenopus Laevi; Reaction 12, negative control.
  • FIG. 15 Expression and purification of sapovirus 3D po1 in E. coli.
  • FIG. 16 Concentration dependence, substrate dependency, temperature dependence and metal ion dependency of the sapovirus 3D p0 'activity. In all reactions, subgenomic RNA was used as a template.
  • RNA synthesis was carried out in the presence of 3 uM sapovirus 3D po 'with subgenomic RNA as a template (0.024 uM), and increasing concentrations (0.5 to 5 mM) of MgAcO or MnCl 2 at 37 0 C for 2 h. Incorporation of [ ⁇ - 32 P] UMP as indicated.
  • FIG. 17 RNA synthesis with sapovirus 3D po1 .
  • RNA synthesis in the presence of a synthetic subgenomic polyadenylated RNA (sG-poly (A) RNA) as a template was performed with and without the addition of a 3 ⁇ M oligo (U) 2 o RNA primer and in the presence of wild-type sapovirus 3D po1 (3D po1 ) or, as indicated, a 3D po1 mutated in the acitve site (m3D po1 , YGD 343 G J D 344G ).
  • the reaction products were analyzed on non-denaturing agarose gels and visualized after ethidium bromide staining with UV transillumination.
  • the reaction product was obtained as indicated by RNA synthesis with sapovirus 3D po1 (3D po1 ) using a subgenomic polyadenylated RNA (sG-Poiy (A) RNA) as template.
  • the reaction products were visualized on denaturing formaldehyde agarose gels.
  • T7 synthetic subgenomic RNA produced by in vitro transcription with T7.
  • M RNA molecular weight markers.
  • Figure 18 De novo initiation of RNA synthesis on sapovirus anti-subgenomic RNA.
  • RNA synthesis was performed in the presence of a synthetic anti-subgenomic RNA (anti-sG RNA) as a template and wild-type sapovirus 3D POI ⁇ 30 POi) or ejner in the ⁇ actjve sjte mutant 3D poi (Pn 30 POi 1
  • Figure 19 Terminal transferase activity of sapovirus 3D po1 .
  • the terminal transferase activity was investigated by a reaction of 3 ⁇ M sapovirus 3D po1 or an active site mutated 3D po1 (m3D po1 ), which was used in the presence of subgenomic RNA (sG-RNA) as a template (0.024 ⁇ M) and [ ⁇ - 32 P] ATP, [OC- 32 P] GTP, [(X- 32 P] CTP or [ ⁇ - 32 P] UTP for 2 h at 37 ° C (0.024 ⁇ M) as was incubated.
  • the reaction products were analyzed on non-denaturing agarose gels and visualized by autoradiography. 17, synthetic subgenomic RNA produced by in vitro transcription with T7.
  • Figure 20 De novo initiation of RNA synthesis by Sapo virus 3D po> on homopolymer templates.
  • RNA synthesis was performed using poly (G) RNA, poly (U) RNA, poly (C) RNA, and poly (A) RNA templates with [ ⁇ - 32 P] CTP, [ ⁇ - 32 P ] ATP, [ ⁇ - 32 P] GTP, or [ ⁇ - 32 P] UTP and with or without 3 ⁇ M of an oligo (C) 2 o, oligo (A) 20l oligo (G) 20 or oligo (U) 20 RNA primers were incubated.
  • RNA synthesis was performed in the absence of an oligo (RNA) primer but in the presence of 50 ⁇ M cold CTP, ATP, GTP, and UTP, respectively, for poly (G) RNA, poly (U) RNA, poly (C ) RNA or poly (A) RNA
  • FIG. 21 Expression and purification of the vesivirus 3D po 'in E. coli.
  • FIG. 22 pol
  • RNA synthesis in the presence of a synthetic subgenomic polyadenylated RNA (sG-poly (A) RNA) as template was performed with and without the addition of a 3 ⁇ M oligo (U) 20 RNA primer and in the presence of wild-type vesivirus 3D po1 (3D po1 ) examined.
  • the reaction products were analyzed on non-denaturing agarose gels and visualized by autoradiography.
  • T7 synthetic subgenomic RNA produced by in vitro transcription with T7.
  • M RNA molecular weight markers.
  • the norovirus RdRP cDNA was obtained by PCR from the norovirus clone pUS-NorII (Genbank accession number: AY741811). It was cloned into the pET-28b (+) vector (Novagen), the expression vector was sequenced and transformed into E. coli CL21 (DE3) pLysS. The cells were at 37 0 C in Luria-Bertani medium with kanamycin (50 mg / L). At an optical density of 0.6 (OD600), protein expression was induced by the addition of isopropyl- ⁇ -D-thiogalactopyranoside (IPTG) at a final concentration of 1 mM. The cultures were then incubated at 25 0 C overnight.
  • IPTG isopropyl- ⁇ -D-thiogalactopyranoside
  • the cell pellets obtained from 250 ml of culture were washed once in 4 ml of phosphate buffered saline (PBS) and 1% Triton X 100 (Sigma).
  • the cells were treated at 37 0 C for 15 minutes with DNase (10 U / ml), sonicated on ice, and resuspended in 40 ml binding buffer (20 mM Tris / HCl, pH 7.9, 500 mM NaCl, 5 mM imidazole). After centrifugation at 4300 rpm at 4 0 C for 40 minutes was obtained, the clarified lysate.
  • His6-tagged norovirus RdRP was bound to a Ni-nitrilotriacetacetic acid (NTA) -sepharose matrix (Novagen) preequilibrated with the binding buffer.
  • NTA Ni-nitrilotriacetacetic acid
  • the bound protein was washed with the binding buffer containing 60 mM imidazole and eluted with binding buffer containing 1 M imidazole.
  • the eluted protein was dialyzed against buffer A (25 mM Tris-hCI, pH 8.0, 1 mM ⁇ -mercaptoethanol, 100 mM NaCl, 5 mM MgCl 2, 10% glycerol, 0.1% Triton X).
  • the protein concentration was determined with the BCA protein assay kit (Pierce) based on the biuret reaction.
  • the enzyme was resuspended in a final volume of 50% glycerol and stored at -20 0 C.
  • the reaction mixture (50 ⁇ l) consists of 0.5 to 1 ⁇ g RNA template, 10 ⁇ l of the reaction buffer (250 mM HEPES, pH 8.0, 15 mM magnesium acetate, 20 mM DTT), 50 U RNase inhibitor (RNAsin, Promega), 0.4 each mM of ATP, CTP, GTP, UTP, 3 ⁇ M of norovirus RdRP prepared according to Example 1.
  • the reaction is carried out at 30 ° C. for 2 hours.
  • the reaction is stopped by the addition of 50 ⁇ l of stop solution (4 M ammonium acetate, 100 mM EDTA). Purification is by phenol-chloroform extraction or by MEGAclear kit (Ambion) according to the manufacturer's instructions.
  • the transcription products are visualized after ethidium bromide staining by UV transillumination on TBE-buffered agarose gels. Formamide agarose gels can also be used.
  • the reaction mixture (50 ⁇ l) consists of 0.5 to 1 ⁇ g RNA template, 10 ⁇ l of the reaction buffer (250 mM HEPES, pH 8.0, 15 mM magnesium acetate, 20 mM DTT), 50 U RNase inhibitor (RNAsin, Promega), 0.4 each mM of ATP, CTP, GTP, UTP, 0.1 to 1 ⁇ M gene-specific RNA primer, 3 ⁇ M of norovirus RdRP prepared according to Example 1.
  • the reaction is carried out at 30 ° C. for 2 hours.
  • the reaction is stopped by the addition of 50 ⁇ l of the stop solution (4 M ammonium acetate, 100 mM EDTA).
  • the reaction mixture (50 ⁇ l) consists of 0.5 to 1 ⁇ g RNA template, 10 ⁇ l of the reaction buffer (250 mM HEPES, pH 8.0, 15 mM magnesium acetate, 20 mM DTT), 50 U RNase inhibitor (RNAsin, Promega), 0.4 each mM of ATP, CTP 1 GTP 1 UTP, 0.1 to 1 ⁇ M poly (U) 2 o primer, 3 ⁇ M of Norovirus RdRP prepared according to Example 1.
  • the reaction is carried out at 30 ° C. for 2 hours.
  • the reaction is stopped by the addition of 50 ⁇ l of stop solution (4 M ammonium acetate, 100 mM EDTA).
  • the reaction mixture (50 ⁇ l) consists of 0.5 to 1 ⁇ g RNA template, 10 ⁇ l of the reaction buffer (250 mM HEPES, pH 8.0, 15 mM magnesium acetate, 20 mM DTT), 50 U RNase inhibitor (RNAsin, Promega), 0.4 each mM of ATP, CTP, GTP 1 UTP 1 3 ⁇ M of Norovirus RdRP prepared according to Example 1.
  • the reaction is carried out at 30 ° C. for 2 hours.
  • the reaction is stopped by the addition of 50 ⁇ l of stop solution (4 M ammonium acetate, 100 mM EDTA). Purification is by phenol-chloroform extraction or by MEGAclear kit (Ambion) according to the manufacturer's instructions.
  • the transcription products are visualized after ethidium bromide staining by UV transillumination on TBE-buffered 10% polyacrylamide gels. Formamide agarose gels can also be used. Alternatively, armored RNA can be used
  • the reaction mixture (50 ⁇ l) consists of 0.5 to 1 ⁇ g RNA template, 10 ⁇ l of the reaction buffer (250 mM HEPES 1 pH 8.0, 15 mM magnesium acetate, 20 mM DTT), 50 U RNase inhibitor (RNAsin, Promega), 0.4 each mM of ATP 1 or CTP 1 or GTP 1 or UTP, 3 ⁇ M of the embodiment 1 Norovirus RdRP.
  • the reaction is carried out at 30 ° C for 2 hours.
  • the reaction is stopped by the addition of 50 ⁇ l of stop solution (4 M ammonium acetate, 100 mM EDTA). Purification is by phenol-chloroform extraction or by MEGAclear kit (Ambion) according to the manufacturer's instructions.
  • the transcription products are visualized after ethidium bromide staining by UV transillumination on TBE-buffered 10% polyacrylamide gels. Formamide agarose gels can also be used. Alternatively, armored RNA can be
  • the reaction mixture (50 ⁇ l) consists of 0.5 to 1 ⁇ g poly (C) RNA template, or an RNA with poly (C) RNA at the 3 'end, 10 ⁇ l of the reaction buffer (250 mM HEPES, pH 8.0, 15 mM magnesium acetate, 20 mM DTT), 50 U RNase inhibitor (RNAsin, Promega), 50 ⁇ M of GTP, and 3 ⁇ M of Norovirus RdRP prepared according to Example 1.
  • the reaction is carried out at 30 ° C. for 2 hours.
  • the reaction is stopped by the addition of 50 ⁇ l of stop solution (4 M ammonium acetate, 100 mM EDTA).
  • the cleaning is done by phenol-chloroform extraction or with the MEGAclear Kit (Ambion) according to the manufacturer's instructions.
  • the transcription products are visualized after ethidium bromide staining by UV transillumination on TBE-buffered 10% polyacrylamide gels.
  • Formamide agarose gels can also be used.
  • armored RNA can be used.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Saccharide Compounds (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)

