CN1178340A - Method for inputting Chinese characters by three-four codes - Google Patents
Method for inputting Chinese characters by three-four codes Download PDFInfo
- Publication number
- CN1178340A CN1178340A CN 97114253 CN97114253A CN1178340A CN 1178340 A CN1178340 A CN 1178340A CN 97114253 CN97114253 CN 97114253 CN 97114253 A CN97114253 A CN 97114253A CN 1178340 A CN1178340 A CN 1178340A
- Authority
- CN
- China
- Prior art keywords
- radical
- character
- chinese character
- word
- chinese
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Landscapes
- Machine Translation (AREA)
Abstract
An unsimplified Chinese characters input method is a quick typing one based on phases and radicals. 3-digit code is used for entering single words and 4-digit code for phrases. Its root encode features the combination of shape and pronunciation, which the 432 Chinese-character roots are all mapped to 26 English letter keys. Its advantages is easy to master it.
Description
The present invention relates to (BIG5) method for inputting Chinese characters, more particularly, relate to a kind of shape of unsimplified Hanzi radical and feature of Guangdong language pronunciation thereof utilized and realize the coding method that computer Chinese-character is imported.
Use the area of unsimplified Hanzi in Hong Kong and other,, use with " Guangdong phonetic " " sound sign indicating number " input method mostly as representative for realizing the computing machine input of unsimplified Hanzi, be characterized in that memory capacitance is few, more eager to learn, but the repetition rate of coding is very high, input speed is slow, can not realize touch system.And be " font code " input method of representative owing to select radical and increase the cause of code length with " Cangjie's input method ", the word repetition rate of coding reduces relatively, and speed improves, but memory capacitance is very big, finds it difficult to learn easily to forget; And there is not phrase input etc.Above-mentioned two big class Chinese character entering techniques, only use a kind of in Chinese character sound, two key elements of shape respectively, do not make full use of the key element of Chinese character own, and starting point of their itself design is standard with the input individual character all, so the expansion that will add phrase thereon and carry out phrase is the comparison difficulty.Therefore easily learning, still attending to one thing and lose sight of another aspect handy, quick.How people can read, knowledge that can writing of Chinese characters, be directly used in the encode Chinese characters for computer of computing machine, and don't need to memorize mechanically those people be some regulation or artificial a large amount of radicals that split of forcing, this is the striving direction of present computer Chinese input method.
The object of the present invention is to provide a kind of method for inputting Chinese characters by three-four codes, this input method is directly encoded to the shape of Chinese character, and all Chinese characters only need have certain understanding just can import to its shape.This Chinese character input method is a feature with 3 yards defeated words, 4 yards defeated speech, and is a kind of quick input method based on speech, and repeated code is few, code length is short and high input speed is easily learnt usefulness well.
The object of the present invention is achieved like this, construct a kind of method for inputting Chinese characters by three-four codes, be used for importing any one Chinese character of 13053 unsimplified Hanzis that will comprise that the BIG5 word is concentrated, convert to by certain step and can be input to computing machine and for its encode Chinese characters for computer of discerning, described encode Chinese characters for computer set comprises English 26 letters, described certain step comprises imports the step that Chinese character resolves into several Chinese character roots with desire, in the several Chinese character roots that decomposite each is mapped to a step of one in the encode Chinese characters for computer set respectively, import the encode Chinese characters for computer that obtains one by one and arrive the step of computing machine, it is characterized in that:
Describedly wish is inputted Chinese character decomposition become the Chinese character radical of using in the step of several Chinese character radicals to comprise sound radical and shape radical, described sound radical coding is the first letter of the Guangdong language phonetic of this radical itself, described shape radical coding is generally to obtain by methods such as pictographs, has 26 groups; In the step of during each in described several Chinese character radicals that will decomposite is mapped to respectively an encode character for computer set, namely Chinese character radical group is to the following corresponding relation of being mapped with of encode character for computer: (A: watt tooth Asia () ShitoYao township Zhao Jue), (B: an ancient type of spoon does not cling toBen Bibai third grasps Bi and foretells () Tony (order)), (C: seven fork zhang size Rolling rivers thousand are ended just uglyLead to scold hurriedly and have Zhu Zhou state string Trucks Long of one's own and weigh worm), (D: tricky bad protruding red fourth () cutter (Dao) electricity(day, say)), (E: two (Bing 丷
)
Narrow eyes into a slit the sixth of the twelve Earthly Branches is), (F: fiery side husband not Pu all () Fou Fly RollingZhang ), (G: towel do the jin melon and fruit more blunt () dagger-axe (Shoot a retrievable arrow) (stone)), (H:(horizontal), mouthful mouthful lower blood is opened gas Xiangxi), (I:(Vertical) Shu, speech (Tou)
Rich 屮
CityNie Then), (J: the sunset well pawl heart (Xin) Epileptic Factory ()), (K: nine works of a specified duration bows and oneself sweet huge first are asked bent card beggar (Hideaway) wide several (Few) golden Zhuang ), (L: power vertical in six officials ()
(
)
), (M: wood not riceThe hair people penta ware female (not) literary composition (Fan notThe-Fan) Wan Door), (N:(right-falling stroke) Dian, be recessed my the Inner (Rou of five female) Http Mi Jiong), (O:(Difficult radical) totally 45 Ge), (P:(slash) Pie,Sheet Jie FuThe Yi corpse Yin), (Q: Ma Ukraine Fish ox (Niu) the Quan insect without feet or legsPig PHP-Manual), (R: the people enters (Ren Chi )), (S: on three the few sailor Sheng Shi of four generation lose Shi Shenshengxi body thing hang down bundle () minister () little () food Rui San Chuan), (T: Da Tian East village soil (scholar) day (dying young) ), (U: Lv twenty Industry European-allies), (V:(folding) second, Si
Bao Qian Contraband), (W: the Households standing grain mutually forever () king's (ninth of the ten Heavenly Stems) Ukraine is (mountain)), (X:(ten)乂
癶
), (Y: again sword in the outstanding ball of In-particular also beautiful rain entreat the tenth of the twelve Earthly Branches Yu smooth drag a kind of monkey mentioned in ancient literature Yu mound ear by Ran Yueyong () bifurcation), (Z: walk foot ()廴
Shu).
