DK415780A - Fremgangsmaade til fremstilling af penicilliner - Google Patents

Fremgangsmaade til fremstilling af penicilliner

Info

Publication number
DK415780A
DK415780A DK415780A DK415780A DK415780A DK 415780 A DK415780 A DK 415780A DK 415780 A DK415780 A DK 415780A DK 415780 A DK415780 A DK 415780A DK 415780 A DK415780 A DK 415780A
Authority
DK
Denmark
Prior art keywords
penicillin preparation
penicillin
preparation
Prior art date
Application number
DK415780A
Other languages
Danish (da)
English (en)
Inventor
J P Clayton
M Cole
Original Assignee
Beecham Group Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Beecham Group Ltd filed Critical Beecham Group Ltd
Publication of DK415780A publication Critical patent/DK415780A/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D499/00Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
    • C07D499/21Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring with a nitrogen atom directly attached in position 6 and a carbon atom having three bonds to hetero atoms with at the most one bond to halogen, e.g. an ester or nitrile radical, directly attached in position 2
    • C07D499/44Compounds with an amino radical acylated by carboxylic acids, attached in position 6
    • C07D499/48Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical
    • C07D499/58Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical substituted in alpha-position to the carboxamido radical
    • C07D499/72Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical substituted in alpha-position to the carboxamido radical by carbon atoms having three bonds to hetero atoms
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/425Thiazoles
    • A61K31/429Thiazoles condensed with heterocyclic ring systems
    • A61K31/43Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D499/00Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D499/00Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
    • C07D499/21Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring with a nitrogen atom directly attached in position 6 and a carbon atom having three bonds to hetero atoms with at the most one bond to halogen, e.g. an ester or nitrile radical, directly attached in position 2
    • C07D499/44Compounds with an amino radical acylated by carboxylic acids, attached in position 6
    • C07D499/48Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical
    • C07D499/58Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with a carbon chain, substituted by hetero atoms or by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, attached to the carboxamido radical substituted in alpha-position to the carboxamido radical
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D499/00Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
    • C07D499/21Heterocyclic compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula:, e.g. penicillins, penems; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring with a nitrogen atom directly attached in position 6 and a carbon atom having three bonds to hetero atoms with at the most one bond to halogen, e.g. an ester or nitrile radical, directly attached in position 2
    • C07D499/44Compounds with an amino radical acylated by carboxylic acids, attached in position 6
    • C07D499/76Compounds with an amino radical acylated by carboxylic acids, attached in position 6 with hetero rings directly attached to the carboxamido radical

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Cephalosporin Compounds (AREA)
DK415780A 1979-10-02 1980-10-01 Fremgangsmaade til fremstilling af penicilliner DK415780A (da)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
GB7934062 1979-10-02

Publications (1)

Publication Number Publication Date
DK415780A true DK415780A (da) 1981-04-03

Family

ID=10508217

Family Applications (1)

Application Number Title Priority Date Filing Date
DK415780A DK415780A (da) 1979-10-02 1980-10-01 Fremgangsmaade til fremstilling af penicilliner

Country Status (25)

Country Link
US (1) US4385060A (cs)
EP (1) EP0026644B1 (cs)
JP (1) JPS5659781A (cs)
KR (1) KR850000474B1 (cs)
AR (1) AR227953A1 (cs)
AU (1) AU534572B2 (cs)
CA (1) CA1148941A (cs)
DE (1) DE3061229D1 (cs)
DK (1) DK415780A (cs)
ES (1) ES8106733A1 (cs)
FI (1) FI803015A7 (cs)
GR (1) GR70283B (cs)
HK (1) HK786A (cs)
HU (1) HU182676B (cs)
IE (1) IE50508B1 (cs)
IL (1) IL61031A0 (cs)
MY (1) MY8600395A (cs)
NO (1) NO802910L (cs)
NZ (1) NZ194912A (cs)
PH (1) PH17119A (cs)
PL (3) PL129141B1 (cs)
PT (1) PT71856B (cs)
SG (1) SG72685G (cs)
YU (2) YU249080A (cs)
ZA (1) ZA805665B (cs)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL67672A0 (en) * 1982-01-22 1983-05-15 Beecham Group Plc Penicillin derivatives,their preparation and pharmaceutical compositions containing them
PT1280515E (pt) 2000-03-09 2007-04-30 Gw Pharma Ltd Compisoções farmacêuticas que compreendem canábis