Description

RNA-abhängige RNA-P olymerase, Verfahren und Kits zur Amplifikation und / oder Markierung von RNA
Die Erfindung betrifft eine RNA-abhängige RNA-Polymerase sowie Verfahren und Kits zur Markierung und / oder zur primerabhängigen und -unabhängigen Amplifikation von Ribonukleinsäure (RNA), insbesondere von viraler, eukaryontischer und prokaryontischer und doppelsträngiger Ribonukleinsäure (RNA) zur Anwendung in der Biotechnologie und der Medizin. Das erfindungsgemäße Amplifikationsverfahren eignet sich insbesondere für die Microarray-Technologie, zur Herstellung von siRNA und zur Diagnose viraler Infektionen durch den Nachweis viraler RNA in Patientenmaterial. Das erfindungsgemäße Markierungsverfahren eignet sich insbesondere für die Aufreinigung von RNA mittels Affinitäts-Bindung, sowie für die Markierung von RNA für die Anwendung in molekularbiologischen Verfahren, die bei der Charakterisierung der Funktion und/oder Struktur viraler, eukaryontischer und prokaryontischer und doppelsträngiger Ribonukleinsäure (RNA) verwendet werden.
Die RNA ist ein wichtiger Bestandteil der eukaryontischen und der prokaryontischen Zelle. Sie ist an mehreren vitalen Funktionen beteiligt: der Transkription, d.h. der Umschreibung der Information des Erbgutes (Desoxyribonukleinsäure, DNA), der Übertragung dieser Information vom Zellkern in das Zytoplasma (mRNA), und der Translation, d.h. die Übersetzung der umgeschriebenen Information in Aminosäuren bzw. Proteine. Die RNA bildet auch die sog. Transfer-RNA, einen wichtigen Baustein für die Translation. Die RNA ist auch ein wichtiger Bestandteil der Ribosomen. Dies sind strukturelle Einheiten des Zytoplasmas, an denen die Übersetzung der Information in Eiweiß stattfindet.
Die Bedeutung der RNA im Bereich der Biotechnologie hat in den letzten Jahrzehnten zugenommen. Neue Entwicklungen wie z.B. die Microarray-Technologie, die miRNA (micro-RNA) oder die siRNA- Technologie (small interfering RNA) haben stattgefunden, deren Relevanz im Bereich der Grundlagenforschung als auch der angewandten Forschung zunimmt. All diese Technologien beruhen auf der synthetischen Generierung von RNA durch Amplifikation in vitro.
Die Herstellung von siRNA in vitro erfolgt bislang über chemische Synthese oder mit Hilfe von DNA- abhängigen RNA-Polymerasen wie der T7-RNA-Polymerase. Dafür werden zwei komplementäre DNA-Stränge mittels PCR unter Einsatz eines Primers, der auch die Sequenz für einen T7-Promotor enthält, synthetisiert. Nach Umschreiben der DNA mit Hilfe der T7 RNA-Polymerase werden die resultierenden komplementären RNA-Stränge hybridisiert und mittels RNAse I verdaut.
Im medizinischen Bereich spielt die RNA-Amplifikation eine wichtige Rolle beim Nachweis viraler Infektionen im Patientenmaterial. Weltweit werden 80% aller viralen Infektionen durch RNA-Viren, d.h. virale Erreger mit einem aus RNA bestehenden Erbgut, verursacht. Wichtige Erreger aus dieser Gruppe von Viren sind u.a. das Humane Immundefizienz-Virus (HIV), das Hepatitis-C-Virus (HCV), das Hepatitis-A-Virus, das Grippe-Virus (Influenza A, B und C) aber auch das Vogelpest-Virus, das vor kurzem neu identifizierte SARS-Virus, das Virus der Kinderlähmung (Poliovirus), das Masern- Virus, das Mumps-Virus, das Röteln-Virus und die Brechdurchfall-Viren (Rotavirus, Sapovirus und Norovirus).
Der Nachweis von RNA im Patientenmaterial findet bis dato in vier Schritten statt. Nach der Gewinnung der RNA aus dem Untersuchungsmaterial folgen die Schritte:
1. Umschreibung der RNA in copy-DNA (cDNA) durch RNA-abhängige DNA-Polymerasen, die sog. reversen Transkriptasen. Dafür bedarf es auch des Einsatzes eines Primers. Primer sind Oligonukleotide, die spezifisch für die zu ampiifizierende Sequenz sind. Primer und die RNA- abhängige DNA-Polymerase ermöglichen die gezielte Amplifikation vom Erbgut, allerdings in DNA-Form.
2. Amplifikation der cDNA durch Polymerasekettenreaktion (PCR),
3. Aufreinigung des PCR-Produkts,
4. Sequenzierung des PCR-Produkts.
Für die Herstellung von RNA, beispielsweise zum Expressionsnachweis oder zur Herstellung von siRNA, erfolgt zusätzlich die Umschreibung des PCR-Produkts in RNA durch DNA-abhängige RNA- Polymerasen, wie z.B. die T7-Polymerase.
Die Durchführung dieser Schritte dauert in der Regel 18 bis 24 Stunden. Ebenfalls dazu benötigt wird auch ein gewisses „Know-How", was nicht allen Forschungseinrichtungen zugänglich ist.
Eine weitere Methode zur Amplifikation von RNA ist die Replikation durch RNA-abhängige RNA- Polymerasen wie z.B. die RNA-Polymerase des Bakteriophagen Qß (auch Qß - Replikase genannt), die RNA-Polymerase des Poliovirus oder des Hepatitis-C- Virus.
Das Genom des Bakteriophagen Qß besteht aus einer einzelsträngigen (+)-RNA, die durch die RNA- abhängige RNA-Polymerase repliziert wird. Die Qß - Replikase stellt eine (-)-Strang-RNA-Kopie des (+)-Stranges her, welche ebenso wie (+)-Stränge als Matrize fungieren kann. Auf diese Weise kann eine exponentielle Vervielfältigung erreicht werden. Das Qß -System wird bereits zum Nachweis von Analyten, wie etwa Nukleinsäuren, verwendet (Chu et al. (1986), Nucleic Acids Research 14, 5591 - 5603; Lizardi et al. (1988), Biotechnology 6, 1197 - 1202).
Diese RNA-abhängigen RNA-Polymerasen benötigen jedoch bestimmte RNA-Sequenzen zur Initiation der RNA-Replikation. Zudem sind sie für die Amplikation der RNA auch auf bestimmte Hilfsproteine angewiesen. Daher sind diese RNA-abhängigen RNA-Polymerasen nicht dazu in der Lage, heterologe RNA zu amplifizieren.
Die Markierung von RNA am 3'-Terminus ist nach dem Stand der Technik nur mit ATP durch die Verwendung von E.coii po)y(A)-Transferase möglich. Verfahren zur Markierung von RNA mit CTP, UTP und GTP sind nicht bekannt. Der Erfindung liegt daher die Aufgabe zugrunde, eine RNA-abhängige RNA-Polymerase sowie Verfahren und Kits zur Markierung und / oder zur Amplifikation von viraler, eukaryontischer und prokaryontischer einzel- und doppelsträngiger Ribonukleinsäure (RNA) bereitzustellen, die effizienter und schneller sind.
Erfindungsgemäß wird die Aufgabe gelöst durch eine RNA-abhängige RNA-Polymerase (im folgenden auch als RdRP oder 3Dpo1 bezeichnet) zur Amplifikation und / oder Markierung von RNA, wobei die RNA-abhängige RNA-Polymerase zu den Viren der Familie der Caliciviridae gehört und eine „Rechte- Hand-Konformation" aufweist und die Aminosäuresequenz der RNA-abhängigen RNA-Polymerase die folgenden Sequenzabschnitte umfasst:
a. XXDYS b. GXPSG c. YGDD d. XXYGL e. XXXXFLXRXX
mit der Bedeutung:
D: Aspartat
Y: Tyrosin
S: Serin
G: Glycin
P: Prolin
L: Leucin
F: Phenylalanin
R: Arginin
X: eine beliebige Aminosäure.
Unter einer sog. „Rechte-Hand-Konformation" ist dabei zu verstehen, dass die tertiäre Struktur (Konformation) des Proteins eine Faltung nach einer rechten Hand mit Finger (finger), Handfläche (palm) und Daumen (thumb), aufweist.
Bei dem Sequenzabschnitt „XXDYS" handelt es sich um das sog. A-Motiv. Das A-Motiv ist für die
Diskriminierng zwischen Ribonukleosiden und Deoxyribonukleosiden zuständig.
Bei dem Sequenzabschnitt „GXPSG" handelt es sich um das sog. B-Motiv. Das B-Motiv ist in allen
Vertretern der Familie Caliciviridae konserviert.
Bei dem Sequenzabschnitt „YGDD" handelt es sich um das sog. C-Motiv. Das C-Motiv stellt die aktive
Stelle des Enzyms dar. Dieses Motiv spielt bei der Koordinierung der Metallionen eine wichtige Rolle.
Bei dem Sequenzabschnitt „XXYGL" handelt es sich um das sog. D-Motiv. Das D- Motiv ist ein
Merkmal der Template-abhängigen Polymerasen. Bei dem Sequenzabschnitt „XXXXFLXRXX" handelt es sich um das sog. E-Motiv. Das E-Motiv ist ein Merkmal der RNA-abhängigen RNA Polymerasen, und kommt bei DNA-abhängigen RNA- Polymerasen nicht vor.
Die erfindungsgemäße RNA-abhängige RNA-Polymerase verfügt über die folgenden Funktionen:
Mg2+- oder Mn2+-abhängige RNA-abhängige RNA-Polymeraseaktivität, keine DNA- Abhängigkeit Template-Abhängigkeit primer-abhängige RNA-Synthese mit homopolymerer RNA (poly(A)-RNA, poly(C)-RNA, poly(G)-RNA bzw. poly(U)-RNA) als Matrize und bei Anwesenheit der entsprechenden Primer (d.h. oligo(U)-RNA, oligo(G)-RNA, oligo-(C)-RNA, bzw. oligo(A)-RNA) primer-unabhängige RNA-Synthese mit poly(C)-RNA als Matrize in Anwesenheit von erhöhten GTP-Konzentrationen
Primer-abhängige oder Primer-unabhängige RNA-Synthese mit heteropolymerer RNA als Matrize
Terminale Transferase-Aktivität mit einer Präferenz für UTP und CTP, was zum „Labelling" des 3'-Endes eines einzelsträngigen RNA-Templates führt.
Die Primer-abhängige Amplifikation der RNA erfolgt nur in der Anwesenheit eines Sequenzspezifischen Primers. Die Amplifikation ist Sequenz-abhängig und erfolgt durch Einbau von AMP, GMP, CMP oder UMP.
Die Primer-unabhängige Amplifikation der RNA erfolgt in der Abwesenheit eines Sequenzspezifischen Primers. Die Amplifikation ist Sequenz-abhängig und erfolgt durch Einbau von AMP, GMP, CMP oder UMP.
Durch die Terminale Transferase-Aktivität werden am 3'-Ende eines RNA-Stranges mehrere Nucleotide gleicher Art angehängt (z.B. ATP oder UTP oder CTP oder GTP), unabhängig von der Sequenz des RNA-Stranges.
Überraschenderweise ist die erfindungsgemäße RNA-abhängige RNA-Polymerase in der Lage, in vitro heterologe virale, eukaryontische und prokaryontische RNA als Template für die Amplifikationsreaktion zu nutzen. Sowohl positiv-strängige und negativ-strängige einzelsträngige als auch doppelsträngige RNA ist als Template zur Amplifikation einsetzbar.
Vorzugsweise ist die erfindungsgemäße RNA-abhängige RNA-Polymerase eine RNA-abhängige RNA-Poiymerase eines Virus aus der Familie der Caliciviήdae. Das Genom der Caliciviridae besteht aus einem polyadenylierten (+)-strängigen RNA-Einzelstrang. in vivo schreibt die RNA-abhängige RNA-Polymerase des Calicivirus bei der viralen Replikation die genomische Calicivirus-RNA in eine (-) - strängige antisense-RNA (aRNA) um. Dabei entsteht ein RNA-aRNA-Hybrid. Die (-)-strängige aRNA dient im Anschluß als Templat zur Synthese neuer (+)-strängiger genomischer Virus-RNA.
