DK300781A - Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater - Google Patents
Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivaterInfo
- Publication number
- DK300781A DK300781A DK300781A DK300781A DK300781A DK 300781 A DK300781 A DK 300781A DK 300781 A DK300781 A DK 300781A DK 300781 A DK300781 A DK 300781A DK 300781 A DK300781 A DK 300781A
- Authority
- DK
- Denmark
- Prior art keywords
- halogenphenylpyridyllylamine
- derivatives
- preparing
- preparing halogenphenylpyridyllylamine
- halogenphenylpyridyllylamine derivatives
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/28—Radicals substituted by singly-bound oxygen or sulphur atoms
- C07D213/30—Oxygen atoms
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/24—Antidepressants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/26—Radicals substituted by halogen atoms or nitro radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/36—Radicals substituted by singly-bound nitrogen atoms
- C07D213/38—Radicals substituted by singly-bound nitrogen atoms having only hydrogen or hydrocarbon radicals attached to the substituent nitrogen atom
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/44—Radicals substituted by doubly-bound oxygen, sulfur, or nitrogen atoms, or by two such atoms singly-bound to the same carbon atom
- C07D213/46—Oxygen atoms
- C07D213/48—Aldehydo radicals
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Psychiatry (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pain & Pain Management (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pyridine Compounds (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Plural Heterocyclic Compounds (AREA)
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
SE7909514A SE7909514L (sv) | 1979-11-16 | 1979-11-16 | Nya halofenyl-pyridyl-allylaminderivat |
PCT/SE1980/000286 WO1981001407A1 (en) | 1979-11-16 | 1980-11-14 | Novel halophenyl-pyridyl-allylamine derivatives |
Publications (1)
Publication Number | Publication Date |
---|---|
DK300781A true DK300781A (da) | 1981-07-07 |
Family
ID=20339337
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK300781A DK300781A (da) | 1979-11-16 | 1981-07-07 | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater |
Country Status (17)
Country | Link |
---|---|
US (1) | US4418065A (fi) |
EP (2) | EP0029420A1 (fi) |
JP (1) | JPS56501524A (fi) |
AU (1) | AU538087B2 (fi) |
CA (1) | CA1155128A (fi) |
DK (1) | DK300781A (fi) |
ES (5) | ES8204721A1 (fi) |
FI (1) | FI812196L (fi) |
GR (1) | GR72129B (fi) |
NO (1) | NO812401L (fi) |
NZ (1) | NZ195558A (fi) |
PL (3) | PL129370B1 (fi) |
PT (1) | PT72066B (fi) |
SE (1) | SE7909514L (fi) |
SU (4) | SU1103794A3 (fi) |
WO (1) | WO1981001407A1 (fi) |
ZA (1) | ZA807102B (fi) |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA1150269A (en) * | 1980-11-14 | 1983-07-19 | Carl B. J. Ulff | Process for preparing 3-(4-bromophenyl)-3-(3-pyridyl)-allylamines |
US4610995A (en) * | 1984-07-27 | 1986-09-09 | Coker Geoffrey G | Certain 1,1-diaryl-propenyl-3-(1-pyrrolidino-2-carboxylic acids, derivatives thereof and their anti-histaminic properties |
GB8814639D0 (en) * | 1988-06-20 | 1988-07-27 | Ici Plc | Heterocyclic tertiary alcohol derivatives |
US6288083B1 (en) | 1998-09-04 | 2001-09-11 | Millennium Pharmaceuticals, Inc. | Chemokine receptor antagonists and methods of use therefor |
US6503926B2 (en) | 1998-09-04 | 2003-01-07 | Millennium Pharmaceuticals, Inc. | Chemokine receptor antagonists and methods of use therefor |