Method for inputting Chinese characters by three-four codes provided by the invention is characterized in that, desire is imported in the step that Chinese character resolves into several Chinese character roots described, according to the Lian Yaofen that divines by means of characters in sequential write, the word, looses, intersect and do not carry out from 4 rules, that is:
The Chinese character pattern decomposition is all undertaken by the sequential write of standard;
Chinese character pattern decomposes the method for pressing " divining by means of characters in the word " to carry out;
A Chinese character is being carried out font when decomposing, have a plurality of from or the radical that links to each other when accumulating in, should take them apart code fetch respectively;
When carrying out the font decomposition, every cross one another stroke structure piece can not be split, and is considered as single character, makes a Chinese character root when splitting code fetch and handles.
By method for inputting Chinese characters by three-four codes provided by the invention, it is characterized in that: can import arbitrary Chinese character for 3 yards,, get root coding+3 yards inputs of the first sum of picture+end stroke individual character root single character; To the combinde rqdical character of double word root, get first character root+inferior radical+3 yards inputs of this word end stroke; To three radicals or multiword root, should get the totally 3 yards inputs of first character root+inferior radical+last radical.
By method for inputting Chinese characters by three-four codes provided by the invention, its feature also is: can import arbitrary phrase for 4 yards.For two words, the first two yard composition totally 4 yards inputs of all-key got in every word; To three words, preceding two words are respectively got first yard, last word and are got the totally 4 yards inputs of the first two yard composition; To four words or multi-character words, the totally 4 yards inputs of first yard composition all got in each word of front-three-end-one.
Implementing method for inputting Chinese characters by three-four codes of the present invention, is a kind of quick input method based on speech, is suitable for sole duty or non-full-time keyboarder and uses, and easily learns easily note, as long as the radical of Chinese character is had certain understanding, can learn in general one day.Code symbols is 26 English alphabets, 3 code words, and 4 yards speech, average code is about 2.3 keys, and the static repetition rate of coding of individual character is about 9%, and nearly more than 40000 phrase repeated codes are about 4.1%, and dynamically repeated code is lower than 4%, and can realize touch system, and whole proposal is succinctly efficient.
Specify feature of the present invention and embodiment below: one, the research of Chinese character pattern
The shape of Chinese character comprises two aspects, constitutes the element of Chinese character " shape " and the structural relation between these elements.From the formation unit of shape usually, the present invention regards a Chinese character by radical as forms, and radical is made of basic stroke.Chinese character ' shape ' structural relation comprise: 1) from relation; 2) continuous relation; 3). overlapping relation.Explanation respectively below:
(1), basic stroke:
Stroke is the minimum level of Chinese character pattern structure.The direction of wieling the pen when writing reduces following five kinds with it, five of promptly so-called ' letter ' words approximately:
Annotate: the stroke of carry and calculate horizontal (), count right-falling stroke (Dian), band being transferred is all calculated folding (second)
The stroke code | Horizontal (one) perpendicular (Shu) casts aside (Pie) and presses down (Dian) folding (second) H, I, P, N, V |
(2), Chinese character root:
(1), stroke structure piece relatively independent in the Chinese character and the single that can independently participate in mosaic are drawn, be defined as " radical ".
(the stroke piece is meant the basic structure form that plural stroke can constitute)
The radical detailed description definitions is as follows
Several successive from single draw to constitute one and parallelly make a radical when block
(as " three ", " six ", " heart ");
2. the bulk that several strokes join is continuously generally regarded a radical (as " sheet ") as;
3. the stroke structure piece that intersects is considered as a radical (as " thing ");
4. the continuous stroke group who forms the encirclement shape of stroke is considered as a radical (as " recessed ");
5. radical commonly used is made a radical code fetch (as " foot ").
(2), radical is the elementary cell of amalgamation Chinese character, can risk whole Chinese characters, great majority are stroke structure pieces, it is basic stroke that minority is arranged.Procedure declaration is as follows:
Stroke → radical → Chinese character
(3), the font structure of Chinese character:
(1), font structure
As mentioned above, radical is the elementary cell of amalgamation Chinese character, and basic element of character can be divided into three types according to the spatial relationship between them when forming Chinese character:
1. from relation (loosing):
Be meant exist between the radical that is combined into Chinese character obvious gap, separate relation arranged, as words such as: knot, knowledge, Lee, bright, devices.
2. relation (company) links to each other:
Be meant between the radical it is a kind of interconnective relation, but between radical, exist recessive gap each other, as: early, the man, fill, words such as Gu, cloud.
3. overlapping relation (friendship):
Be meant that it is mutual juxtapositions that several basic element of characters constitute Chinese characters, between radical, do not have the gap of separability, as: in, lining, thing, heavily wait.They itself are exactly a relatively independent individuality, should not split.
(2), Chinese character type
1, single character: claim the simplest independent Chinese character again, itself is exactly a kind of interior poly-, nondecomposable stroke structure piece.Mostly be to connect or intersect all-in-one-piece, minority is that a single is drawn and the basic element of character individual character structure that forms of adhesion mutually.As: day, the moon, water, fire, soil, in, too, word such as die young.
2, combinde rqdical character: be the Chinese character that is put together by two or more relatively independent stroke structure pieces, itself is a kind of mixed structure of decomposability.(in other words, the word that is combined by single character or independent body font is combinde rqdical character.) as: the Chinese, word, volume, sign indicating number, sing, sing, change, word such as leather.