In weiteren bevorzugten Ausführungsformen der Erfindung ist die RNA-abhängige RNA-Polymerase eine RNA-abhängige RNA-Polymerase eines humanen und / oder nicht-human pathogenen Calicivirus. Besonders bevorzugt handelt es sich um eine RNA-abhängige RNA-Polymerase eines Norovirus, Sapovirus, Vesivirus oder eines Lagovirus, z.B. die RNA-abhängige RNA-Polymerase des Norovirus-Stammes HuCV/NL/Dresden174/1997/GE oder des Sapovirus-Stammes pJG-SapO1 oder des Vesivirυs-Stammes FCV/Dresden/2006/GE.
In besonders bevorzugten Ausführungsformen der Erfindung ist die RNA-abhängige RNA-Polymerase ein Protein mit einer Aminosäuresequenz gemäß SEQ ID NO 1, SEQ ID NO 2 oder SEQ ID NO 3.
SEQ ID NO 1 ist die Aminosäuresequenz einer Norovirus-RdRP. SEQ ID NO 2 ist die Aminosäuresequenz einer Sapovirus-RdRP. SEQ ID NO 3 ist die Aminosäuresequenz einer Vesivirus-RdRP.
SEQ ID NO 1:
MGGDSKGTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGK DPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTID PPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANL MFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAF GGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDST QQRAVLAAALEIMVKFSSΞPHLAQWAEDLLSPSWDVGDFKISINΞGLP SGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVST DIKLDPΞKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDP AGWFGKLEQSSILRQMYWTRGPNHΞDPSETMIPHSQRPIQLMSLLGEAAL HGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNL APSFVNEDGVEVDKLAAALE
SEQ ID NO 2:
MKDEFQWKGLPWKSGLDVGGMPTGTRYHRSPAWPEEQPGETHAPAPFGAGD
KRYTFSQTEMLVNGLKPYTEPTAGVPPQLLSRΆVTHVRSYIETIIGTHRS
PVLTYHQACELLERTTSCGPFVQGLKGDYWDEEQQQYTGVLANHLEQAWD
KANKGIAPRNAYKLALKDELRPIEKNKAGKRRLLWGCDAΆTTLIATAAFK
AVATRLQWTPMTPVAVGINMDSVQMQVMNDSLKGGVLYCLDYSKWDSTQ
NPAVTAASLAILERFAEPHPIVSCAIEALSSPAEGYVNDIKFVTRGGLPS
GMPFTSWNSINHMIYVAAΆILQAYESHNVPYTGNVFQVETVHTYGDDCM
YSVCPATASIFHAVLANLTSYGLKPTAΆDKSDAIKPTNTPVFLKRTFTQT PHGVRALLDITSITRQFYWLKANRTSDPSSPPAFDRQARSAQLENALAYA SQHGPWFDTVRQIAIKTAQGEGLVLVNTNYDQΆLATYNAWFIGGTVPDP VGHTEGTHKIVFEME SEQ ID NO 3:
MKVTTQKYDVTKPDISYKGLICKQLDEIRVIPKGTRLHVSPAHTDDYDEC SHQPASLGSGDPRCPKSLTAIWDSLKPYCEKTDGPPHDILHRVQRMLID HLSGFVPMNISSΞPSMLAAFHKLNHDTSCGPYLGGRKKDHMIGGEPDKPL LDLLSSKWKLATQGIGLPHEYTIGLKDELRPVEKVQEGKRRMIWGCDVGV ATVCAAAFKGVSDAITANHQYGPVQVGIKTMDGPSVEALYQRIRSAAKVFA VDYSKWDSTQSPRVSAASIDILRYFSDRSPIVDSAANTLKSPPIAIFNGV AVKVTSGLPSGMPLTSVINSLNHCLYVGCAILQSLESRNIPVTWNLFSTF DMMTYGDDGVYMFPMMFASVSDQIFANLTΆYGLKPTRVDKSVGAIEPIDP ESWFLKRTITRTPHGIRGLLDRGSIIRQFYYIKGENSDDWKTPPKTIDP TSRGQQLWNACLYASQHGPEFYNKVYRLΆEKAVEYΞΞLHFEPPSYHSALE HYNNQFNGVDTRSDQIDASVMTDLHCDVFEVLE
Die RNA-abhängigen RNA-Polymerasen des Norovirus, des Sapovirus und des Vesivivirus sind rekombinant herstellbar durch Kionierung der die Norovirus-, Sapovirus- bzw. Vesivirus-RdRP kodierenden Nukleinsäure in einen geeigneten Expressionsvektor, beispielsweise pET-28 (Novagen). Der Expressionsvektor mit der Gensequenz, die für die Virus-RdRP kodiert, wird zur Expression in einen geeigneten Wirtsorganismus eingebracht. Der Wirtsorganismus wird bevorzugt aus den üblicherweise für die Proteinexpression verwendeten prokaryontischen, bevorzugt Eschericha coli, oder eukaryontischen Wirtsorganismen, bevorzugt Sacharomyces cerevisae oder Insektenzellen (bevorzugt Sf9-Zellen), die mit rekombinanten Baculoviren infiziert worden sind, gewählt. Dieser Wirtsorganismus enthält mindestens einen Expressionsvektor mit einer Gensequenz, die für die Virus- RdRP kodiert.
In bevorzugten Ausführungsformen wird die Norovirus-, Sapovirus- oder Vesivirus- Calicivirus-RdRP am N- oder C-Terminus mit einer Proteinsequenz fusioniert, welche die Aufreinigung des RdRP- Fusionsproteins nach der Expression in einem Wirtsorganismus erleichtert. Bevorzugt ist diese Sequenz ein sogenannter Histidin-Marker, bestehend aus einer Sequenz von mindestens 6 aufeinanderfolgenden Histidinen (His oder H). Ein solcher Histidin-Marker ermöglicht in bekannter Weise die Aufreinigung des Proteins affinitätschromatographisch auf einer Nickel- oder Kobalt-Säule.
Beispiele für mit einem Histidin-Marker fusionierte Ausführungsformen der RNA-abhängigen RNA- Polymerase sind die Proteine mit einer Aminosäuresequenz gemäß SEQ ID NO 4, SEQ ID NO 5 oder SEQ ID NO 6.
SEQ ID NO 4 ist die Aminosäuresequenz einer Norovirus-RdRP mit einem Histidin-Marker (His-tag). SEQ ID NO 5 ist die Aminosäuresequenz einer Sapovirus-RdRP mit einem Histidin-Marker (His-tag). SEQ ID NO 6 ist die Aminosäuresequenz einer Vesivirus-RdRP mit einem Histidin-Marker (His-tag).
SEQ ID NO 4:
MGGDSKGTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGK DPRVKGGPSLQQVMRDQLKPFTΞPRGKPPKPSVLΞAAKKTIINVLEQTID PPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANL MFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAF GGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDST QQRAVLAAALEIMVKFSSEPHLAQWAEDLLSPSVVDVGDFKISINEGLP SGVPCTSQWNSIAHWLLTLCALSΞVTNLSPDIIQANSLFSFYGDDEIVST DIKLDPEKLTAKLKΞYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDP AGWFGKLEQSSILRQMYWTRGPNHEDPSΞTMIPHSQRPIQLMSLLGEAAL HGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNL APSFVNEDGVEVDKLAAALEHHHHHH
SEQ ID NO 5:
MKDEFQWKGLPWKSGLDVGGMPTGTRYHRSPAWPEEQPGETHAPAPFGAGD
KRYTFSQTEMLVNGLKPYTEPTAGVPPQLLSRAVTHVRSYIETIIGTHRS
PVLTYHQACELLΞRTTSCGPFVQGLKGDYWDEEQQQYTGVLANHLEQAWD
KANKGIAPRNAYKLALKDELRPIEKNKAGKRRLLWGCDAATTLIATAAFK
AVATRLQWTPMTPVAVGINMDSVQMQVMNDSLKGGVLYCLDYSKWDSTQ
NPAVTAASLAILERFAEPHPIVSCAIEALSSPAEGYVNDIKFVTRGGLPS
GMPFTSWNSINHMIYVAAAILQAYESHNVPYTGNVFQVETVHTYGDDCM
YSVCPATASIFHAVLANLTSYGLKPTAΆDKSDAIKPTNTPVFLKRTFTQT
PHGVRALLDITSITRQFYWLKANRTSDPSSPPAFDRQARSAQLENALAYA
SQHGPWFDTVRQIAIKTAQGEGLVLVNTNYDQALATYNAWFIGGTVPDP
VGHTEGTHKIVFEMΞHHHHHH
SEQ ID NO 6;
MKVTTQKYDVTKPDISYKGLICKQLDEIRVIPKGTRLHVSPAHTDDYDEC SHQPASLGSGDPRCPKSLTAIWDSLKPYCEKTDGPPHDILHRVQRMLID HLSGFVPMNISSEPSMLΆAFHKLNHDTS CGPYLGGRKKDHMIGGEPDKPL LDLLSSKWKLATQGIGLPHΞYTIGLKDELRPVE KVQEGKRRMIWGCDVGV ATVCAAAFKGVSDAITANHQYGPVQVGINMDGPSVEALYQRIRSAAKVFA VDYSKWDSTQSPRVSAASIDILRYFSDRSPIVDSAANTLKSPPIAIFNGV AVKVTSGLPSGMPLTSVINSLNHCLYVGCAILQSLESRNIPVTWNLFSTF DMMTYGDDGVYMFPMMFASVSDQIFANLTAYGLKPTRVDKSVGAIEPIDP ESWFLKRTITRTPHGIRGLLDRGSIIRQFYYIKGENSDDWKTPPKTIDP TSRGQQLWNACLYASQHGPEFYNKVYRLAEKAVEYEΞLHFΞPPSYHSALE HYNNQFNGVDTRSDQIDAS VMTDLHCDVFΞVLEHHHHHH
Bestandteil der Erfindung ist auch die Verwendung einer erfindungsgemäßen RNA-abhängigen RNA- Polymerase zur Amplifikation und / oder Markierung von RNA.
Bestandteil der Erfindung ist auch ein Verfahren zur Amplifikation von RNA mittels einer erfindungsgemäßen RNA-abhängigen RNA-Polymerase mit den Schritten a. Anlagerung der RNA-abhängigen RNA-Polymerase an die RNA-Matrize in der Anwesenheit oder Abwesenheit eines Oligonukleotid-Primers, z.B. eines Oligo-RNA-Primers oder Oligo- DNA-Primers, b. Umschreiben der RNA-Matrize in antisense-RNA durch die RNA-abhängige RNA-Polymerase, c. Trennung des RNA/antisense-RNA-Duplexes in einzelne RNA-Stränge
sowie ein Kit zur Durchführung des Verfahrens zur Amplifikation von RNA, mindestens bestehend aus a. einer erfindungsgemäßen RNA-abhängigen RNA-Polymerase b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-Inhibitor e. ggf. Stoplösung
Die RNA-Matrize wird beim erfindungsgemäßen Verfahren vorzugsweise in Mengen von 1 μg bis 4 μg pro 50 μl-Reaktionsansatz eingesetzt. Die Konzentration der eingesetzten Ribonukleotide ATP1 CTP, GTP und UTP (NTPs) beträgt vorzugsweise zwischen 0,1 μmol/l und 1 μmol/l, besonders bevorzugt 0,4 μmol/l. Auch NTP-Analoga sind beim erfindungsgemäßen Verfahren zur RNA- Amplifikation einsetzbar, beispielsweise fluoreszenzmarkierte NTPs, Biotin-markierte NTPs oder radioaktiv-markierte NTPs wie [P32]-markierte NTPs. Die Konzentration der erfindungsgemäßen RdRP beträgt bevorzugt zwischen 1 μmol/l und 3 μmol/l.
In einer besonders bevorzugten Ausführungsform enthält das Kit a. 150 μmol/l rekombinant hergestellter Norovirus-RdRP gemäß SEQ ID NO 1 oder SEQ ID NO 4 und/oder Sapovirus-RdRP gemäß SEQ ID NO 2 oder SEQ ID NO 5 und/oder Vesivirus-RdRP gemäß SEQ ID NO 3 oder SEQ ID NO 6 b. als Puffer : 50 mmol/l HEPES, pH 8.0, 3 mmol/l Magnesiumacetat oder Manganchlorid (MnCI2), 4 mM DTT c. 10 mmol/l ATP, 10 mmol/l CTP, 10 mmol/l GTP, 10 mmol/l UTP d. RNase-Inhibitor e. als Stoplösung: 4 mol/l Ammoniumacetat, 100 mmol/l EDTA
Das Verfahren wird vorzugsweise bei einem pH-Wert zwischen 6,5 und 8,5 und bei einer Temperatur zwischen 200C und 4O0C durchgeführt. Eine bevorzugte Ausführungsform des Verfahrens zur RNA- Amplifikation wird bei 3O0C mit Norovirus-RdRP oder bei 37°C mit Sapovirus-RdRP unter folgenden Pufferbedingungen durchgeführt: 50 mmol/l HEPES, pH 8.0, 3 mmol/l Magnesiumacetat oder Manganchlorid, 4 mmol/l DTT.
In einer Ausführungsform der Erfindung erfolgt die Trennung des RNA / antisense-RNA-Duplexes in einzelne RNA-Stränge durch Hitzedenaturierung, durch chemische Denaturierung und / oder enzymatisch, z.B. mit einem Enzym mit der Fähigkeit, doppelsträngige RNA in einzelsträngige RNA aufzutrennen wie z:B. eine Helikase. Durch die Strangtrennung liegt wieder einzelsträngiges Template vor und eine weitere Amplifikationsrunde kann eingeleitet werden.
Durch den Einsatz eines Enzyms mit der Fähigkeit, doppelsträngige RNA in einzelsträngige RNA aufzutrennen, kann die Reaktion isotherm gehalten werden.
Bestandteil der Erfindung ist ein entsprechendes Kit zur Amplifikation von RNA, das zusätzlich zum erfindungsgemäßen Kit ein Enzym mit der Fähigkeit, doppelsträngige RNA in einzelsträngige RNA aufzutrennen wie z.B. eine Helikase, enthält.
Eine Ausführungsform der Erfindung ist ein Verfahren zur primerabhängigen Amplifikation von RNA, wobei mindestens ein Primer, der mit einem Abschnitt der RNA-Matrize hybridisiert, eingesetzt wird und nach der Anlagerung der erfindungsgemäßen RNA-abhängigen RNA-Polymerase der Primer durch die RNA-abhängige RNA-Polymerase entsprechend der Sequenz der RNA-Matrize verlängert wird.
Als Primer wird bevorzugt ein RNA-Primer oder ein DNA-Primer, z.B. mit einer Länge von 20 bis 25 Basen, vorzugsweise in einer Konzentration von 0,1 bis 1 μmol/l eingesetzt. Als RNA-Matrize ist dabei z.B. virale, prokaryontische und eukaryontische RNA einsetzbar.
Der Ablauf der primerabhängigen RNA-Amplifikation einer einzelsträngigen RNA-Matrize unter Einsatz eines RNA-Primers ist in Figur 2 schematisch dargestellt.
