DK302880A - Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin - Google Patents

Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin

Info

Publication number
DK302880A
DK302880A DK302880A DK302880A DK302880A DK 302880 A DK302880 A DK 302880A DK 302880 A DK302880 A DK 302880A DK 302880 A DK302880 A DK 302880A DK 302880 A DK302880 A DK 302880A
Authority
DK
Denmark
Prior art keywords
amino1
pyrazoline
aryl
preparing
pharmaceutical preparation
Prior art date
Application number
DK302880A
Other languages
Danish (da)
English (en)
Inventor
A G Caldwell
S R Challand
F C Copp
C V Denyer
K E Eakins
J M G Walker
N Whittaker
Original Assignee
Wellcome D
Wellcome Found
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Wellcome D, Wellcome Found filed Critical Wellcome D
Publication of DK302880A publication Critical patent/DK302880A/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D231/00Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
    • C07D231/02Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
    • C07D231/06Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C243/00Compounds containing chains of nitrogen atoms singly-bound to each other, e.g. hydrazines, triazanes

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
DK302880A 1979-07-13 1980-07-11 Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin DK302880A (da)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US5736279A 1979-07-13 1979-07-13

Publications (1)

Publication Number Publication Date
DK302880A true DK302880A (da) 1981-01-14

Family

ID=22010106

Family Applications (1)

Application Number Title Priority Date Filing Date
DK302880A DK302880A (da) 1979-07-13 1980-07-11 Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin

Country Status (10)

Country Link
EP (1) EP0022578B1 (enExample)
JP (1) JPS5632416A (enExample)
AU (1) AU537499B2 (enExample)
CA (1) CA1150632A (enExample)
DE (1) DE3072103D1 (enExample)
DK (1) DK302880A (enExample)
IL (1) IL60550A (enExample)
IT (1) IT1207128B (enExample)
NZ (1) NZ194328A (enExample)
ZA (1) ZA804196B (enExample)

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL64555A (en) * 1980-12-16 1986-01-31 Wellcome Found Pharmaceutical compositions containing aryl-pyrazolineamine derivatives,certain such novel derivatives and their preparation
US4572913A (en) * 1980-12-23 1986-02-25 Burroughs Wellcome Co. Use of 3-(arylmethyleneamino)-1-aryl-2-pyrazolines in the prophylaxis and treatment of inflammation, pain, pyresis, and asthma
DE3172167D1 (en) * 1980-12-23 1985-10-10 Wellcome Found Pyrazoline derivatives, processes for their preparation and pharmaceutical formulations containing them
EP0070376A1 (en) * 1981-07-13 1983-01-26 American Cyanamid Company Heterocyclic substituted-amino-pyrazolines
US4432991A (en) * 1981-07-13 1984-02-21 American Cyanamid Company Therapeutically active 3-amino-1-phenyl(and substituted phenyl)-2-pyrazolines
US4447442A (en) * 1981-07-13 1984-05-08 American Cyanamid Company 3-Trifluoroacetylamino-1-aryl-2-pyrazolines
US4451479A (en) * 1981-07-13 1984-05-29 American Cyanamid Company Therapeutically active 3-amino-1-halogenated phenyl-2-pyrazolines and their C4 and C5 analogs
US4448783A (en) * 1982-05-17 1984-05-15 Burroughs Wellcome Co. Substituted pyrazoline, and its use in treatment of gastro-intestinal disturbances
FI840543A7 (fi) * 1983-02-11 1984-08-12 Wellcome Found Kemisk process och vid denna anvaendbara mellanprodukter.
GB8303782D0 (en) * 1983-02-11 1983-03-16 Wellcome Found Heterocyclic compounds
US4824859A (en) * 1983-05-21 1989-04-25 Fisons Plc. Pyrazoline compounds compositions and use
EP0178035B1 (en) * 1984-05-12 1990-01-03 FISONS plc Anti-inflammatory 1,n-diarylpyrazol-3-amines, compositions containing them and processes for their preparation
US4970210A (en) * 1987-07-17 1990-11-13 Abbott Laboratories Triazinone lipoxygenase compounds
DK2903440T3 (en) 2012-10-02 2017-12-11 Bayer Cropscience Ag THETEROCYCLIC COMPOUNDS AS PESTICIDES
CA2925873A1 (en) * 2013-10-17 2015-04-23 Dow Agrosciences Llc Processes for the preparation of pesticidal compounds
AR098108A1 (es) * 2014-07-31 2016-05-04 Dow Agrosciences Llc Proceso para la preparación de 3-(3-cloro-1h-pirazol-1-il)piridina