When concrete fractionation, overlapping relation should be considered as independent body, can not be split; In, the two kinds of relations of joining, in general, join from being better than.
Had after these definition, we just can utilize the relative independentability of Chinese character root to split Chinese character.Two, the fractionation of Chinese character pattern
(1), disassembly principle:
1. split by the gap;
2. the basic stroke piece does not split.
Chinese character is put together by radical, because " assembly ", must be gapped, radical is made of stroke, because " structure ", also can be gapped.Therefore, must be distinguished the gap, the gap between radical is called external series gap; The gap that the stroke structure relation forms is called internal clearance, and external series gap is the foundation that splits, and internal clearance is the restriction condition that splits.
The fractionation rule of Chinese character is based upon on the objective law of Chinese character pattern structure, Chinese character is split possessed objectivity, also make Chinese character have expandability.
(1), split rule:
The fractionation rule comprises: the Lian Yaofen that divines by means of characters in sequential write, the word, looses, intersect not from.
1. sequential write: promptly Chinese character splits with the radical code fetch and is all undertaken by normal sequential write.
Example: the Chinese (Rui, again); Type (open, Dao, soil)
2. divine by means of characters in the word: in a Chinese character,, should split code fetch respectively to " word in the word " in this Chinese character one by one if comprise " word in the word (single character) ".
Example: open (bow, long); The tree (wood, again, very little)
3. Lian Yaofen looses: in a Chinese character, have a plurality of from or the radical that links to each other when accumulating in, should take them apart code fetch respectively.
From (loosing) example:
Knot (Si, scholar, mouth) does (Rolling, Tou, mouth, Jiong, mouth)
(company) example links to each other:
Ancient (ten, mouthful), man's (field, power)
4. intersect not from: every cross one another stroke piece can not be split, and is considered as single character, makes a radical when splitting code fetch and handles.
Intersect (friendship) example:
' building ' can only tear open and be (then, Yin),
And can not tear open into (Ji. two. Shu. Yin) or (Nie. two. Yin)
(2), choosing of radical:
The purpose that Chinese character splits is in order to obtain an effective radical inventory intuitively.
We divide three types to be described as follows one by one:
(1), characterized radical: be meant the stroke structure piece of the meaning of word, be called single character again.
In the most preferred embodiment of this programme, all single characters all are considered as radical and handle, Ding Yi radical like this, and everybody is familiar with, the easy identification; Tear open well in combinde rqdical character, the radical of getting is big, and the radical number that splits out is few, and code length is short, and input speed is fast.As: this, bow, wood, son, long again, standing grain, medium word are done a characterized radical and are handled.Generally be to obtain corresponding coding: middle C, people R, big T etc. by the method that the pronunciation sound is arranged.
(2), non-word radical:
Can not be meant the stroke structure piece of word, claim the independent body font again.As: Si A, Rolling F, Fu P Jie P etc., its coding generally is to obtain by pictograph.(3) O unfamiliar word root:
Three or four yards root coding, generally taking is the code taking method of " the pronunciation sound is arranged, and tone-off is got shape ".It is unique characteristics according to Chinese character root, or by its sound (ideophone, pronunciation), or by its shape (pictograph, table shape) etc., adopt shape to sound, shape to multiple rationalizing arrangements such as shapes, promptly 432 Hanzi components all are mapped on 26 English alphabet keys dexterously, specifically, vividly, image, easily learn usefulness well.(1), sound radical---the pronunciation sound is arranged: 1. generally be to get the initial of its Guangdong language phonetic for characterized radical as coding. as:
C:(becomes, and is just long, volume, and car, the river, in);
The K:(first, oneself, and, gold, the worker, bow); 2. the Guangdong language phonetic initial is generally got in the similar distortion that is produced by characterized radical, as:
S:(three, Rui San Chuan
); (2), the shape radical---tone-off is got shape: 1. utilize the plesiomorphism of English alphabet and radical, make the coding of image by its shape, as:
K:(Zhuang.
); 2. utilize letter to be associated, do abstract classification by its shape with the cabinet frame characteristic morphology, as:
T:(.
...
)。(3), special radical: 1. in order to reduce repeated code, below 13 radical pictographs preferential, do not make the sound correspondence.
(4), O unfamiliar word root:
Day, order, two, ten, the people, the mountain, stone, it, speech, the heart, foot is walked horse (animal) D, B, E, X, R, W, G, Z, I, J, Z, Z, Q |
In the radical inventory, there is the frequency of utilization of 45 radicals very low, the image correspondence is made in inconvenience again, and we are referred to as " unfamiliar word root ".In order to alleviate user's memory burden, so they are all collected in the O key.Every unfamiliar word root that runs into only needs to press the O key and gets final product, and needn't memorize mechanically.As input: (Ha once,
, day), its coding is " EOD ".Attached: O unfamiliar word root: O:(Difficult radical)
Mortar
Import 3 yards, shield on the space
1, single character:
The individual character root: root coding+the first sum of picture+end stroke, example:
' in ' (C, Shu Shu) are ' CII '
(and simplified three or four yards " in " coding be " ZII ")
2, combinde rqdical character:
Double word root: first character root+inferior radical+this word end stroke, example:
' Lee ' (wood, son, one) i.e. is ' MCH ';
(and the coding of simplified three or four yards " Lee " is " MZH ")
Three radicals: first character root+inferior radical+last radical, example:
' showing ' (king, order, youngster) i.e. be ' WBE ';
(and simplified three or four yards " show " coding be " WNE ")
The multiword root: first character root+inferior radical+last radical, example:
‘ Hair ' (X, bow, again) promptly ' XKY '.