Vorzugsweise wird bei polyadenylylierter RNA, polyurydylilierter RNA, polyguanylylierter RNA oder polycytidylylierter RNA als Primer ein poly-U-RNA, poly-A-RNA, poly-C-RNA oder poly-G-RNA-Primer eingesetzt. Mit Hilfe des poly-U-RNA-Primers ist eine spezifische Amplifikation der gesamten zellulären mRNA möglich. Vorzugsweise wird dafür ein Poly-U-Primer von 20 bis 24 Basen Länge eingesetzt. Die amplifizierte zelluläre mRNA kann Anschluss beispielsweise mit Hilfe der sog. Microarray-Verfahren untersucht werden.
Das erfindungsgemäße Verfahren zur sequenzspezifischen RNA-Amplifikation wird vorteilhaft auch zum Nachweis viraler RNA in Patientenmaterial verwendet.
Hierfür wird die gesamte zelluläre RNA aus dem Patientenmaterial gewonnen und unter Einsatz eines RNA-Primers, der spezifisch mit einem bestimmten Abschnitt viraler RNA hybridisiert, wird im Patientenmaterial vorhandene virale RNA amplifiziert.
Als Patientenmaterial wird beispielsweise Liquor, Blut, Plasma oder Körperflüssigkeiten eingesetzt. Auch geeignet ist das Verfahren zum Nachweis von RNA-Viren mit einem poly-A-Schwanz am 3'- Ende des Genoms, DNA-Viren und viralen mRNA-Transkripten.
Bestandteil der Erfindung ist ebenfalls ein Kit zur Durchführung des Verfahrens zur primerabhängigen Amplifikation von RNA, mindestens bestehend aus a. einer erfindungsgemäßen RNA-abhängigen RNA-Polymerase b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-Inhibitor e. ggf. Stoplösung f. Primer
In einer besonders bevorzugten Ausführungsform enthält das Kit
a. 150 rekombinant hergestellter μmol/l Norovirus-RdRP gemäß SEQ ID NO 1 oder SEQ ID NO 4 und/oder Sapovirus-RdRP gemäß SEQ ID NO 2 oder SEQ ID NO 5 und/oder Vesivirus-RdRP gemäß SEQ ID NO 3 oder SEQ ID NO 6 b. als Puffer : 50 mmol/l HEPES, pH 8.0, 3 mmol/l Magnesiumacetat oder Manganchlorid (MnCI2), 4 mM DTT c. 10 mmol/l ATP, 10 mmol/l CTP, 10 mmol/l GTP, 10 mmol/l UTP d. RNase-Inhibitor e. als Stoplösung: 4 mol/l Ammoniumacetat, 100 mmol/l EDTA f. 0,1 bis 3 μM Primer (homopolymeres oder heteropolymeres RNA- oder DNA-Oligonukleotid mit einer Länge von 15 bis 20 Basen)
Ebenfalls Teil der Erfindung ist ein Verfahren zur primerunabhängigen Amplifikation von RNA, wobei kein Primer, der mit einem Abschnitt der RNA-Matrize hybridisiert, eingesetzt und durch die RNA- abhängige RNA-Polymerase entsprechend der Sequenz der RNA-Matrize verlängert wird, sowie ein Kit zur primerunabhängigen Amplifikation von RNA, mindestens bestehend aus
a. einer erfindungsgemäßen RNA-abhängigen RNA-Polymerase b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-Inhibitor e. ggf. Stoplösung.
In dieser Ausgestaltung des erfindungsgemäßen Verfahrens erfolgt die Anlagerung der RNA- abhängigen RNA-Polymerase an die RNA-Matrize primerunabhängig. Der Ablauf der sequenzunabhängigen RNA-Amplifikation einer einzelsträngigen RNA-Matrize ohne Einsatz eines RNA-Primers ist in Figur 1 schematisch dargestellt. Eine weitere Ausführungsform der Erfindung ist ein Verfahren zur primerunabhängigen Ampiifikation von poly(C)-RNA, dadurch gekennzeichnet, dass kein Primer, der mit einem Abschnitt der RNA- Matrize hybridisiert, eingesetzt wird, dass GTP, vorzugsweise 50 μM, als einziger Nukleotid verwendet wird und durch die RNA-abhängige RNA-Polymerase entsprechend der Sequenz der RNA-Matrize verlängert wird.
Der Schematische Ablauf der sequenz-unabhängigen RNA-Synthese ausgehend von einer poly(C)- RNA in Anwesenheit von 50 μM GTP ist in Figur 4 dargestellt.
Die Anwendungsmöglichkeiten der erfindungsgemäßen Verfahren zur Amplifkation von RNA sind vielfältig. Zum einem ist der direkte Nachweis viralen Erbgutes in Patientenmaterial möglich. Hierfür wird die gesamte zelluläre RNA gewonnen und unter Einsatz eines RNA-Primers eine beliebige RNA- Sequenz spezifisch amplifiziert. Der Nachweis der viralen Nukleinsäure erfolgt dann durch Hybridisierung an spezifischen Sonden. Eine andere Anwendung betrifft die unspezifische (RNA- Primer-unabhängige) Ampiifikation der RNA, die ermöglichen kann, bisher nicht identifizierte Viren bzw. neue virale Varianten zu identifizieren.
Eine weitere Anwendung betrifft die Microarray-Technologie. Diese hat den differenziellen Nachweis der zellulären Expression zum Ziel. Dies geschieht durch den Nachweis der sog. zellulärer Transkripte, d.h. der mRNA. Die Erfindung ermöglicht ausgehend aus einem zellulären Gemisch, die mRNA spezifisch durch den Einsatz eines poly(U)-Oligonukleotid zu amplifizieren, um anschließend auf Microarrays durch Hybridisierung den Nachweis zu erbringen.
Ein anderes Anwendungsgebiet der Erfindung ist die Herstellung von siRNA in vitro. Dies erfolgt bis dato mit Hilfe der T7-Polymerase. Es wird dafür
1. zwei komplementäre DNA-doppelstränge mittels PCR unter dem Einsatz eines T7~Promotor- Primers synthetisiert,
2. nach Umschreibung der DNA mit Hilfe der T7-Polymerase, werden beide resultierende komplementäre RNA-Stränge hybridisiert,
3. dann werden mittels RNAse I beide Stränge verdaut.
Diese Schritte dauern nach dem Stand der Technik in der Regel 24 bis 48 Stunden, und benötigen ebenso das notwendige „Know-How". Die Erfindung ermöglicht demgegenüber in 1,5 Stunden und ausgehend von einer RNA-Sequenz die direkte, effiziente und einfache Herstellung doppelsträngiger RNA, ohne die Notwendigkeit eines PCR-Schrittes, der in vitro Transkription und der Hybridisierung der RNA (die eventuell sub-optimal verlaufen kann).
Bestandteil der Erfindung ist auch ein Verfahren zur Markierung von RNA mittels einer erfindungsgemäßen RNA-abhängigen RNA-Polymerase mit den Schritten a. Anlagerung der RNA-abhängigen RNA-Polymerase an die zu markierende RNA, b. Anhängen mindestens eines Nukleotids an das 3'-Ende der zu markierenden RNA.
sowie ein Kit zur Durchführung des erfindungsgemäßen Verfahrens zur Markierung von RNA, mindestens bestehend aus
a. einer erfindungsgemäßen RNA-abhängigen RNA-Polymerase b. einem geeigneten Reaktions-Puffer c. CTP oder UTP oder ATP oder GTP d. ggf. RNase-lnhibitor e. ggf. Stoplösung.
Der Ablauf des Labelling des 3'-Endes des RNA-Templates ist schematisch in Figur 3 dargestellt.
In einer besonders bevorzugten Ausführungsform enthält das Kit
g. 150 rekombinant hergestellter μmol/l Norovirus-RdRP gemäß SEQ ID NO 1 oder SEQ ID NQ 4 und/oder Sapovirus-RdRP gemäß SEQ ID NO 2 oder SEQ ID NO 5 und/oder Vesivirus-RdRP gemäß SEQ ID NO 3 oder SEQ ID NO 6 h. als Puffer : 50 mmol/l HEPES, pH 8.0, 3 mmol/l Magnesiumacetat oder Manganchlorid (MnCI2), 4 mM DTT i. 10 mmol/l ATP, und 10 mmol/l CTP, und 10 mmol/l GTP, und 10 mmol/l UTP j. RNase-lnhibitor k. als Stoplösung: 4 mol/i Ammoniumacetat, 100 mmol/l EDTA
Anhand der folgenden Figuren und Ausführungsbeispiele wird die Erfindung näher erläutert. Dabei zeigen
Figur 1 : Schematischer Ablauf der sequenz-abhängigen RNA-Amplifikation
Figur 2: Schematischer Abiauf der sequenz-unabhängigen RNA-Amplifikation
Figur 3: Schematischer Ablauf des Labelling des 3'-Endes des RNA-Templates
Figur 4: Schematischer Ablauf der sequenz-unabhängigen RNA Synthese ausgehend von einer poly(C)-RNA in Anwesenheit von 50 μW! GTP
Figur 5: Expression und Reinigung von Norovirus 3DpDl in E. coli.
(A) SDS-PAGE-Analyse von in E. coli exprimierter, gereinigter, rekombinanter Norovirus 3DP°' mit einem C-terminalen His-tag. 3Dp£>l, Wildtyp- Norovirus 3Dpt}l. m3Dpo1, Norovirus 3Dpo1 mit einer Mutation in der .active site' (YGD343GD344G). M, Molekulargewichtsmarker (KDa).
(B) Western-Blot-Analyse von gereinigter rekombinanter Norovirus 3Dpo1 unter Verwendung eines Penta-Histidin-Antikörpers (monoklonaler Maus-Antikörper, Qiagen) zur Detektion von Proteinen mit einem C-terminalen His-tag. 3Dpo1, Wildtyp-Norovirus 3Dpo1. Norovirus 3Dpo1 mit einer Mutation in der .active site' (YGD343GD3443). M, Molekulargewichtsmarker (KDa).
Figur 6: RNA Synthese mit Norovirus 3Dpo1.
(A) Die RNA-Synthese wurde in Anwesenheit einer synthetischen subgenomischen RNA (sG-RNA) als Template sowie in Anwesenheit von Wildtyp-Norovirus 3Dpo1 oder einer Norovirus 3Dpo' mit einer Mutation in der , active site' (YGD343GD344G) wie angegeben untersucht. Die Reaktionsprodukte wurden auf einem nicht-denaturierenden Agarosegel analysiert und mittels Autoradiographie visualisiert. 17, synthetische subgenomische RNA, die durch in vitro Transkription mit 17 hergestellt wurde.
(B) Ethidiumbromid-Färbung desselben Gels und Visualisierung der Reaktionsprodukte durch UV-Transillumination. Die bei der Reaktion mit m3Dpo1 anstelle von Wildtyp 3Dpo1 sichtbare verbleibende Bande stammt von dem in der Reaktion eingesetzten synthetischen subgenomischen RNA- Template. M, RNA Molekulargewichtsmarker. (C) Strangseparationsanalyse des Reaktionsprodukts der in vitro RNA-Synthese mit Norovirus 3Dpo1. Das Reaktionsprodukt wurde durch RNA-Synthese mit Norovirus 3DP°' (3Dpo1 ) mit einer synthetischen subgenomischen RNA (sG- RNA) als Template hergestellt. Die Reaktionsprodukte wurden auf nicht- denaturierenden (0.5 M; links) und denaturierenden (1.25 M; rechts) Formaldehyde-Agarosegelen sichtbar gemacht. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. M, RNA Molekulargewichtsmarker.
Figur 7: Northern-Blot Analyse der Norovirus 3Dpo1 Syntheseprodukte.
(A) Die RNA-Synthese wurde in Anwesenheit einer synthetischen subgenomischen RNA (sG-RNA) als Template sowie in Anwesenheit von Wildtyp-Norovirus 3Dpo1 oder einer Norovirus 3Dpo1 mit einer Mutation in der ,active site' (YGD343QD344G) wie angegeben durchgeführt. Die Reaktionsprodukte wurden auf einem nicht-denaturierenden Agarosegel analysiert und nach Ethidiumbromidfärbung mittels UV-Transillumination visualiert. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. M, RNA Molekulargewichtsmarker. Die bei der Reaktion mit m3Dpo1 anstelle von Wildtyp 3Dpo1 sichtbare verbleibende Bande stammt von dem in der Reaktion eingesetzten Template.
(B) Hybridisierung einer (-)-strängigen RNA-Probe mit den Syntheseprodukten der Norovirus 3Dpo1. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. sG-RNA, als Template eingesetzte synthetische subgenomische RNA. 3Dpo1, Wildtyp-Norovirus 3Dpo1. Norovirus 3Dpo1 mit einer Mutation in der .active site' (YGD343GD344Q).
Figur 8: Analyse der Konzentrationsabhängigkeit, der Temperaturabhängigkeit und des
Zeitverlaufs der Norovirus 3Dpol-Aktivität. Bei allen Reaktionen wurde subgenomische RNA als Template eingesetzt.