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1324687A (en) * 1970-08-06 1973-07-25 Chinoin Gyogyszer Es Vegyeszet 3-amino-delta2-pyrazoline derivatives and process for the preparation thereof
IT1061812B (it) * 1976-06-25 1983-04-30 Montedison Spa Processo per la preparazione di i fenil 3 ammino pirazoli

Also Published As

Publication number Publication date
EP0022578A1 (en) 1981-01-21
DE3072103D1 (en) 1988-08-04
ZA804196B (en) 1982-02-24
NZ194328A (en) 1985-03-20
IL60550A0 (en) 1980-09-16
JPH0248549B2 (enExample) 1990-10-25
EP0022578B1 (en) 1988-06-29
IT8049233A0 (it) 1980-07-11
IL60550A (en) 1984-12-31
CA1150632A (en) 1983-07-26
AU537499B2 (en) 1984-06-28
IT1207128B (it) 1989-05-17
JPS5632416A (en) 1981-04-01
AU6032780A (en) 1981-01-15

Similar Documents

Publication Publication Date Title
DK153440C (da) Fremgangsmaade til fremstilling af et nasalt farmaceutisk ergotpeptidalkaloid-praeparat
DK158932C (da) Fremgangsmaade til fremstilling af pancreatinpiller
DK345081A (da) Fremgangsmaade til fremstilling af et stabilt vandigt praeparat indeholdende invermectin
DK498481A (da) Fremgangsmaade til fremstilling af et stabilt gelprodukt
DK154267C (da) Fremgangsmaade til fremstilling af et intravenoest indgiveligt antistofholdigt immunoglobulin og fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende dette
DK160739C (da) Fremgangsmaade til fremstilling af et stabilt prostaglandinindeholdende praeparat til laegemiddelanvendelse
DK528879A (da) Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende isosorbiddinitrat
DK302880A (da) Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin
DK229980A (da) Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner
DK140480A (da) Fremgangsmaade til fremstilling af mercaptoacyldipeptider
DK157169C (da) Fremgangsmaade til fremstilling af et koncentrat af prothrombinkompleks
ES497831A0 (es) Un metodo de preparacion de nuevos nitrotiofenos
DK8080A (da) Fremgangsmaade til fremstilling af en graneleret formulering af nabilon
DK277880A (da) Fremgangsmaade til fremstilling af dipeptider
DK203879A (da) Fremgangsmaade til fremstilling af en farmaceutisk doseringskomponent
DK7679A (da) Fremgangsmaade til fremstilling af et prostaglandinholdigt praeparat
DK352578A (da) Fremgangsmaade til fremstilling af et farmaceutisk praeparat
DK174580A (da) Fremgangsmaade til fremstilling af penicilliner
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK154607C (da) Fremgangsmaade til fremstilling af en laegemiddelform til oral administration af ergotalkaloider
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK159136C (da) Fremgangsmaade til fremstilling af et farmaceutisk praeparat til rectal indgivning
DK345681A (da) Fremgangsmaade til femstilling af et farmaceutisk praeparat
DK396582A (da) Fremgangsmaade til fremstilling af farmaceutisk praeparat
DK153469C (da) Fremgangsmaade til fremstilling af fluorerede alkenylaminer

Legal Events

Date Code Title Description
AHB Application shelved due to non-payment