(the input method of and simplified three or four yards " send out " coding be " OYN ") five, phrase
Three or the four yards quick input methods that are a kind of based on speech in traditional font provided by the invention, acceptance system more than 40,000 phrase phrase, almost included the various words in the daily life, convenient and swift.
Import 4 yards, go up screen automatically
1. two words: the first two sign indicating number (2+2) totally 4 yards input of all-key got in every word:
(and the coding of simplified three or four yards " Chinese character " is " SYNZ ")
2. three words: preceding two words are respectively got one yard, and the first two sign indicating number (1+1+2) totally 4 yards got in last word:
Take picture Machine (day, wood, wood, several) i.e. ' DMMK '
(and the coding of simplified three or four yards " camera " is " DMMJ ")
3. four words: one yard (1+1+1+1) totally 4 yards inputs all got in each word:
Company limited (ten, Fu, eight, second) i.e. ' XPEV '
(and the coding of simplified three or four yards " company limited " is " XPBV ")
4. multi-character words: first three word is respectively got one yard, and a yard (preceding 3 ends 1) totally 4 yards got again in last word:
<400> 10
Tyr Leu Thr Ala Arg Arg Gly Gln Gln Thr Thr Leu Gly Glu Val Val
151015
Cys
Sequence information
BASB027 polynucleotide sequences and polypeptide sequences
SEQ ID NO: 1
From strain ATCC43617 mucositis Moraxella BASB027 polynucleotide sequences
ATGCGTAATTCATATTTTAAAGGTTTTCAGGTCAGTGCAATGACAATGGCTGTCATGATG
GTAATGTCAACTCATGCACAAGCGGCGGATTTTATGGCAAATGACATTACCATCACAGGA
CTACAGCGAGTGACCATTGAAAGCTTACAAAGCGTGCTGCCGTTTCGCTTGGGTCAAGTG
GTGAGCGAAAACCAGTTGGCTGATGGTGTCAAAGCACTTTATGCAACAGGCAATTTTTCA
GATGTGCAAGTCTATCATCAAGAAGGGCGTATCATCTATCAGGTAACCGAAAGGCCGTTA
ATCGCTGAGATTAATTTTGAGGGCAATCGCTTAATTCCAAAAGAAGGTCTACAAGAAGGG
CTAAAAAATGCTGGCTTAGCTGTGGGTCAACCACTAAAACAAGCCACAGTACAGATGATC
GAAACCGAGCTTACCAATCAATATATATCACAAGGCTATTATAATACCGAAATTACTGTC
AAACAGACGATGCTTGATGGTAATCGTGTTAAGCTTGATATGACCTTTGCTGAAGGTAAA
CCTGCACGGGTGGTTGATATTAATATCATTGGCAATCAGCATTTTAGCGATGCAGATTTG
ATTGATGTGCTTGCGATTAAGGATAATAAAATCAATCCACTGTCTAAAGCTGACCGTTAT
ACTCAAGAAAAGCTGGTGACCAGTTTAGAGAATTTGCGTGCTAAATATCTCAATGCAGGG
TTTGTGCGTTTTGAGATTAAAGATGCTAAGCTTAATATTAATGAAGATAAAAACCGTATC
TTTGTTGAGATTTCATTGCATGAAGGTGAGCAATATCGCTTTGGACAGACACAGTTTTTG
GGTAATTTAACTTATACTCAAGCAGAACTTGAGGCACTGCTTAAATTCAAAGCAGAAGAA
GGGTTTTCACAAGCCATGCTTGAGCAAACAACAAACAATATCAGTACCAAATTTGGTGAC
GATGGCTATTATTATGCTCAAATCCGTCCTGTAACACGCATTAATGATGAAAGTCGTACG
GTTGATGTGGAATATTATATTGACCCTGTACACCCTGTCTATGTACGCCGTATTAATTTT
ACAGGTAACTTTAAGACCCAAGATGAAGTACTCCGTCGTGAGATGCGACAACTTGAAGGT
GCGTTGGCATCTAATCAAAAAATCCAGCTGTCTCGTGCACGCTTGATGCGGACTGGGTTT
TTTAAACATGTTACCGTTGATACTCGTCCAGTACCCAACTCACCTGATCAGGTTGATGTA
AATTTTGTGGTTGAAGAACAACCTTCAGGATCATCAACCATCGCAGCAGGCTACTCTCAA
AGTGGTGGTGTAACTTTTCAATTTGATGTTTCTCAAAATAACTTTATGGGTACAGGTAAG