(A) Konzentrationsabhängige Aktivität der Norovirus 3Dpo1. Norovirus 3Dpo1 Konzentration (μM) wie angegeben. Die Reaktion wurde für 2 h bei 300C durchgeführt. Für jede Konzentration sind Mittelwert und Standardabweichung dreier unabhängiger Experimente gezeigt.
(B) Zeitverlaufsanalyse der Norovirus 3Dpo'-Aktivität. Einbau von [α-32P]UMP wie angegeben. Die Reaktion wurde bei 300C durchgeführt und 3 μM Norovirus 3Dpo1 wurden eingesetzt. Für jeden Zeitpunkt sind Mittelwert und Standardabweichung dreier unabhängiger Experimente Experimenten gezeigt.
(C) Temperaturabhängige Aktivität der Norovirus 3Dpo1. Einbau von [α-32P]UMP wie angegeben. Die Reaktionszeit war 2 h. Für jede Konzentration von Norovirus 3Dpo1 sind Mittelwert und Standardabweichung dreier unabhängiger Experimente gezeigt.
(D) Metallionen-Abhängigkeit der Norovirus 3Dpol-Aktivität. Die RNA-Synthese wurde über 2 h bei 300C in Gegenwart von 3 μM Norovirus 3DpDl, subgenomischer RNA als Template (0.024 μM) und steigender Konzentrationen (0.5 bis 3 mM) von MgAGO, MnCI2 oder FeSCλ} durchgeführt. Einbau von [α-32P]UMP wie angegeben. Für jede Konzentration sind Mittelwert und Standardabweichung dreier unabhängiger Experimente gezeigt.
Figur 9: Primer-abhängige Initiation der RNA Synthese auf hompoiymeren Tempiaten.
Die RNA-Synthese wurde in Anwesenheit (schwarze Balken) oder in Abwesenheit (graue Balken) eines komplementären RNA-Oligonukleotid-Primers durchgeführt. Der Einbau von [α-32P]CMP, [α-32P]AMP, [α-32P]GMP, oder [α-32P]UMP wurde nach TCA- Präzipitation und Sammeln von G/C-Glassfaserfiltern gemessen. Die Einbauwerte sind angegeben.
Figur 10: Terminale Transferase - Aktivität der Norovirus 3Dpo1
(A) Zur Untersuchung der Terminalen Transferase - Aktivität wurde 3 μM Norovirus 3Dpo1 über 2 h bei 30°C in Gegenwart von subgenomischer RNA (sG-RNA) als Template (0.024 μM) und [α-32P]ATP, [α-32P]GTP, [α-32P]CTP oder [α-3ZP]UTP wie angegeben inkubiert. Die Reaktionsprodukte wurden auf nicht-denaturierenden Agarosegelen analysiert und mittels Autoradiographie visualisiert.
(B) Zeitverlaufsexperiment der Norovirus 3Dpo) Terminalen Transferase - Aktivität an subgenomischer Norovirus-RNA als Template. Die Reaktion wurde wie unter (A) beschrieben, jedoch unter Verwendung von Ja-32P]UTP als gelabeltem Nukleotid durchgeführt, zu den angegebenen Zeiten (sec) gestoppt, und die Reaktionsprodukte wurden auf nicht-denaturierenden Agarosegelen mittels Autoradiographie visualisiert. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. (C) Zeitverlaufsexperiment der RNA-Synthese mit 3 μM Norovirus 3Dpo1 unter Verwendung von subgenomischer RNA als Template. Die Reaktion wurde bei 30°C inkubiert, zu den angegebenen Zeiten (sec) gestoppt und die Reaktions produkte wurden auf nicht-denaturierenden Agarosegelen mittels Autoradiographie visualisiert. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. P, Norovirus 3Dpo1 Syntheseprodukt.
Figur 11: Primer-abhängige Replikation von full-length subgenomischer polyadenylierter
RNA durch Norovirus 3Dpo1. Bei allen Reaktionen wurde synthetische subgenomische polyadenylierte RNA als Template eingesetzt. Die Reaktionsprodukte wurden auf Formaldehyd-Agarosegelen analysiert und durch Autoradiographie visualisiert.
(A) Die Reaktion wurde in Gegenwart eines oligo(U)2o-RNA-Primers wie angegeben (mM) durchgeführt. M, Marker (in vitro transkribierte subgenomische polyadenylierte RNA).
(B) Die Reaktion wurde in Gegenwart eines RNA-Oligonukleotids durchgeführt, das komplementär zu der dem poly(A)-Schwanz benachbarten Sequenz ist. RNA-Oligonukleotid Primerkonzentration (mM) wie angegeben. M, Marker (in vitro transkribierte subgenomische polyadenylierte RNA).
Figur 12: De novo Initiation der RNA-Synthese an Norovirus anti-subgenomischer RNA.
Bei allen Reaktionen wurde synthetische anti-subgenomische RNA als Template für die Replikationsreakton eingesetzt. Die RNA-Reaktionsprodukte wurden auf nativen Agarosegelen analysiert und nach Ethidiumbromidfärbung durch UV-Transillumination visualisiert.
(A) Bahnen 1 bis 3: RNA-Synthese in Gegenwart von Wildtyp 3Dpo1, mutierter 3Dpo1 bzw. in Abwesenheit von 3Dpo1. Bahnen 4 bis 6: RNA-Synthese in Gegenwart von Wildtyp 3Dpo1 und einem RNA-Oligonukleotid komplementär zum 3'-Terminus, mutierter 3Dpo1 und einem RNA-Oligonukleotid komplementär zum 3'-Terminus bzw. mit einem RNA-Oligonukleotid komplementär zum 3'-Terminus, aber ohne Norovirus 3Dpo1. Bahnen 7 bis 9, RNA-Synthese in Gegenwart von Wildtyp 3Dpo1 und einem DNA-Oligonukleotid komplementär zum 3'-Terminus, mutierter 3Dp0' und einem DNA- Oligonukleotid komplementär zum 3'-Terminus, bzw. mit einem DNA- Oligonukleotid komplementär zum 3'-Terminus, aber ohne Norovirus 3Dpo1. T, Template-RNA. R, Replikationsprodukt. M, RNA-Molekulargewichtsmarker (Kb). (B) Strangseparationsanalyse der Replikationsprodukte. Die Reaktionsprodukte wurden auf Formaldehyd-Agarosegelen analysiert und nach Ethidiumbromidfärbung durch UV-Transillumination visualisiert. Bahnen 1 und 2, Template (anti-subgenomische RNA) bzw. Norovirus 3DpDl Replikationsprodukt. M, RNA Molekulargewichtsmarker (Kb).
Figur 13: Primer-unabhängige de novo Initiation der RNA Synthese an homopoiymeren
Templaten. Die RNA-Synthese wurde in Anwesenheit (schwarze Balken) oder in Abwesenheit (graue Balken) von kaltem CTP1 ATP, GTP bzw. UTP für poly(rG), poly(rU), poly(rC) bzw. poly(rA)-Templates durchgeführt. Der Einbau von [α-32P]CMP, [OC-32P]AMP, [α-32P]GMP, oder [α-32P]UMP wurde nach TCA-Präzipitation und Sammeln von G/C-Glassfaserfiltern gemessen. Die Einbauwerte sind angegeben.
Figur 14: Ampiifikation viraler und eukaryontischer RNA mit dem Norovirus RNA-
Polymerase-E nzym .
(A) Autoradiogramm der Inkorporation von [α-32P]UMP. Reaktion 1 , Subgenomische Norovirus RNA; Reaktion 2, Subgenomische Norovirus RNA mit einer 60 Nukleotid Deletion am 5 '-Ende der RNA; Reaktion 3, Subgenomische Norovirus RNA mit einer 60 Nukleotid Deletion am 3'-Ende der RNA; Reaktion 4, Subgenomische Norovirus RNA mit einer 60 Nukleotid Deletion am 5'-Ende und 3'-Ende der RNA; Reaktion 5 u. 6, negative Kontrolle: Reaktion 7; Subgenomische Astrovirus RNA (Serotyp 1); Reaktion 8; Subgenomische Astrovirus RNA (Serotyp 2); Reaktion 9, eukaryontische RNA des elF4-Gens von Xenopus Laevf, Reaktion 10, Subgenomische Norovirus DNA; Reaktion 11 ; T7- transkriberte RNA des elF4-Gens von Xenopus Laevi; Reaktion 12, negative Kontrolle.
(B) Quantifizierung der Inkorporation von [α-32P]UMP. Die Nummerierung der Reaktionen bezieht sich auf die Proben der Figur 14 (A).
Figur 15: Expression und Reinigung von Sapovirus 3Dpo1 in E. coli.
(A) SDS-PAGE Analyse von gereinigter rekombinanter Sapovirus 3Dpo1 die in E. coli exprimiert wurde und einen C-terminalen His-tag trägt. 3Dpo1, Wildtyp- Sapovirus 3Dpo1. m3Dpo1, Sapovirus 3Dpo1 mit einer Mutation in der ,active site' (YGD343GD344G). M, Molekulargewichtsmarker (KDa).
(B) Western-Blot Analyse von gereinigter rekombinanter Sapovirus 3Dpo1 unter Verwendung eines Penta-Histidin-Antikörpers (monoklonaler Maus-Antikörper, Qiagen) zur Detektion von Proteinen mit einem C-terminalen His-tag. 3Dpo1, Wildtyp- Sapovirus 3Dpo1. m3Dpo1, Sapovirus 3Dpo1 mit einer Mutation in der ,active site' (YGD343GD344Q). M, Molekulargewichtsmarker (KDa).
Figur 16: Konzentrationsabhängigkeit, Substratabhängigkeit, Temperaturabhängigkeit und Metallionenabhängigkeit der Sapovirus 3Dp0' Aktivität. Bei allen Reaktionen wurde subgenomische RNA als Template eingesetzt.
(A) Konzentrationsabhängige Aktivität der Sapovirus 3Dpo1. Die RNA-Synthese wurde in Gegenwart von 0.024 μM RNA und ansteigenden Konzentrationen von Sapovirus 3Dpo1 (0.0 bis 5.0 μM) durchgeführt. Einbau von [α-32P]UMP wie angegeben. Die Reaktion wurde 2 h bei 37°C durchgeführt.
(B) Substratabhängigkeit der Sapovirus 3Dpo1 Aktivität. Die RNA-Synthese wurde in Gegenwart von 3 μM Sapovirus 3Dpo1 und ansteigenden Konzentrationen von subgenomischer RNA als Template (0.00. bis 0.100 μM) für 2 h bei 37°C durchgeführt. Einbau von Ja-32P]UMP wie angegeben.
(C) Temperaturabhängige Activität von Sapovirus 3Dpo1. Die Reaktion wurde bei 30°C oder 37°C durchgeführt und zu den angegebenen Zeiten gestoppt. Bei allen Reaktionen wurden 3 μM Sapovirus 3Dpo1 eingesetzt. Einbau von [α- 32P]UMP wie angegeben.
(D) Metallionenabhängigkeit der Sapovirus 3DP°'-Aktivität. Die RNA-Synthese wurde in Gegenwart von 3 μM Sapovirus 3Dpo' mit subgenomischer RNA als Template (0.024 μM) und steigenden Konzentrationen (0.5 bis 5 mM) von MgAcO oder MnCI2 bei 370C für 2 h durchgeführt. Einbau von [α-32P]UMP wie angegeben.
Figur 17: RNA-Synthese mit Sapovirus 3Dpo1.
(A) Die RNA-Synthese in Gegenwart einer synthetischen subgenomischen polyadenylierten RNA (sG-poly(A)-RNA) als Template wurde mit und ohne Zugabe eines 3 μM oligo(U)2o RNA-Primers und in Anwesenheit von Wildtyp Sapovirus 3Dpo1 (3Dpo1) oder wie angegeben einer in der 'acitve site' mutierten 3Dpo1 (m3Dpo1, YGD343GJD344G) untersucht. Die Reaktionsprodukte wurden auf nicht-denaturierenden Agarosegelen analysiert und nach Ethidiumbromidfärbung mit UV-Transillumination visualisiert. Die sichtbare verbleibende Bande in den Reaktionen, bei denen m3Dpo' anstelle von Wildtyp 3Dpo1 eingesetzt wurden oder bei denen kein Oligo(U)2o RNA-Primer zugegben wurde, resultiert vom in der Reaktion eingesetzten synthetischen subgenomischen RNA Template. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. M, RNA- Molekulargewichtsmarker.
(B) Strangseparationsanalyse des Reaktionsprodukts der in vitro RNA-Synthese mit Sapovirus 3Dpo1. Das Reaktionsprodukt wurde wie angegeben durch RNA- Synthese mit Sapovirus 3Dpo1 (3Dpo1 ) unter Verwendung einer subgenomeischen polyadenylierten RNA (sG-Poiy(A)-RNA) als Template erhalten. Die Reaktionsprodukte wurden auf denaturierenden Formaldehyd- Agarosegelen Visual isiert. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. M, RNA- Molekulargewichtsmarker.
Figur 18: De novo Initiation der RNA-Synthese an Sapovirus anti-subgenomischer RNA.
(A) Die RNA-Synthese wurde in Gegenwart einer synthetischen anti- subgenomischen RNA (Anti-sG-RNA) als Template und Wildtyp-Sapovirus 3DPOI ^30POi) oder ejner in der <actjve sjte, mutierten 3Dpoi (Pn30POi1