GB0219154D0 (en) * | 2002-08-16 | 2002-09-25 | Pfizer Ltd | Diaryl compounds |
US6800652B2 (en) | 2002-08-16 | 2004-10-05 | Pfizer Inc. | Diaryl compounds |
JP6479834B2 (ja) | 2013-11-05 | 2019-03-06 | アストラゼネカ・アクチエボラーグAstrazeneca Aktiebolag | Nmdaアンタゴニストプロドラッグ |
Family Cites Families (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2676964A (en) * | 1950-06-07 | 1954-04-27 | Schering Corp | 3-pyridyl propylamine antihistamine substances |
DE966534C (de) * | 1951-03-22 | 1957-08-22 | Schering Corp | Verfahren zur Herstellung von basisch substituierten Pyridinverbindungen |
GB850298A (en) | 1956-10-30 | 1960-10-05 | Maggioni & C Societa Per Azion | ª‡,ª‡[(p-chlorophenyl)-(4-pyridyl)] carbinols and method of preparing same |
DE1468359A1 (de) * | 1963-10-23 | 1968-11-28 | Merck & Co Inc | Verfahren zur Herstellung von Dibenzocycloheptehderivaten |
US3396224A (en) * | 1965-09-09 | 1968-08-06 | Lilly Co Eli | Controlling phytopathogenic fungi on plants with 3-pyridyl methane derivatives |
US3423510A (en) * | 1966-08-31 | 1969-01-21 | Geigy Chem Corp | 3-(p-halophenyl) - 3 - (2'-pyridyl-n-methylpropylamine for the treatment of depression |
US3471505A (en) * | 1967-02-01 | 1969-10-07 | Ciba Geigy Corp | 1-(alkoxyphenyl)-1-(3-pyridyl)-carbinols |
US3928369A (en) * | 1971-04-28 | 1975-12-23 | Haessle Ab | Compounds useful as antidepressive agents, and a process for their preparation |
US3928613A (en) * | 1971-04-28 | 1975-12-23 | Haessle Ab | Compounds useful as antidepressive agents |
SE361663B (fi) * | 1971-04-28 | 1973-11-12 | Haessle Ab | |
SE373850B (fi) * | 1972-11-16 | 1975-02-17 | Haessle Ab | |
US4094908A (en) * | 1973-08-15 | 1978-06-13 | Richter Gedeon Vegyeszeti Gyar Rt. | Alpha-substituted benzhydrol derivatives |
GB1480593A (en) * | 1973-11-30 | 1977-07-20 | Kefalas As | Xanthene and thioxanthene derivatives having pharmaceutical activity |
US4102887A (en) * | 1974-11-21 | 1978-07-25 | Per Arvid Emil Carlsson | Intermediates used in the preparation of phenyl-pyridylamine derivatives |
SE388854B (sv) | 1974-11-21 | 1979-03-26 | Astra Laekemedel Ab | Forfarande for framstellning av fenylpyridylaminderivat |
US4186202A (en) * | 1974-11-21 | 1980-01-29 | Astra Lakemedel Aktiebolag | Phenyl-pyridylamine derivatives |
SE418291B (sv) * | 1976-05-17 | 1981-05-18 | Astra Laekemedel Ab | 4-bromfenyl-3-pyridylderivat som mellanprodukter vid framstellning av fenylpyridylaminer |
SE409706B (sv) * | 1976-05-21 | 1979-09-03 | Astra Pharma Prod | Forfarande for framstellning av n,n-dimetyl-3-(4-bromfenyl)-3-3(3-pyridyl)-allylamin dihydroklorid monohydrat |
SE418399B (sv) * | 1976-05-21 | 1981-05-25 | Astra Laekemedel Ab | Forfarande for framstellning av n,n-dimetyl-3-(4 bromfenyl)-3-(3-pyridyl)allylamin |
EP0000322B1 (en) * | 1977-07-04 | 1982-05-05 | Astra Läkemedel Aktiebolag | Compounds having an anti-depressive or tranquilizing activity, pharmaceutical compositions containing them, and processes and intermediates for their preparation |
SE409861B (sv) * | 1977-07-04 | 1979-09-10 | Astra Laekemedel Ab | Ett nytt forfarande for framstellning av en terapeutisk aktiv pyridinforening |
SE409860B (sv) * | 1977-07-04 | 1979-09-10 | Astra Laekemedel Ab | En ny mellanprodukt for framstellning av terapeutiskt aktiva pyridinforeningar |
-
1979
- 1979-11-16 SE SE7909514A patent/SE7909514L/xx not_active Application Discontinuation
-
1980
- 1980-11-14 NZ NZ195558A patent/NZ195558A/en unknown
- 1980-11-14 ES ES496859A patent/ES8204721A1/es not_active Expired