CACGTCAATGCTTCGTTTTCTCGCTCTGAGACCCGTGAGGTGTATAGTTTGGGTATGACC
AACCCATACTTTACCGTAAATGGCGTCTCGCAAAGCTTGAGTGGCTACTATCGTAAAACC
AAGTATGATAACAAGAACATTAGTAATTATGTACTTGATTCTTATGGTGGCTCATTAAGC
TATGGATATCCAATTGATGAAAATCAACGCATAAGCTTTGGTCTGAATGCTGACAATACC
AAGCTTCATGGCGGTCGTTTTATGGGCATTAGTAATGTCAAGCAGCTGATGGCAGATGGT
GGCAAAATTCAAGTGGATAATAATGGCATTCCTGATTTTAAGCATGATTACACAACCTAC
AATGCCATTTTGGGGTGGAATTATTCAAGTCTAGATCGCCCTGTATTTCCAACCCAAGGC
ATGAGTCATTCTGTAGATTTGACGGTTGGTTTTGGTGATAAAACTCATCAAAAAGTGGTT
TATCAAGGCAATATCTATCGCCCATTTATCAAAAAATCAGTCTTGCGTGGATACGCCAAG
TTAGGCTATGGCAATAATTTACCATTTTATGAAAATTTCTATGCAGGCGGCTATGGTTCG
GTTCGTGGCTATGATCAATCCTCTTTGGGTCCACGCTCACAAGCCTATTTGACAGCTCGT
CGTGGTCAACAAACCACACTAGGAGAGGTTGTTGGTGGTAATGCTTTGGCAACTTTCGGC
AGTGAGCTGATTTTACCTTTGCCATTTAAAGGTGATTGGATAGATCAGGTGCGTCCAGTG
ATATTCATTGAGGGCGGTCAGGTTTTTGATACAACAGGTATGGATAAACAAACCATTGAT
TTAACCCAATTTAAAGACCCACAAGCAACAGCTGAACAAAATGCAAAAGCAGCCAATCGC
CCGCTACTAACCCAAGATAAACAGTTGCGTTATAGTGCTGGTGTTGGTGCAACTTGGTAT
ACGCCCATTGGTCCTTTATCTATTAGCTATGCCAAGCCATTGAATAAAAAACAAAATGAT
CAGACCGATACGGTACAGTTCCAGATTGGTAGTGTCTTTTAA
SEQ ID NO: 2
The SEQ ID NO: 1 polynucleotide sequence deduced mucositis BASB027 Moraxella
Polypeptide sequence
MRNSYFKGFQVSAMTMAVMMVMSTHAQAADFMANDITITGLQRVTIESLQSVLPFRLGQV
VSENQLADGVKALYATGNFSDVQVYHQEGRIIYQVTERPLIAEINFEGNRLIPKEGLQEG
LKNAGLAVGQPLKQATVQMIETELTNQYISQGYYNTEITVKQTMLDGNRVKLDMTFAEGK
PARVVDINIIGNQHFSDADLIDVLAIKDNKINPLSKADRYTQEKLVTSLENLRAKYLNAG
FVRFEIKDAKLNINEDKNRIFVEISLHEGEQYRFGQTQFLGNLTYTQAELEALLKFKAEE
GFSQAMLEQTTNNISTKFGDDGYYYAQIRPVTRINDESRTVDVEYYIDPVHPVYVRRINF
TGNFKTQDEVLRREMRQLEGALASNQKIQLSRARLMRTGFFKHVTVDTRPVPNSPDQVDV
NFVVEEQPSGSSTIAAGYSQSGGVTFQFDVSQNNFMGTGKHVNASFSRSETREVYSLGMT
NPYFTVNGVSQSLSGYYRKTKYDNKNISNYVLDSYGGSLSYGYPIDENQRISFGLNADNT
KLHGGRFMGISNVKQLMADGGKIQVDNNGIPDFKHDYTTYNAILGWNYSSLDRPVFPTQG
MSHSVDLTVGFGDKTHQKVVYQGNIYRPFIKKSVLRGYAKLGYGNNLPFYENFYAGGYGS
VRGYDQSSLGPRSQAYLTARRGQQTTLGEVVGGNALATFGSELILPLPFKGDWIDQVRPV
IFIEGGQVFDTTGMDKQTIDLTQFKDPQATAEQNAKAANRPLLTQDKQLRYSAGVGATWY
TPIGPLSISYAKPLNKKQNDQTDTVQFQIGSVF
SEQ ID NO: 3
From strain ATCC43617 mucositis Moraxella BASB027 polynucleotide sequences
ATGCGTAATTCATATTTTAAAGGTTTTCAGGTCAGTGCAATGACAATGGCTGTCATGATG
GTAATGTCAACTCATGCACAAGCGGCGGATTTTATGGCAAATGACATTACCATCACAGGA
CTACAGCGAGTGACCATTGAAAGCTTACAAAGCGTGCTGCCGTTTCGCTTGGGTCAAGTG
GTGAGCGAAAACCAGTTGGCTGATGGTGTCAAAGCACTTTATGCAACAGGCAATTTTTCA
GATGTGCAAGTCTATCATCAAGAAGGGCGTATCATCTATCAGGTAACCGAAAGGCCGTTA
ATCGCTGAGATTAATTTTGAGGGCAATCGCTTAATTCCAAAAGAAGGTCTACAAGAAGGG
CTAAAAAATGCTGGCTTAGCTGTGGGTCAACCACTAAAACAAGCCACAGTACAGATGATC
GAAACCGAGCTTACCAATCAATATATATCACAAGGCTATTATAATACCGAAATTACTGTC
AAACAGACGATGCTTGATGGTAATCGTGTTAAGCTTGATATGACCTTTGCTGAAGGTAAA
CCTGCACGGGTGGTTGATATTAATATCATTGGCAATCAGCATTTTAGCGATGCAGATTTG
ATTGATGTGCTTGCGATTAAGGATAATAAAATCAATCCACTGTCTAAAGCTGACCGTTAT
ACTCAAGAAAAGCTGGTGACCAGTTTAGAGAATTTGCGTGCTAAATATCTCAATGCAGGG
TTTGTGCGTTTTGAGATTAAAGATGCTAAGCTTAATATTAATGAAGATAAAAACCGTATC
TTTGTTGAGATTTCATTGCATGAAGGTGAGCAATATCGCTTTGGACAGACACAGTTTTTG