YGD343GD344G), wie angegeben. Die Reaktionsprodukte wurden auf nicht- denaturierenden Agarosegelen analysiert und nach Ethidiumbromidfärbung durch. UV Transillumination visualisiert. Die sichtbare verbleibende Bande bei der Reaktion, in der m3Dpo1 anstelle von Wildtyp 3Dpo1 eingesetzt wurde, resultiert aus dem in der Reaktion eingesetzten synthetischen anti- subgenomischen RNA-Template. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. M, RNA- Molekulargewichtsmarker.
(B) Strangseparationsanalyse des Reaktionsprodukts der in vitro RNA-Synthese mit Sapovirus 3Dpo'. Das Reaktionsprodukt wurde wie angegeben durch RNA- Synthese mit Sapovirus 3Dpo1 unter Verwendung einer synthetischen anti- subgenomischen RNA (Anti-sG-RNA) als Template erhalten. Die Reaktionsprodukte wurden auf denaturierenden Formaldehyd-Agarosegelen visualisiert. T7, synthetische anti-subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde, lyi, RNA-Molekulargewichtsmarker.
Figur 19: Terminale Transferase-Aktivität von Sapovirus 3Dpo1.
Die Terminale Transferase-Aktivität wurde anhand einer Reaktion aus 3 μM Sapovirus 3Dpo1 oder einer in der ,active site' mutierten 3Dpo1 (m3Dpo1) untersucht, die in Gegenwart von subgenomischer RNA (sG-RNA) als Template (0.024 μM) und [α- 32P]ATP, [OC-32P]GTP, [(X-32P]CTP oder [α-32P]UTP für 2 h bei 37°C (0.024 μM) wie angegeben inkubiert wurde. Die Reaktionsprodukte wurden auf nicht-denaturierenden Agarosegelen analysiert und durch Autoradiographie visualisiert. 17, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde.
Figur 20: De novo Initiation der RNA-Synthese durch Sapo virus 3Dpo> an homopolymeren Templates.
Die RNA-Synthese wurde durchgeführt, indem poly(G)-RNA, poly(U)-RNA, poly(C)- RNA und poly(A)-RNA Templates mit [α-32P]CTP, [α-32P]ATP, [α-32P]GTP, bzw. [α- 32P]UTP und mit oder ohne 3 μM eines Oligo(C)2o, Oligo(A)20l Oligo (G)20 bzw. Oligo(U)20-RNA-Primers inkubiert wurden. Parallel dazu wurde die RNA-Synthese in Abwesenheit eines Oligo(RNA)-Primers, aber in Anwesenheit von 50 μM kaltem CTP, ATP, GTP bzw. UTP für poly(G)-RNA, poly(U)-RNA, poly(C)-RNA bzw. poly(A)-RNA
Templates. Einbau von [α- T]CMP, [α- 32 P]AMP, [α- P]GMP, oder [α-JΦ]UMP as wie angegeben.
Figur 21: Expression und Reinigung vom Vesivirus 3Dpo' in E. coli.
(A) SDS-PAGE Analyse von in E. coli exprimierter, gereinigter, rekombinanter Vesivirus 3Dpt)l mit einem C-terminalen His-tag. Gezeigt sind die Fractionen 11 bis 19 nach Affinitätsreinigung an einer Ni-NTA-Säule sowie die Konzentration von Fraktion 14. M, Molekulargewichtsmarker (KDa).
Figur 22: pol
RNA-Synthese mit Vesivirus 3D
(A) Die RNA-Synthese in Gegenwart einer synthetischen subgenomischen polyadenylierten RNA (sG-poly(A)-RNA) als Template wurde mit und ohne Zugabe eines 3 μM oligo(U)20 RNA-Primers und in Anwesenheit von Wildtyp Vesivirus 3Dpo1 (3Dpo1) untersucht. Die Reaktionsprodukte wurden auf nicht- denaturierenden Agarosegelen analysiert und nach Autoradiographie visualisiert. T7, synthetische subgenomische RNA, die mittels in vitro Transkription mit T7 hergestellt wurde. M, RNA-Molekulargewichtsmarker.
Ausführungsbeispiel 1
Verfahren zur Herstellung rekombinanter Norovirus RdRP
Die cDNA der Norovirus-RdRP wurde durch PCR aus dem Norovirus-Klon pUS-Norll (Genbank accession number: AY741811 ) erhalten. Sie wurde in den pET-28b(+)-Vektor (Novagen) kloniert, der Expressionsvektor wurde sequenziert und in E. coli CL21 (DE3)pLysS transformiert. Die Zellen wurden bei 370C in Luria-Bertani-Medium mit Kanamycin (50 mg/L) kultiviert. Bei einer optischen Dichte von 0.6 (OD600) wurde die Proteinexpression durch den Zusatz von Isopropyl-ß-D-thiogalactopyranosid (IPTG) mit einer Endkonzentration von 1 mM induziert. Die Kulturen wurden dann bei 25 0C über Nacht inkubiert. Die aus 250 ml Kultur erhaltenen Zellpellets wurden einmal in 4 ml phosphate buffered saline (PBS) und 1 % Triton X 100 (Sigma) gewaschen. Die Zellen wurden bei 37 0C für 15 Minuten mit DNase (10 U/ml) behandelt, auf Eis sonifiziert und in 40 ml Bindungspuffer (20 mM Tris/HCI, pH 7.9, 500 mM NaCI, 5 mM Imidazol) resuspendiert. Nach der Zentrifugation bei 4300 rpm bei 4 0C für 40 Minuten wurde das geklärte Lysat erhalten. Die mit einem His6-tag versehene Norovirus-RdRP wurde an eine Ni-Nitrilotriacetessigsäure (NTA)-Sepharosematrix (Novagen) gebunden, die mit dem Bindungspuffer prääquilibriert worden war. Das gebundene Protein wurde mit dem Bindungspuffer, der 60 mM Imidazol enthielt, gewaschen und mit Bindungspuffer, der 1 M Imidazol enthielt, eluiert. Das eluierte Protein wurde gegen Puffer A dialysiert (25 mM Tris-hCI, pH 8.0, 1 mM ß-Mercaptoethanol, 100 mM NaCI, 5 mM MgCI2, 10 % Glycerin, 0.1 % Triton X). Die Proteinkonzentration wurde mit dem BCA proteinassay Kit (Pierce) auf der Grundlage der Biuret- Reaktion bestimmt. Das Enzym wurde in einem Endvolumen von 50 % Glycerin resuspendiert und bei -200C aufbewahrt.
Ausführungsbeispiel 2
Sequenzunabhängige RNA-Amplifikation mit Norovirus-RdRP
Die Reaktionsmischung (50 μl) besteht aus 0.5 bis 1 μg RNA-Matrize, 10 μl des Reaktionspuffer (250 mM HEPES, pH 8.0, 15 mM Magnesiumacetat, 20 mM DTT), 50 U RNase-lnhibitor (RNAsin, Promega), je 0.4 mM von ATP, CTP, GTP, UTP, 3 μM der nach Ausführungsbeispiel 1 hergestellten Norovirus-RdRP. Die Reaktion wird bei 30 0C für 2 Stunden durchgeführt. Die Reaktion wird durch die Zugabe von 50 μl der Stoplösung (4 M Ammoniumacetat, 100 mM EDTA) gestoppt. Die Reinigung erfolgt durch Phenol-Chloroform-Extraktion oder mit dem MEGAclear Kit (Ambion) nach den Herstelleranweisungen. Die Transkriptionsprodukte werden nach Ethidiumbromid-Färbung durch UV- Transillumination auf TBE-gepufferten Agarosegelen sichtbar gemacht. Formamid-Agarosegele können ebenfalls verwendet werden.
Ausführungsbeispiel 3
Sequenzabhängige RNA-Amplifikation mit Norovirus-RdRP mit einem genspezifischen RNA-
Primer
Die Reaktionsmischung (50 μl) besteht aus 0.5 bis 1 μg RNA-Matrize, 10 μl des Reaktionspuffer (250 mM HEPES, pH 8.0, 15 mM Magnesiumacetat, 20 mM DTT), 50 U RNase-lnhibitor (RNAsin, Promega), je 0.4 mM von ATP, CTP, GTP, UTP, 0.1 bis 1 μM genspezifischer RNA-Primer, 3 μM der nach Ausführungsbeispiel 1 hergestellten Norovirus-RdRP. Die Reaktion wird bei 30 0C für 2 Stunden durchgeführt. Die Reaktion wird durch die Zugabe von 50 μl der Stoplösung (4 M Ammoniumacetat, 100 mM EDTA) gestoppt. Die Reinigung erfolgt durch Phenol-Chloroform-Extraktion oder mit dem MEGAclear Kit (Ambion) nach den Herstelleranweisungen. Die Transkriptionsprodukte werden nach Ethidiumbromid-Färbung durch UV-Transillumination auf TBE-gepufferten Agarosegelen sichtbar gemacht. Formamid-Agarosegele oder Harnstoff/Polyacrylamidgele können ebenfalls verwendet werden.
Ausführungsbeispiel 4
Amplifikation der zellulären tnRNA mit Norovirus-RdRP mit einem poly-U-Primer
Die Reaktionsmischung (50 μl) besteht aus 0.5 bis 1 μg RNA-Matrize, 10 μl des Reaktionspuffer (250 mM HEPES, pH 8.0, 15 mM Magnesiumacetat, 20 mM DTT), 50 U RNase-lnhibitor (RNAsin, Promega), je 0.4 mM von ATP, CTP1 GTP1 UTP, 0.1 bis 1 μM poly-(U)2o-Primer, 3 μM der nach Ausführungsbeispiel 1 hergestellten Norovirus-RdRP. Die Reaktion wird bei 30 0C für 2 Stunden durchgeführt. Die Reaktion wird durch die Zugabe von 50 μl der Stoplösung (4 M Ammoniumacetat, 100 mM EDTA) gestoppt. Die Reinigung erfolgt durch Phenol-Chloroform-Extraktion oder mit dem MEGAclear Kit (Ambion) nach den Herstelleranweisungen. Die Transkriptionsprodukte werden nach Ethidiumbromid-Färbung durch UV-Transillumination auf TBE-gepufferten Agarosegelen sichtbar gemacht. Formamid-Agarosegele können ebenfalls verwendet werden.
Ausführungsbeispiel 5
Herstellung von siRNA mit Norovirus-RdRP
Die Reaktionsmischung (50 μl) besteht aus 0.5 bis 1 μg RNA-Matrize, 10 μl des Reaktionspuffer (250 mM HEPES, pH 8.0, 15 mM Magnesiumacetat, 20 mM DTT), 50 U RNase-lnhibitor (RNAsin, Promega), je 0.4 mM von ATP, CTP, GTP1 UTP1 3 μM der nach Ausführungsbeispiel 1 hergestellten Norovirus-RdRP. Die Reaktion wird bei 30 0C für 2 Stunden durchgeführt. Die Reaktion wird durch die Zugabe von 50 μl der Stoplösung (4 M Ammoniumacetat, 100 mM EDTA) gestoppt. Die Reinigung erfolgt durch Phenol-Chloroform-Extraktion oder mit dem MEGAclear Kit (Ambion) nach den Herstelleranweisungen. Die Transkriptionsprodukte werden nach Ethidiumbromid-Färbung durch UV- Transillumination auf TBE-gepufferten 10 %igen Polyacrylamidgelen sichtbar gemacht. Formamid- Agarosegele können ebenfalls verwendet werden. Alternativ kann armored-RNA verwendet werden.
Ausführungsbeispiel 6
Labelling von RNA mit Norovirus-RdRP
Die Reaktionsmischung (50 μl) besteht aus 0.5 bis 1 μg RNA-Matrize, 10 μl des Reaktionspuffer (250 mM HEPES1 pH 8.0, 15 mM Magnesiumacetat, 20 mM DTT), 50 U RNase-lnhibitor (RNAsin, Promega), je 0.4 mM von ATP1 oder CTP1 oder GTP1 oder UTP, 3 μM der nach Ausführungsbeispiel 1 hergestellten Norovirus-RdRP. Die Reaktion wird bei 30 °C für 2 Stunden durchgeführt. Die Reaktion wird durch die Zugabe von 50 μl der Stoplösung (4 M Ammoniumacetat, 100 mM EDTA) gestoppt. Die Reinigung erfolgt durch Phenol-Chloroform-Extraktion oder mit dem MEGAclear Kit (Ambion) nach den Herstelleranweisungen. Die Transkriptionsprodukte werden nach Ethidiumbromid-Färbung durch UV-Transillumination auf TBE-gepufferten 10 %igen Polyacrylamidgelen sichtbar gemacht. Formamid- Agarosegele können ebenfalls verwendet werden. Alternativ kann armored-RNA verwendet werden.
Ausführungsbeispie! 6
RNA-Synthese von poly(C)-poly(G) RNA-Hybrid mit Norovirus-RdRP
Die Reaktionsmischung (50 μl) besteht aus 0.5 bis 1 μg poly(C)-RNA-Matrize, oder eine RNA mit PoIy(C)-RNA am 3'-Ende, 10 μl des Reaktionspuffer (250 mM HEPES, pH 8.0, 15 mM Magnesiumacetat, 20 mM DTT), 50 U RNase-lnhibitor (RNAsin, Promega), 50 μM von GTP, und 3 μM der nach Ausführungsbeispiel 1 hergestellten Norovirus-RdRP. Die Reaktion wird bei 30 0C für 2 Stunden durchgeführt. Die Reaktion wird durch die Zugabe von 50 μl der Stoplösung (4 M Ammoniumacetat, 100 mM EDTA) gestoppt. Die Reinigung erfolgt durch Phenol-Chloroform- Extraktion oder mit dem MEGAclear Kit (Ambion) nach den Herstelieranweisungen. Die Transkriptionsprodukte werden nach Ethidiumbromid-Färbung durch UV-Transillumination auf TBE- gepufferten 10 %igen Polyacrylamidgelen sichtbar gemacht. Formamid-Agarosegele können ebenfalls verwendet werden. Alternativ kann armored-RNA verwendet werden.

