DK415780A - Fremgangsmaade til fremstilling af penicilliner - Google Patents
Fremgangsmaade til fremstilling af penicillinerInfo
- Publication number
- DK415780A DK415780A DK415780A DK415780A DK415780A DK 415780 A DK415780 A DK 415780A DK 415780 A DK415780 A DK 415780A DK 415780 A DK415780 A DK 415780A DK 415780 A DK415780 A DK 415780A
- Authority
- DK
- Denmark
- Prior art keywords
- penicillin preparation
- penicillin
- preparation
- Prior art date
Links
- 229930182555 Penicillin Natural products 0.000 title 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 title 1
- 229940049954 penicillin Drugs 0.000 title 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D499/00—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
- C07D499/21—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring with a nitrogen atom directly attached in position 6 and a carbon atom having three bonds to hetero atoms with at the most one bond to halogen, e.g. an ester or nitrile radical, directly attached in position 2
- C07D499/44—Compounds with an amino radical acylated by carboxylic acids, attached in position 6
- C07D499/48—Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical
- C07D499/58—Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical substituted in alpha-position to the carboxamido radical
- C07D499/72—Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical substituted in alpha-position to the carboxamido radical by carbon atoms having three bonds to hetero atoms
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/429—Thiazoles condensed with heterocyclic ring systems
- A61K31/43—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D499/00—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D499/00—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
- C07D499/21—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring with a nitrogen atom directly attached in position 6 and a carbon atom having three bonds to hetero atoms with at the most one bond to halogen, e.g. an ester or nitrile radical, directly attached in position 2
- C07D499/44—Compounds with an amino radical acylated by carboxylic acids, attached in position 6
- C07D499/48—Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical
- C07D499/58—Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical substituted in alpha-position to the carboxamido radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D499/00—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
- C07D499/21—Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring with a nitrogen atom directly attached in position 6 and a carbon atom having three bonds to hetero atoms with at the most one bond to halogen, e.g. an ester or nitrile radical, directly attached in position 2
- C07D499/44—Compounds with an amino radical acylated by carboxylic acids, attached in position 6
- C07D499/76—Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with hetero rings directly attached to the carboxamido radical
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Cephalosporin Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB7934062 | 1979-10-02 |
Publications (1)
Publication Number | Publication Date |
---|---|
DK415780A true DK415780A (da) | 1981-04-03 |
Family
ID=10508217
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK415780A DK415780A (da) | 1979-10-02 | 1980-10-01 | Fremgangsmaade til fremstilling af penicilliner |
Country Status (25)
Country | Link |
---|---|
US (1) | US4385060A (es) |
EP (1) | EP0026644B1 (es) |
JP (1) | JPS5659781A (es) |
KR (1) | KR850000474B1 (es) |
AR (1) | AR227953A1 (es) |
AU (1) | AU534572B2 (es) |
CA (1) | CA1148941A (es) |
DE (1) | DE3061229D1 (es) |
DK (1) | DK415780A (es) |
ES (1) | ES495554A0 (es) |
FI (1) | FI803015A (es) |
GR (1) | GR70283B (es) |
HK (1) | HK786A (es) |
HU (1) | HU182676B (es) |
IE (1) | IE50508B1 (es) |
IL (1) | IL61031A0 (es) |
MY (1) | MY8600395A (es) |
NO (1) | NO802910L (es) |
NZ (1) | NZ194912A (es) |
PH (1) | PH17119A (es) |
PL (3) | PL129141B1 (es) |
PT (1) | PT71856B (es) |
SG (1) | SG72685G (es) |
YU (2) | YU249080A (es) |
ZA (1) | ZA805665B (es) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL67672A0 (en) * | 1982-01-22 | 1983-05-15 | Beecham Group Plc | Penicillin derivatives,their preparation and pharmaceutical compositions containing them |
WO2001066089A2 (en) | 2000-03-09 | 2001-09-13 | Gw Pharma Limited | Pharmaceutical compositions comprising cannabis |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3853849A (en) * | 1969-05-29 | 1974-12-10 | Beecham Group Ltd | Alpha(aryloxycarbonyl)-and alpha(alkoxy-carbonyl)-aralkyl penicillins |
GB1229670A (es) | 1968-09-03 | 1971-04-28 | ||
BE759795A (fr) | 1969-12-11 | 1971-06-03 | Pfizer | Synthese de penicillines par l'intermediaire d'anhydrides mixtes de l'acide sulfurique |
US4171303A (en) * | 1974-07-30 | 1979-10-16 | Chinoin Gyogyszer Es Vegyeszeti Termekek Gyara Rt. | Process for the preparation of reactive penicillanic acid and cephalosporanic acid derivatives |