GGTAATTTAACTTATACTCAAGCAGAACTTGAGGCACTGCTTAAATTCAAAGCAGAAGAA
GGGTTTTCACAAGCCATGCTTGAGCAAACAACAAACAATATCAGTACCAAATTTGGTGAC
GATGGCTATTATTATGCTCAAATCCGTCCTGTAACACGCATTAATGATGAAAGTCGTACG
GTTGATGTGGAATATTATATTGACCCTGTACACCCTGTCTATGTACGCCGTATTAATTTT
ACAGGTAACTTTAAGACCCAAGATGAAGTACTCCGTCGTGAGATGCGACAACTTGAAGGT
GCGTTGGCATCTAATCAAAAAATCCAGCTGTCTCGTGCACGCTTGATGCGGACTGGGTTT
TTTAAACATGTTACCGTTGATACTCGTCCAGTACCCAACTCACCTGATCAGGTTGATGTA
AATTTTGTGGTTGAAGAACAACCTTCAGGATCATCAACCATCGCAGCAGGCTACTCTCAA
AGTGGTGGTGTAACTTTTCAATTTGATGTTTCTCAAAATAACTTTATGGGTACAGGTAAG
CACGTCAATGCTTCGTTTTCTCGCTCTGAGACCCGTGAGGTGTATAGTTTGGGTATGACC
AACCCATACTTTACCGTAAATGGCGTCTCGCAAAGCTTGAGTGGCTACTATCGTAAAACC
AAGTATGATAACAAGAACATTAGTAATTATGTACTTGATTCTTATGGTGGCTCATTAAGC
TATGGATATCCAATTGATGAAAATCAACGCATAAGCTTTGGTCTGAATGCTGACAATACC
AAGCTTCATGGCGGTCGTTTTATGGGCATTAGTAATGTCAAGCAGCTGATGGCAGATGGT
GGCAAAATTCAAGTGGATAATAATGGCATTCCTGATTTTAAGCATGATTACACAACCTAC
AATGCCATTTTGGGGTGGAATTATTCAAGTCTAGATCGCCCTGTATTTCCAACCCAAGGC
ATGAGTCATTCTGTAGATTTGACGGTTGGTTTTGGTGATAAAACTCATCAAAAAGTGGTT
TATCAAGGCAATATCTATCGCCCATTTATCAAAAAATCAGTCTTGCGTGGATACGCCAAG
TTAGGCTATGGCAATAATTTACCATTTTATGAAAATTTCTATGCAGGCGGCTATGGTTCG
GTTCGTGGCTATGATCAATCCTCTTTGGGTCCACGCTCACAAGCCTATTTGACAGCTCGT
CGTGGTCAACAAACCACACTAGGAGAGGTTGTTGGTGGTAATGCTTTGGCAACTTTCGGC
AGTGAGCTGATTTTACCTTTGCCATTTAAAGGTGATTGGATAGATCAGGTGCGTCCAGTG
ATATTCATTGAGGGCGGTCAGGTTTTTGATACAACAGGTATGGATAAACAAACCATTGAT
TTAACCCAATTTAAAGACCCACAAGCAACAGCTGAACAAAATGCAAAAGCAGCCAATCGC
CCGCTACTAACCCAAGATAAACAGTTGCGTTATAGTGCTGGTGTTGGTGCAACTTGGTAT
ACGCCCATTGGTCCTTTATCTATTAGCTATGCCAAGCCATTGAATAAAAAACAAAATGAT
CAGACCGATACGGTACAGTTCCAGATTGGTAGTGTCTTTTAA
SEQ ID NO: 4
The SEQ ID NO: 3 polynucleotide sequence deduced mucositis BASB027 Moraxella
Polypeptide sequence
MRNSYFKGFQVSAMTMAVMMVMSTHAQAADFMANDITITGLQRVTIESLQSVLPFRLGQV
VSENQLADGVKALYATGNFSDVQVYHQEGRIIYQVTERPLIAEINFEGNRLIPKEGLQEG
LKNAGLAVGQPLKQATVQMIETELTNQYISQGYYNTEITVKQTMLDGNRVKLDMTFAEGK
PARVVDINIIGNQHFSDADLIDVLAIKDNKINPLSKADRYTQEKLVTSLENLRAKYLNAG
FVRFEIKDAKLNINEDKNRIFVEISLHEGEQYRFGQTQFLGNLTYTQAELEALLKFKAEE
GFSQAMLEQTTNNISTKFGDDGYYYAQIRPVTRINDESRTVDVEYYIDPVHPVYVRRINF
TGNFKTQDEVLRREMRQLEGALASNQKIQLSRARLMRTGFFKHVTVDTRPVPNSPDQVDV
NFVVEEQPSGSSTIAAGYSQSGGVTFQFDVSQNNFMGTGKIVNASFSRSETREVYSLGMT
NPYFTVNGVSQSLSGYYRKTKYDNKNISNYVLDSYGGSLSYGYPIDENQRISFGLNADNT
KLHGGRFMGISNVKQLMADGGKIQVDNNGIPDFKHDYTTYNAILGWNYSSLDRPVFPTQG
MSHSVDLTVGFGDKTHQKVVYQGNIYRPFIKKSVLRGYAKLGYGNNLPFYENFYAGGYGS
VRGYDQSSLGPRSQAYLTARRGQQTTLGEVVGGNALATFGSELILPLPFKGDWIDQVRPV
IFIEGGOVFDTTGMDKQTIDLTQFKDPQATAEQNAKAANRPLLTQDKQLRYSAGVGATWY
TPIGPLSISYAKPLNKKQNDQTDTVQFQIGSVF
SEQ ID NO: 5
ACT ATA GGG CAC GCG TG
SEQ ID NO: 6
CCT GCG TTT GTT TGA TTG AG
SEQ ID NO: 7
AAG GGC CCA ATT ACG CAG AGG GGA TCC ACA GGA CTA CAG CGA GTG
ACC ATT GAA AGC TTA C
SEQ ID NO: 8
AAG GGC CCA ATT ACG CAG AGG GTC GAC TTA TTA AAA GAC ACT ACC
AAT CTG GAA CTG TAC CGT ATC G
SEQ ID NO: 9
CYAKPLNKKQNDQTDT
SEQ ID NO: 10
YLTARRGQQTTLGEWC
...