Claims

Patentansprüche
1. RNA-abhängige RNA-Polymerase zur Amplifikation und / oder Markierung von RNA, dadurch gekennzeichnet, dass die RNA-abhängige RNA-Polymerase eine „Rechte-Hand- Konformation" aufweist und die Aminosäuresequenz der RNA-abhängigen RNA-Polymerase die folgenden Sequenzabschnitte umfasst: a. XXDYS b. GXPSG c. YGDD d. XXYGL e. XXXXFLXRXX
mit der Bedeutung:
D: Aspartat
Y: Tyrosin
S: Serin
G: Glycin
P: Prolin
L: Leucin
F: Phenylalanin
R: Arginin
X: eine beliebige Aminosäure.
2. RNA-abhängige RNA-Polymerase nach Anspruch 1 , dadurch gekennzeichnet, dass die RNA- abhängige RNA-Polymerase eine RNA-abhängige RNA-Polymerase eines Virus aus der Familie der Caliciviridae ist.
3. RNA-abhängige RNA-Polymerase nach Anspruch 2, dadurch gekennzeichnet, dass die RNA- abhängige RNA-Polymerase eine RNA-abhängige RNA-Polymerase eines humanen und / oder nicht-humanen pathogenen Virus der Familie der Caliciviridae ist.
4. RNA-abhängige RNA-Polymerase nach Anspruch 3, dadurch gekennzeichnet, dass die RNA- abhängige RNA-Polymerase eine RNA-abhängige RNA-Polymerase eines Norovirus, Sapovirus, Vesivirus oder eines Lagovirus ist.
5. RNA-abhängige RNA-Polymerase nach Anspruch 4, dadurch gekennzeichnet, dass die RNA- abhängige RNA-Polymerase die RNA-abhängige RNA-Polymerase eines Norovirus-Stammes wie z.B. des Norovirus-Stammes HuCV/NL/Dresden174/1997/GE oder eines eines Sapovirus- Stammes wie z.B. des Sapovirus-Stammes pJG-SapO1 , oder eines Vesivirus-Stammes wie z.B. des Vesivirus-Stammes FCV/Dresden/2006/GE ist.
6. RNA-abhängige RNA-Polymerase nach Anspruch 4, dadurch gekennzeichnet, dass die RNA- abhängige RNA-Polymerase ein Protein gemäß SEQ ID NO 1, SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5 oder SEQ ID NO 6 ist.
7. Verfahren zur Amplifikation von RNA mittels einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 mit den Schritten a. Anlagerung der RNA-abhängigen RNA-Polymerase an die RNA-Matrize in der Anwesenheit oder Abwesenheit eines Oligonukleotid-Primers, b. Umschreiben der RNA-Matrize in antisense-RNA durch die RNA-abhängige RNA- Polymerase c. Trennung des RNA/antisense-RNA-Duplexes in einzelne RNA-Stränge.
8. Verfahren zur Amplifikation von RNA nach Anspruch 7, dadurch gekennzeichnet, dass die Trennung des RNA/antisense-RNA-Duplexes in einzelne RNA-Stränge durch Hitzedenaturierung, durch chemische Denaturierung und / oder enzymatisch erfolgt.
9. Verfahren zur Amplifikation von RNA nach Anspruch 8, dadurch gekennzeichnet, dass die enzymatische Trennung des RNA/antisense-RNA-Duplexes in einzelne RNA-Stränge durch ein Enzym mit der Fähigkeit, doppelsträngige RNA in einzelsträngige RNA aufzutrennen, erfolgt .
10. Verfahren zur primerabhängigen Amplifikation von RNA nach einem der Ansprüche 7 bis 9, dadurch gekennzeichnet, dass mindestens ein Primer, der mit einem Abschnitt der RNA- Matrize hybridisiert, eingesetzt wird und nach der Anlagerung der RNA-abhängigen RNA- Polymerase der Primer durch die RNA-abhängige RNA-Polymerase entsprechend der Sequenz der RNA-Matrize verlängert wird.
11. Verfahren zur primerabhängigen Amplifikation von RNA nach Anspruch 10, dadurch gekennzeichnet, dass als Primer ein heteropolymeres oder homopolymeres RNA-Primer oder DNA-Primer eingesetzt wird.
12. Verfahren zur primerabhängigen Amplifikation von RNA nach Anspruch 11 , dadurch gekennzeichnet, dass als Primer ein poly-U-RNA-, poly-A-RNA, poly-C-RNA oder poly-G- RNA-Primer oder jedes beliebiges hompolymeres Oligo-RNA-Primer eingesetzt wird.
13. Verfahren zur primerunabhängigen Amplifikation von RNA nach einem der Ansprüche 7 bis 9, dadurch gekennzeichnet, dass kein Primer, der mit einem Abschnitt der RNA-Matrize hybridisiert, eingesetzt und durch die RNA-abhängige RNA-Polymerase entsprechend der Sequenz der RNA-Matrize verlängert wird.
14. Verfahren zur primerunabhängigen Amplifikation von poly(C)-RNA nach einem der Ansprüche 7 bis 9, dadurch gekennzeichnet, dass kein Primer, der mit einem Abschnitt der RNA-Matrize hybridisiert, eingesetzt wird, dass GTP als einziger Nukleotid verwendet wird und durch die RNA-abhängige RNA-Polymerase entsprechend der Sequenz der RNA-Matrize verlängert wird.
15. Verfahren zur Markierung von RNA mittels einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 mit den Schritten a. Anlagerung der RNA-abhängigen RNA-Polymerase an die zu markierende RNA, b. Anhängen mindestens eines Nukleotids an das 3'-Ende der zu markierenden RNA.
16. Verwendung einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 zur Amplifikation und / oder Markierung von RNA.
17. Kit zur Amplifikation von RNA nach Anspruch 7, mindestens bestehend aus
a. einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-Inhibitor e. ggf. Stoplösung
18. Kit zur Amplifikation von RNA nach Anspruch 9, mindestens bestehend aus
a. einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-Inhibitor e. ggf. Stoplösung f. einer Helicase
19. Kit zur primerabhängigen Amplifikation von RNA nach Anspruch 10, mindestens bestehend aus a. einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-Inhibitor e. ggf. Stoplösung f. Primer
20. Kit zur primerunabhängigen Amplifikation von RNA nach Anspruch 13, mindestens bestehend aus a. einer RNA-abhängigen RNA-P olymerase nach einem der Ansprüche 1 bis 6 b. einem geeigneten Reaktions-Puffer c. NTPs d. ggf. RNase-lnhibitor e. ggf. Stoplösung
21. Kit zur Markierung von RNA nach Anspruch 15, mindestens bestehend aus a. einer RNA-abhängigen RNA-Polymerase nach einem der Ansprüche 1 bis 6 b. einem geeigneten Reaktions-Puffer c. CTP oder UTP oder ATP oder GTP oder jeden beliebigen Nukleotid d. ggf. RNase-lnhibitor e. ggf. Stoplösung
EP06761834A 2005-07-25 2006-07-25 Rna-abhängige rna-polymerase, verfahren und kits zur amplifikation und / oder markierung von rna Withdrawn EP1910528A2 (de)