- 1980-11-14 EP EP80850172A patent/EP0029420A1/en not_active Withdrawn
- 1980-11-14 EP EP83200107A patent/EP0081478A3/en not_active Withdrawn
- 1980-11-14 ZA ZA00807102A patent/ZA807102B/xx unknown
- 1980-11-14 GR GR63358A patent/GR72129B/el unknown
- 1980-11-14 CA CA000364712A patent/CA1155128A/en not_active Expired
- 1980-11-14 JP JP50260380A patent/JPS56501524A/ja active Pending
- 1980-11-14 AU AU64378/80A patent/AU538087B2/en not_active Ceased
- 1980-11-14 WO PCT/SE1980/000286 patent/WO1981001407A1/en active Application Filing
- 1980-11-14 US US06/232,043 patent/US4418065A/en not_active Expired - Fee Related
- 1980-11-14 PT PT72066A patent/PT72066B/pt unknown
- 1980-11-14 PL PL1980232731A patent/PL129370B1/pl unknown
- 1980-11-14 PL PL1980227849A patent/PL128457B1/pl unknown
- 1980-11-14 PL PL1980232732A patent/PL129369B1/pl unknown
-
1981
- 1981-07-07 DK DK300781A patent/DK300781A/da not_active Application Discontinuation
- 1981-07-10 FI FI812196A patent/FI812196L/fi not_active Application Discontinuation
- 1981-07-13 NO NO812401A patent/NO812401L/no unknown
- 1981-07-15 SU SU813306852A patent/SU1103794A3/ru active
- 1981-12-16 ES ES508065A patent/ES508065A0/es active Granted
- 1981-12-16 ES ES508063A patent/ES8300095A1/es not_active Expired
- 1981-12-16 ES ES508064A patent/ES508064A0/es active Granted
- 1981-12-16 ES ES508062A patent/ES508062A0/es active Granted
-
1982
- 1982-04-13 SU SU823419750A patent/SU1149875A3/ru active
- 1982-04-13 SU SU823419749A patent/SU1149874A3/ru active
- 1982-12-30 SU SU823530055A patent/SU1138021A3/ru active
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DK158679C (da) | Fremgangsmaade til fremstilling af ethanol | |
DK540080A (da) | Fremgangsmaade til fremstilling af 2-amino-4-hydroxyquinazolinderivater | |
DK377079A (da) | Fremgangsmaade til fremstilling af 4-anilinoquinazolinderivater | |
DK417981A (da) | Fremgangsmaade til fremstilling af 3-aryl-5-isothiazol-derivater | |
DK160679A (da) | Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid | |
DK88081A (da) | Fremgangsmaade til fremstilling af tetrazolderivater | |
DK140480A (da) | Fremgangsmaade til fremstilling af mercaptoacyldipeptider | |
DK229980A (da) | Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner | |
DK343682A (da) | Fremgangsmaade til fremstilling af thiazolidinylalkylen-piperazin-derivater | |
DK277880A (da) | Fremgangsmaade til fremstilling af dipeptider | |
DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
DK152752C (da) | Fremgangsmaade til fremstilling af l-sulpirid | |
DK343782A (da) | Fremgangsmaade til fremstilling af spirothiazolidinyl-piperazin-derivater | |
DK183880A (da) | Fremgangsmaade til fremstilling af hydroxyderivater af isopropyrimidin | |
DK153469C (da) | Fremgangsmaade til fremstilling af fluorerede alkenylaminer | |
DK36379A (da) | Fremgangsmaade til fremstilling af n-ethylethylendiamin | |
DK149472C (da) | Fremgangsmaade til fremstilling af phosphorchloridthiolater | |
DK158038C (da) | Fremgangsmaade til fremstilling af di-n-propylacetonitril | |
DK144280A (da) | Fremgangsmaade til fremstilling af 2-aminopyraziner | |
DK341980A (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
DK143107C (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
DK274480A (da) | Fremgangsmaade til fremstilling af pyrenzepin | |
DK160294C (da) | Fremgangsmaade til fremstilling af 3-oxycyclopentener | |
DK158678A (da) | Fremgangsmaade til fremstilling af d-homosteroider |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
ATS | Application withdrawn |