(and the coding of simplified three or four yards " People's Republic of China (PRC) " is " ZRRK ") six, the consideration that realizes
In order to realize creation aim of the present invention, adopt following some technological means especially:
(1), encode Chinese characters for computer just realizes a kind of means of computer Chinese-character input, should make every effort to its coding and simplify accurately.By fractionation and statistics to each Chinese character in the national standard Chinese character library, have only the Chinese character of two radicals, three radicals to reach 80%, therefore, we have stipulated to get 3 yards rules of [first character root+inferior radical+last radical] of each Chinese character, reduced splitting the amount of redundancy of code fetch to greatest extent, and improved the input efficiency of Chinese character greatly.
(2), repeated code is handled:
The present invention's Chinese character input belongs to block code, 3 code words, 4 yards speech.If repeated code takes place, then counterweight code word speech has been done the classification processing by its practical frequency.
Generally speaking, when you imported 3 yards Chinese characters, repeated code words commonly used will make number one, and you only need can go up screen by space bar in passing, after handling like this, made the input of repeated code commonly used can not influence speed basically.
(3), about brevity code:
Be further to improve input speed, reduce repeated code, the present invention is also preferred, and more than 600 I and II brevity code word makes things convenient for the user.
In three or four code systems, all Chinese characters are display reminding in advance on presenting bank all, and the brevity code word is positioned at first of presenting bank all the time, and the user only need can realize its input by space bar in passing.Because the brevity code word all is the word that is in daily use, and do not have repeated code, and its code length is short, after the user is skilled, will improve the efficient of words input greatly.
List the mnemonic word of one-level high frequency word and encode as follows: A B C D E F G, H I J K L M N, O P Q R S T, U V W X Y Z. one in not seven or nine and my this state people's years, a day flat personnel selection is for he, on you is to exist in main month.
(4), with the comparison of simplified version (95120931.0)
" method for inputting Chinese characters by three-four codes " that this programme invention provides is to improve a kind of method for inputting Chinese characters based on speech that forms on simplified three or four yards basis, and it does not conflict with " the three four-code Chinese character input methods " of simplified edition (95120931.0):
1. simplified three or four yards 6763 simplified Hanzis that only are applicable to GB (GB) word collection; Three or four yards 13053 unsimplified Hanzis that then are applicable to (BIG5) word collection in the traditional font that this programme provides;
2. the sound radical in simplified three or four yards is the pairing coding of initial with the Chinese phonetic alphabet, and three or four yards of traditional fonts that this programme provides then are with the first alphabetic coding of Guangdong language phonetic.
3. simplified three or four yards shape radical arrangement is corresponding different with three or four yards of this programme traditional fonts;
4. the radical sum in simplified three or four yards is 398, and the radical sum that the traditional font that this programme provides is three or four yards then is 432.
Claims (4)
1, a kind of method for inputting Chinese characters by three-four codes, be used for importing any one Chinese character of 13053 unsimplified Hanzis that will comprise that the BIG5 word is concentrated, convert to by certain step and can be input to computing machine and for its encode Chinese characters for computer of discerning, described encode Chinese characters for computer set comprises English 26 letters, described certain step comprises imports the step that Chinese character resolves into several Chinese character roots with desire, in the several Chinese character roots that decomposite each is mapped to a step of one in the encode Chinese characters for computer set respectively, import the encode Chinese characters for computer that obtains one by one and arrive the step of computing machine, it is characterized in that:
Describedly wish is inputted Chinese character decomposition become the Chinese character radical of using in the step of several Chinese character radicals to comprise sound radical and shape radical, described sound radical coding is the first letter of the Guangdong language phonetic of this radical itself, described shape radical coding is generally to obtain by methods such as pictographs, has 26 groups; In the step of during each in described several Chinese character radicals that will decomposite is mapped to respectively an encode character for computer set, namely Chinese character radical group is to the following corresponding relation of being mapped with of encode character for computer: (A: watt tooth Asia ()
ㄠ township Zhao Jue), (B: an ancient type of spoon does not cling toBen Bibai third grasps Bi and foretells ()) Tony (order)), (C: seven fork zhang size Rolling rivers thousand are ended just uglyMain scold hurriedly and have Zhu of one's ownThe heavy worm of state Chuan Trucks Long), (D: tricky bad protruding red fourth () cutter (Dao) electricity(day, say)), (E: two (Bing 丷
)
Narrow eyes into a slit the sixth of the twelve Earthly Branches is), (F: fiery side husband not Pu all () Fou Fly RollingZhang ), (G: towel do the jin melon and fruit more blunt () dagger-axe (Shoot a retrievable arrow) (stone)), (H:(horizontal), mouthful mouthful lower blood is opened gas Xiangxi), (I:(Vertical) Shu, speech (Tou)
Rich 屮
Nie Then), (J: the sunset well pawl heart (Xin) Epileptic Factory ()), (K: nine works of a specified duration bows and oneself sweet huge first are asked bent card beggar (Hideaway) wide several (Few) golden Zhuang ), (L: power vertical in six officials ()
(
)
), (M: wood is end riceThe hair people penta ware female (not) literary composition (Fan notThe-Fan) Wan Door), (N:(right-falling stroke) Dian, be recessed my the Inner (Rou of five female) Http Mi Jiong), (O:(Difficult radical) totally 45 Ge), (P:(slash) Pie,Sheet Jie FuThe Yi corpse Yin), (Q: Ma Ukraine Fish ox (Niu) the Quan insect without feet or legs Pig PHP-Manual), (R: the people enters (Ren Chi )), (S: on three the few sailor Sheng Shi of four generation lose Shi Shenshengxi body thing hang down bundle () minister () little () food Rui San Chuan), (T: Da Tian East village soil (scholar) day (dying young) ), (U: Lv twenty Industry European-allies), (V:(folding) second, Si
Bao Qian Contraband), (W: the Households standing grain mutually forever () king's (ninth of the ten Heavenly Stems) Ukraine is (mountain)), (X:(ten)乂
癶
), (Y: again sword in the outstanding ball of In-particular also beautiful rain entreat the tenth of the twelve Earthly Branches Yu smooth drag a kind of monkey mentioned in ancient literature Yu mound ear by Ran Yueyong () bifurcation), (Z: walk foot ()廴
Shu) °
2, method for inputting Chinese characters by three-four codes according to claim 1 is characterized in that, desire is imported in the step that Chinese character resolves into several Chinese character roots described, follows sequential write, divine by means of characters in the word, the Lian Yaofen that looses, intersect not from following 4 rules carry out:
The Chinese character pattern decomposition is all undertaken by the sequential write of standard;
Chinese character pattern decomposes the method for pressing " divining by means of characters in the word " to carry out;
A Chinese character is being carried out font when decomposing, have a plurality of from or the radical that links to each other when accumulating in, should take them apart code fetch respectively;
When carrying out the font decomposition, every cross one another stroke structure piece can not be split, and is considered as single character, makes a Chinese character root when splitting code fetch and handles.