Priority Applications (3)

Application Number Priority Date Filing Date Title
EP09155974A EP2077322B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur Amplifikation von heteropolymerer oder poly(C)- RNA
EP09155984A EP2098592A3 (de) 2005-07-25 2006-07-25 RNA-abhängige RNA-Polymerase, Verfahren und Kits zur Amplifikation und/oder Markierung von RNA
EP10158113A EP2204445B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur primer-abhängigen Amplifikation heterologer viraler, eukaryontischer oder prokaryontischer RNA

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE102005036085 2005-07-25
DE102006008219 2006-02-13
PCT/DE2006/001326 WO2007012329A2 (de) 2005-07-25 2006-07-25 Rna-abhängige rna-polymerase, verfahren und kits zur amplifikation und / oder markierung von rna

Related Child Applications (2)

Application Number Title Priority Date Filing Date
EP09155984A Division EP2098592A3 (de) 2005-07-25 2006-07-25 RNA-abhängige RNA-Polymerase, Verfahren und Kits zur Amplifikation und/oder Markierung von RNA
EP09155974A Division EP2077322B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur Amplifikation von heteropolymerer oder poly(C)- RNA

Publications (1)

Publication Number Publication Date
EP1910528A2 true EP1910528A2 (de) 2008-04-16

Family

ID=37682762

Family Applications (4)

Application Number Title Priority Date Filing Date
EP09155984A Withdrawn EP2098592A3 (de) 2005-07-25 2006-07-25 RNA-abhängige RNA-Polymerase, Verfahren und Kits zur Amplifikation und/oder Markierung von RNA
EP10158113A Not-in-force EP2204445B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur primer-abhängigen Amplifikation heterologer viraler, eukaryontischer oder prokaryontischer RNA
EP09155974A Not-in-force EP2077322B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur Amplifikation von heteropolymerer oder poly(C)- RNA
EP06761834A Withdrawn EP1910528A2 (de) 2005-07-25 2006-07-25 Rna-abhängige rna-polymerase, verfahren und kits zur amplifikation und / oder markierung von rna

Family Applications Before (3)

Application Number Title Priority Date Filing Date
EP09155984A Withdrawn EP2098592A3 (de) 2005-07-25 2006-07-25 RNA-abhängige RNA-Polymerase, Verfahren und Kits zur Amplifikation und/oder Markierung von RNA
EP10158113A Not-in-force EP2204445B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur primer-abhängigen Amplifikation heterologer viraler, eukaryontischer oder prokaryontischer RNA
EP09155974A Not-in-force EP2077322B1 (de) 2005-07-25 2006-07-25 Verfahren und Kit zur Amplifikation von heteropolymerer oder poly(C)- RNA

Country Status (7)

Country Link
US (1) US20080176293A1 (de)
EP (4) EP2098592A3 (de)
JP (1) JP5383189B2 (de)
CN (1) CN101228268A (de)
AT (1) ATE478946T1 (de)
DE (2) DE502006007749D1 (de)
WO (1) WO2007012329A2 (de)

Families Citing this family (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2003279624A1 (en) 2002-11-08 2004-06-07 Pantarhei Bioscience B.V. Synthesis of estetrol via estrone derived steroids
WO2009150156A1 (en) * 2008-06-13 2009-12-17 Riboxx Gmbh Method for enzymatic synthesis of chemically modified rna
CN102216472A (zh) 2008-11-13 2011-10-12 里博克斯艾克斯有限公司 Rna检测方法
US8409805B2 (en) * 2009-02-13 2013-04-02 Asuragen, Inc. Method of amplification of GC-rich DNA templates
CN102333869A (zh) * 2009-02-24 2012-01-25 里博克斯艾克斯有限公司 小干扰rna的改进设计
US20120208242A1 (en) * 2009-10-21 2012-08-16 Riboxx Gmbh Method and RNA Reactor for Exponential Amplification of RNA
JP2013507942A (ja) * 2009-10-21 2013-03-07 リボックス・ゲーエムベーハー 熱安定性rna依存性rnaポリメラーゼを用いる、rnaの指数関数的増幅のための方法
EP2619307A1 (de) 2010-09-21 2013-07-31 RiboxX GmbH Verfahren zur synthese von rna mittels dna-templat
JP2013539969A (ja) * 2010-09-21 2013-10-31 リボックス・ゲーエムベーハー カリシウイルスのrnaポリメラーゼによる、マイクロ波によって駆動されるrna重合
WO2012107538A1 (en) 2011-02-09 2012-08-16 Riboxx Gmbh Method for labelling double-stranded dna or dna/rna hybrids
WO2012107537A1 (en) 2011-02-09 2012-08-16 Riboxx Gmbh Method for the detection of polynucleotide sequences
BR112013030833B1 (pt) 2011-06-01 2019-09-03 Estetra S A processo para a preparação de um composto de fórmula (i) e processo para a preparação de estetrol
WO2012164096A1 (en) 2011-06-01 2012-12-06 Estetra S.A. Process for the production of estetrol intermediates
EP2383279A1 (de) 2011-07-19 2011-11-02 Pantarhei Bioscience B.V. Herstellungsverfahren für Esterol
US20140286998A1 (en) 2011-10-31 2014-09-25 Riboxx Gmbh Double-Stranded RNA For Immunostimulation
WO2013097965A1 (en) 2011-12-30 2013-07-04 Riboxx Gmbh Triphosphate-containing double-stranded rna for immunostimulation
EP2888688B1 (de) 2012-07-20 2019-09-04 Asuragen, INC. Umfassende fmr1-genotypisierung
WO2015144736A1 (en) * 2014-03-24 2015-10-01 Riboxx Gmbh Double-stranded rna conjugates and their use
WO2016112963A1 (en) 2015-01-13 2016-07-21 Riboxx Gmbh Delivery of biomolecules into cells
WO2017121494A1 (en) 2016-01-15 2017-07-20 Riboxx Gmbh 5'-triphosphated short immunostimulatory nucleotides, oligonucleotides and polynucleotides
EP3564375A4 (de) * 2016-12-27 2020-12-16 The University Of Tokyo Verfahren zur funktionalisierung von mrna
US10870891B2 (en) * 2017-01-05 2020-12-22 Biodesix, Inc. Diagnostic test system for specific, sensitive and reproducible detection of circulating nucleic acids in whole blood
CN108893467B (zh) * 2018-06-21 2022-02-15 广东省微生物研究所(广东省微生物分析检测中心) 一种gi.1型札幌病毒基因组扩增引物和扩增方法
WO2021231891A1 (en) * 2020-05-15 2021-11-18 Quidel Corporation Method for direct amplification and detection of rna

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100872437B1 (ko) * 2000-12-01 2008-12-05 막스-플랑크-게젤샤프트 츄어 푀르더룽 데어 비쎈샤프텐 에.파우. Rna 간섭을 매개하는 작은 rna 분자
AU2002314782A1 (en) * 2001-05-14 2002-11-25 Henry H. Ji Replicase cycling reaction amplification
JP2005110517A (ja) * 2003-10-03 2005-04-28 Bml Inc Rna依存性rnaポリメラーゼ蛋白質の製造

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2007012329A2 *

Also Published As

Publication number Publication date
EP2098592A3 (de) 2009-09-30
DE502006007749D1 (de) 2010-10-07
EP2204445A1 (de) 2010-07-07
CN101228268A (zh) 2008-07-23
WO2007012329A2 (de) 2007-02-01
WO2007012329A3 (de) 2007-08-23
JP5383189B2 (ja) 2014-01-08
ATE478946T1 (de) 2010-09-15
EP2098592A2 (de) 2009-09-09
EP2077322A3 (de) 2009-09-30
JP2009502145A (ja) 2009-01-29
EP2077322B1 (de) 2010-08-25
DE112006002611A5 (de) 2008-07-03
EP2204445B1 (de) 2013-01-02
EP2077322A2 (de) 2009-07-08
US20080176293A1 (en) 2008-07-24

Similar Documents

Publication Publication Date Title
EP2077322B1 (de) Verfahren und Kit zur Amplifikation von heteropolymerer oder poly(C)- RNA
JP6587544B2 (ja) 熱安定なTthPrimPolを用いた増幅及び配列決定方法
DE69730926T2 (de) Modifizierte thermostabile DNA Polymerase
US20210139884A1 (en) Reverse transcriptase for nucleic acid sequencing
US7662594B2 (en) Helicase-dependent amplification of RNA
US12241095B2 (en) Modified heat-resistant DNA polymerase
DE69030386T2 (de) Bei hoher temperatur aktive reverse transkriptasen
DE60112746T2 (de) Kälteempfindliche dna-polymerasemutanten
CN114207145B (zh) 基于III型CRISPR/Cas的诊断
EP3556854A1 (de) Hitzebeständiger reverse-transkriptase-mutant
CN113801917B (zh) 基于crispr技术进行多重核酸检测的方法
CA3154479A1 (en) Novel class 2 type ii and type v crispr-cas rna-guided endonucleases
KR20230075403A (ko) 활성 및 열안정성이 증가된 역전사효소 돌연변이체
JP2020036614A (ja) 核酸増幅法
ES2285766T3 (es) Arn-polimerasa dependiente de arn que funciona preferentemente sobre molde de arn y procedimiento de transcripcion de arn bajo la dependencia de un promotor con dicha arn polimerasa dependiente de arn.
US20120135472A1 (en) Hot-start pcr based on the protein trans-splicing of nanoarchaeum equitans dna polymerase
JP7160142B2 (ja) 核酸増幅用試薬及び核酸増幅法
US9994886B2 (en) Modified Epstein-Barr virus DNA polymerase and methods for isothermal DNA amplification
JP7417985B2 (ja) プライマーセット
JP2007000040A (ja) B型肝炎ウイルスの検出方法
CN116926170A (zh) 基于硫修饰核酸及硫修饰核酸识别蛋白的核酸检测方法
CN117441029A (zh) 用于检测具有刺突蛋白突变的严重急性呼吸综合征冠状病毒2(sars-cov-2)变体的组合物和方法
US20050282155A1 (en) Viral libraries from uncultivated viruses and polypeptides produced therefrom
WO2021231891A1 (en) Method for direct amplification and detection of rna
JP2003334095A (ja) 単一成分から成るトリ骨芽球症ウイルス逆転写酵素とその用途

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20080221

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR

17Q First examination report despatched

Effective date: 20081117

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: RIBOXX GMBH

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20091020