GB1455529A (es) | 1975-02-27 | 1976-11-10 | ||
JO984B1 (en) | 1977-10-11 | 1979-12-01 | بيتشام غروب ليمتد | A dry pharmaceutical compound with a suitable dosage unit for oral administration |
-
1980
- 1980-09-10 GR GR62854A patent/GR70283B/el unknown
- 1980-09-10 NZ NZ194912A patent/NZ194912A/xx unknown
- 1980-09-12 ZA ZA00805665A patent/ZA805665B/xx unknown
- 1980-09-14 IL IL61031A patent/IL61031A0/xx unknown
- 1980-09-22 US US06/189,622 patent/US4385060A/en not_active Expired - Lifetime
- 1980-09-25 FI FI803015A patent/FI803015A/fi not_active Application Discontinuation
- 1980-09-26 DE DE8080303378T patent/DE3061229D1/de not_active Expired
- 1980-09-26 EP EP80303378A patent/EP0026644B1/en not_active Expired
- 1980-09-30 YU YU02490/80A patent/YU249080A/xx unknown
- 1980-09-30 KR KR1019800003787A patent/KR850000474B1/ko active IP Right Grant
- 1980-09-30 PT PT71856A patent/PT71856B/pt unknown
- 1980-09-30 AU AU62830/80A patent/AU534572B2/en not_active Ceased
- 1980-10-01 PL PL1980232295A patent/PL129141B1/pl unknown
- 1980-10-01 DK DK415780A patent/DK415780A/da unknown
- 1980-10-01 PL PL1980227022A patent/PL129153B1/pl unknown
- 1980-10-01 IE IE2045/80A patent/IE50508B1/en unknown
- 1980-10-01 ES ES495554A patent/ES495554A0/es active Granted
- 1980-10-01 PL PL23229480A patent/PL232294A1/xx unknown
- 1980-10-01 NO NO802910A patent/NO802910L/no unknown
- 1980-10-01 CA CA000361314A patent/CA1148941A/en not_active Expired
- 1980-10-01 HU HU802394A patent/HU182676B/hu unknown
- 1980-10-02 JP JP13823280A patent/JPS5659781A/ja active Pending
- 1980-10-02 PH PH24658A patent/PH17119A/en unknown
-
1981
- 1981-12-21 AR AR287880A patent/AR227953A1/es active
-
1983
- 1983-02-25 YU YU00458/83A patent/YU45883A/xx unknown
-
1985
- 1985-10-05 SG SG726/85A patent/SG72685G/en unknown
-
1986
- 1986-01-02 HK HK7/86A patent/HK786A/xx unknown
- 1986-12-30 MY MY395/86A patent/MY8600395A/xx unknown
Also Published As
Publication number | Publication date |
---|---|
ZA805665B (en) | 1981-09-30 |
IE50508B1 (en) | 1986-04-30 |
HU182676B (en) | 1984-02-28 |
PT71856A (en) | 1980-10-01 |
PL129153B1 (en) | 1984-04-30 |
ES8106733A1 (es) | 1981-09-01 |
NZ194912A (en) | 1983-05-31 |
PL227022A1 (es) | 1981-12-11 |
AU534572B2 (en) | 1984-02-09 |
KR830003498A (ko) | 1983-06-21 |
PL232294A1 (es) | 1982-03-29 |
PL232295A1 (es) | 1982-03-29 |
ES495554A0 (es) | 1981-09-01 |
FI803015A (fi) | 1981-04-03 |
PT71856B (en) | 1981-07-09 |
YU249080A (en) | 1983-06-30 |
PH17119A (en) | 1984-06-01 |
SG72685G (en) | 1986-05-02 |
US4385060A (en) | 1983-05-24 |
PL129141B1 (en) | 1984-04-30 |
YU45883A (en) | 1983-12-31 |
KR850000474B1 (ko) | 1985-04-08 |
HK786A (en) | 1986-01-10 |
IL61031A0 (en) | 1980-11-30 |
GR70283B (es) | 1982-09-03 |
EP0026644A1 (en) | 1981-04-08 |
CA1148941A (en) | 1983-06-28 |
IE802045L (en) | 1981-04-02 |
AR227953A1 (es) | 1982-12-30 |
EP0026644B1 (en) | 1982-12-01 |
AU6283080A (en) | 1981-04-09 |
DE3061229D1 (en) | 1983-01-05 |
MY8600395A (en) | 1986-12-31 |
NO802910L (no) | 1981-04-03 |
JPS5659781A (en) | 1981-05-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DK150623C (da) | Fremgangsmaade til fremstilling af fiskemel | |
DK140480A (da) | Fremgangsmaade til fremstilling af mercaptoacyldipeptider | |
DK229980A (da) | Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner | |
DK156253C (da) | Fremgangsmaade til fremstilling af pyruvatoxidase | |
DK145033C (da) | Fremgangsmaade til fremstilling af bloed iscreme | |
DK144272C (da) | Fremgangsmaade til fremstilling af penicilliner | |
DK277880A (da) | Fremgangsmaade til fremstilling af dipeptider | |
DK174580A (da) | Fremgangsmaade til fremstilling af penicilliner | |
DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
DK87079A (da) | Fremgangsmaade til fremstilling af dialkylphospohorchloridothioter | |
DK229479A (da) | Fremgangsmaade til fremstilling af forbindelser af muramylpeptidtypen | |
DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
DK152752C (da) | Fremgangsmaade til fremstilling af l-sulpirid | |
DK79280A (da) | Fremgangsmaade til fremstilling af penicilliner | |
DK153469C (da) | Fremgangsmaade til fremstilling af fluorerede alkenylaminer | |
DK36379A (da) | Fremgangsmaade til fremstilling af n-ethylethylendiamin | |
DK415780A (da) | Fremgangsmaade til fremstilling af penicilliner | |
DK274480A (da) | Fremgangsmaade til fremstilling af pyrenzepin | |
DK143107C (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
DK341980A (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
DK144280A (da) | Fremgangsmaade til fremstilling af 2-aminopyraziner | |
DK147420C (da) | Fremgangsmaade til fremstilling af acylcyanider | |
DK160294C (da) | Fremgangsmaade til fremstilling af 3-oxycyclopentener | |
DK545280A (da) | Fremgangsmaade til fremstilling af nitrothiazolinforbindelser | |
DK195979A (da) | Fremgangsmaade til fremstilling af d-homosteroider |