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3853849A (en) * 1969-05-29 1974-12-10 Beecham Group Ltd Alpha(aryloxycarbonyl)-and alpha(alkoxy-carbonyl)-aralkyl penicillins
GB1229670A (cs) 1968-09-03 1971-04-28
BE759795A (fr) 1969-12-11 1971-06-03 Pfizer Synthese de penicillines par l'intermediaire d'anhydrides mixtes de l'acide sulfurique
US4171303A (en) * 1974-07-30 1979-10-16 Chinoin Gyogyszer Es Vegyeszeti Termekek Gyara Rt. Process for the preparation of reactive penicillanic acid and cephalosporanic acid derivatives
GB1455529A (cs) 1975-02-27 1976-11-10
JO984B1 (en) 1977-10-11 1979-12-01 بيتشام غروب ليمتد A dry pharmaceutical compound with a suitable dosage unit for oral administration

Also Published As

Publication number Publication date
KR850000474B1 (ko) 1985-04-08
CA1148941A (en) 1983-06-28
IL61031A0 (en) 1980-11-30
FI803015A7 (fi) 1981-01-01
JPS5659781A (en) 1981-05-23
PT71856B (en) 1981-07-09
PH17119A (en) 1984-06-01
EP0026644A1 (en) 1981-04-08
US4385060A (en) 1983-05-24
ES495554A0 (es) 1981-09-01
AU534572B2 (en) 1984-02-09
SG72685G (en) 1986-05-02
HU182676B (en) 1984-02-28
ES8106733A1 (es) 1981-09-01
PL232295A1 (cs) 1982-03-29
HK786A (en) 1986-01-10
NO802910L (no) 1981-04-03
MY8600395A (en) 1986-12-31
PL232294A1 (cs) 1982-03-29
YU45883A (en) 1983-12-31
ZA805665B (en) 1981-09-30
YU249080A (en) 1983-06-30
PL129153B1 (en) 1984-04-30
NZ194912A (en) 1983-05-31
AU6283080A (en) 1981-04-09
PL227022A1 (cs) 1981-12-11
DE3061229D1 (en) 1983-01-05
EP0026644B1 (en) 1982-12-01
PL129141B1 (en) 1984-04-30
IE802045L (en) 1981-04-02
GR70283B (cs) 1982-09-03
PT71856A (en) 1980-10-01
IE50508B1 (en) 1986-04-30
AR227953A1 (es) 1982-12-30
KR830003498A (ko) 1983-06-21

Similar Documents

Publication Publication Date Title
DK150623C (da) Fremgangsmaade til fremstilling af fiskemel
DK229980A (da) Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner
DK140480A (da) Fremgangsmaade til fremstilling af mercaptoacyldipeptider
DK156253C (da) Fremgangsmaade til fremstilling af pyruvatoxidase
DK145033C (da) Fremgangsmaade til fremstilling af bloed iscreme
DK277880A (da) Fremgangsmaade til fremstilling af dipeptider
DK144272C (da) Fremgangsmaade til fremstilling af penicilliner
DK152752C (da) Fremgangsmaade til fremstilling af l-sulpirid
DK174580A (da) Fremgangsmaade til fremstilling af penicilliner
DK229479A (da) Fremgangsmaade til fremstilling af forbindelser af muramylpeptidtypen
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK87079A (da) Fremgangsmaade til fremstilling af dialkylphospohorchloridothioter
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK79280A (da) Fremgangsmaade til fremstilling af penicilliner
DK153469C (da) Fremgangsmaade til fremstilling af fluorerede alkenylaminer
DK36379A (da) Fremgangsmaade til fremstilling af n-ethylethylendiamin
DK415780A (da) Fremgangsmaade til fremstilling af penicilliner
DK274480A (da) Fremgangsmaade til fremstilling af pyrenzepin
DK143107C (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK341980A (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK144280A (da) Fremgangsmaade til fremstilling af 2-aminopyraziner
DK147420C (da) Fremgangsmaade til fremstilling af acylcyanider
DK160294C (da) Fremgangsmaade til fremstilling af 3-oxycyclopentener
DK545280A (da) Fremgangsmaade til fremstilling af nitrothiazolinforbindelser
DK195979A (da) Fremgangsmaade til fremstilling af d-homosteroider