3, method for inputting Chinese characters by three-four codes according to claim 1 is characterized in that: 3 yards defeated words, to individual character root single character, get root coding+3 yards inputs of the first sum of picture+end stroke; To the combinde rqdical character of double word root, get first character root+inferior radical+3 yards inputs of this word end stroke; To three radicals or multiword root, should get the totally 3 yards inputs of first character root+inferior radical+last radical.
4, method for inputting Chinese characters by three-four codes according to claim 1, its feature also is: 4 yards defeated speech.For two words, the first two yard composition totally 4 yards inputs of all-key got in every word; To three words, preceding two words are respectively got first yard, last word and are got the totally 4 yards inputs of the first two yard composition; To four words or multi-character words, the totally 4 yards inputs of first yard composition all got in each word of front-three-end-one.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN 97114253 CN1178340A (en) | 1997-09-10 | 1997-09-10 | Method for inputting Chinese characters by three-four codes |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN 97114253 CN1178340A (en) | 1997-09-10 | 1997-09-10 | Method for inputting Chinese characters by three-four codes |
Publications (1)
Publication Number | Publication Date |
---|---|
CN1178340A true CN1178340A (en) | 1998-04-08 |
Family
ID=5172827
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN 97114253 Pending CN1178340A (en) | 1997-09-10 | 1997-09-10 | Method for inputting Chinese characters by three-four codes |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN1178340A (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1293451C (en) * | 2004-11-10 | 2007-01-03 | 刘卓梁 | Chinese character input method through fonts and phonics by three strokes |
CN101308406B (en) * | 2008-05-16 | 2010-06-09 | 李平 | Method for inputting Chinese-traditional characters by computer large keyboard using sound-notating alphabet |
CN102722262A (en) * | 2012-05-28 | 2012-10-10 | 秦一明 | Keyboard inputting method capable of thoroughly solving problems of keyin, storage and retrieval for all Chinese characters |
-
1997
- 1997-09-10 CN CN 97114253 patent/CN1178340A/en active Pending
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1293451C (en) * | 2004-11-10 | 2007-01-03 | 刘卓梁 | Chinese character input method through fonts and phonics by three strokes |
CN101308406B (en) * | 2008-05-16 | 2010-06-09 | 李平 | Method for inputting Chinese-traditional characters by computer large keyboard using sound-notating alphabet |
CN102722262A (en) * | 2012-05-28 | 2012-10-10 | 秦一明 | Keyboard inputting method capable of thoroughly solving problems of keyin, storage and retrieval for all Chinese characters |
CN102722262B (en) * | 2012-05-28 | 2015-06-24 | 秦一明 | Keyboard inputting method capable of thoroughly solving problems of keyin, storage and retrieval for all Chinese characters |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN1178340A (en) | Method for inputting Chinese characters by three-four codes | |
CN1101569C (en) | Syllable symbol code Chinese character input method and its keyboard | |
CN1267807C (en) | Chinese charactor input method by Chinese character and redical pronunciation code | |
CN1184554C (en) | Chinese character Hanyi code input method and keyboard for computer | |
CN1159892C (en) | Pictographic digital Chinese character encoding method and input keyboard | |
CN100339806C (en) | Chinese character three-code input method | |
CN1201219C (en) | Modular Chinese character part code input method and its common keyboard | |
CN1825254A (en) | Chinese character inputting method and computer keyboard therefor | |
CN1082216A (en) | The Chinese-character word-phrase encode method and the keyboard of the input of fast-three-code, non-repeated codes phonetic | |
CN1159638C (en) | Computer with 60 keys and six-stroke and twelve-form Chinese character code | |
CN1162766C (en) | Chinese-character 'pronunciation-shape code' input method and its keyboard profile | |
CN1279427C (en) | Multidimensional Chinese character encoding input method | |
CN1055554C (en) | Nadical spelling standarded code Chinese character input method | |
CN1130771A (en) | Chinese character real code coding method and its keyboard | |
CN1127682C (en) | Zero-stroke easy code input method | |
CN1347023A (en) | Intelligent two-stroke handwriting input system | |
CN1553305A (en) | Phonetical and shape four-digit code Chinese inputting method | |
CN1456964A (en) | Shape-phonetical Chinese character input method | |
CN1272692C (en) | Regular convenient Chinese character computer input method and its keyboard | |
CN1269010C (en) | Chinese bit coding keyboard inputting method | |
CN1873590A (en) | Method of three key codes for inputting Chinese characters | |
CN1105963C (en) | Five-stroke parts input method and its keyboard | |
CN1252553A (en) | Eight Diagrams code method for for Chinese character input | |
CN1142479C (en) | Chinese-character dual-structure five-stroke input method by universal numeral keypad | |
CN1074558C (en) | Tianpan echoism Chinese character input method |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C02 | Deemed withdrawal of patent application after publication (patent law 2001) | ||
WD01 | Invention patent application deemed withdrawn after publication |