CN114159352A - Bacteriostatic and itching-relieving foam shampoo - Google Patents
Bacteriostatic and itching-relieving foam shampoo Download PDFInfo
- Publication number
- CN114159352A CN114159352A CN202111545239.3A CN202111545239A CN114159352A CN 114159352 A CN114159352 A CN 114159352A CN 202111545239 A CN202111545239 A CN 202111545239A CN 114159352 A CN114159352 A CN 114159352A
- Authority
- CN
- China
- Prior art keywords
- parts
- foam
- hair
- shampoo
- scalp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/92—Oils, fats or waxes; Derivatives thereof, e.g. hydrogenation products thereof
- A61K8/922—Oils, fats or waxes; Derivatives thereof, e.g. hydrogenation products thereof of vegetable origin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/33—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing oxygen
- A61K8/34—Alcohols
- A61K8/345—Alcohols containing more than one hydroxy group
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/40—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing nitrogen
- A61K8/44—Aminocarboxylic acids or derivatives thereof, e.g. aminocarboxylic acids containing sulfur; Salts; Esters or N-acylated derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
- A61K8/645—Proteins of vegetable origin; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/72—Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds
- A61K8/73—Polysaccharides
- A61K8/731—Cellulose; Quaternized cellulose derivatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/72—Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds
- A61K8/81—Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds obtained by reactions involving only carbon-to-carbon unsaturated bonds
- A61K8/817—Compositions of homopolymers or copolymers of compounds having one or more unsaturated aliphatic radicals, each having only one carbon-to-carbon double bond, and at least one being terminated by a single or double bond to nitrogen or by a heterocyclic ring containing nitrogen; Compositions or derivatives of such polymers, e.g. vinylimidazol, vinylcaprolactame, allylamines (Polyquaternium 6)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/72—Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds
- A61K8/84—Cosmetics or similar toiletry preparations characterised by the composition containing organic macromolecular compounds obtained by reactions otherwise than those involving only carbon-carbon unsaturated bonds
- A61K8/86—Polyethers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/96—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution
- A61K8/97—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution from algae, fungi, lichens or plants; from derivatives thereof
- A61K8/9783—Angiosperms [Magnoliophyta]
- A61K8/9789—Magnoliopsida [dicotyledons]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/96—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution
- A61K8/97—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution from algae, fungi, lichens or plants; from derivatives thereof
- A61K8/9783—Angiosperms [Magnoliophyta]
- A61K8/9794—Liliopsida [monocotyledons]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
- A61Q17/005—Antimicrobial preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q5/00—Preparations for care of the hair
- A61Q5/006—Antidandruff preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q5/00—Preparations for care of the hair
- A61Q5/02—Preparations for cleaning the hair
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2800/00—Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
- A61K2800/40—Chemical, physico-chemical or functional or structural properties of particular ingredients
- A61K2800/56—Compounds, absorbed onto or entrapped into a solid carrier, e.g. encapsulated perfumes, inclusion compounds, sustained release forms
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2800/00—Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
- A61K2800/40—Chemical, physico-chemical or functional or structural properties of particular ingredients
- A61K2800/59—Mixtures
- A61K2800/592—Mixtures of compounds complementing their respective functions
- A61K2800/5922—At least two compounds being classified in the same subclass of A61K8/18
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2800/00—Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
- A61K2800/40—Chemical, physico-chemical or functional or structural properties of particular ingredients
- A61K2800/59—Mixtures
- A61K2800/596—Mixtures of surface active compounds
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Birds (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Botany (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Chemical & Material Sciences (AREA)
- Emergency Medicine (AREA)
- Dermatology (AREA)
- Cosmetics (AREA)
Abstract
The invention discloses a bacteriostatic itching-relieving foam shampoo which is prepared from the following raw materials in parts by weight: 1-10 parts of cationic polymer, 15-30 parts of anionic surfactant, 20-30 parts of amphoteric surfactant, 1-5 parts of thickener, 1-10 parts of humectant, 0.1-1 part of chelating agent, 0.1-1 part of glycolic acid, 5-10 parts of antibacterial compound, 5-10 parts of fragrance sustained-release microcapsule, a proper amount of aromatizing agent, pH regulator and deionized water, wherein the pH value range is 5.0-7.0, the fragrance sustained-release microcapsule is applied to hair in a foam form through a foam generating device, manual massage and foaming are not needed, the antibacterial compound can be more fully and uniformly contacted with scalp and hair, the antibacterial effect is maximally exerted, the symptoms such as excessive sebum secretion, scalp pruritus and the like are effectively relieved, and the phenomenon that the local concentration of the antibacterial compound is too high and the scalp is stimulated is avoided; the antibacterial compound is arranged to inhibit malassezia and bacteria, the fragrance slow-release microcapsule is arranged to realize long-acting fragrance release, and the problem that excessive sebum secretion causes smelly oil smell of hair is solved.
Description
Technical Field
The invention relates to a shampoo, and in particular relates to a foam shampoo with functions of bacteriostasis and itching relieving.
Background
Shampoo is an indispensable daily product in life, and has a wide variety in the market, so that the shampoo meets the most basic cleaning requirement and also focuses on the maintenance of hair quality and scalp. Malassezia can cause problems of hair inflammation, dandruff, excessive sebum secretion and the like, tinea capitis balance is damaged, harmful bacteria are bred in large quantity, and imbalance of hair oil and metabolism can be caused if the tinea capitis balance is not prevented, so that the whole scalp state is disordered, and the health condition of the scalp is seriously damaged; moreover, excessive sebum secretion can cause the hair to quickly generate odor oil after being washed, which is not beneficial to personal image and social interaction, and the odor oil cannot be covered because the odor oil is quickly volatilized and dissipated due to exposure to air when only an aromatizer is simply added into the shampoo.
Disclosure of Invention
Aiming at the problems in the related art, the invention provides a bacteriostatic itching-relieving foam shampoo, which aims to overcome the technical problems in the prior related art.
The technical scheme of the invention is realized as follows:
a bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the foaming shampoo has a pH value ranging from 5.0 to 7.0, and is applied to the hair in the form of foam by a foam generating means.
The anionic surfactant provides cleaning and foaming capabilities for the shampoo, and the shampoo can generate abundant foam by matching with a foam generating device, so that the contact of the antibacterial compound with the scalp and the hair is more sufficient.
The hair is washed to enable the hair to have negative charges, the cationic polymer can form a coacervate to deposit and attach on the surface of the hair, the negative charges are neutralized, the repulsion between the hair is reduced, the hair is smoother, and meanwhile, the fragrance slow-release microcapsules are entrained by the coacervate or attach on the hair by self, so that the fragrance can be continuously emitted after the hair is washed.
The malassezia can cause scalp problems such as inflammation, pruritus and excessive sebum secretion, so that the bacteriostatic compound is arranged to inhibit the malassezia, and the excessive sebum secretion can cause the problem that the hair quickly generates smelly oil after being cleaned, and the problem is solved by arranging the fragrance slow-release microcapsule, so that the fragrance can be slowly released, and the function of covering the smelly oil for a long time is realized; on the other hand, the antibacterial compound is directly applied to the hair in a foam form, manual massage and foaming are not needed, the antibacterial compound can be more fully and uniformly contacted with the scalp and the hair, the antibacterial effect is maximally exerted, the symptoms such as excessive sebum secretion and scalp pruritus are effectively relieved, and the scalp is prevented from being stimulated due to overhigh local concentration of the antibacterial compound.
The scalp diseases are mainly caused by malassezia, but the manifestation and development of symptoms are the result of the combined action of various bacteria and malassezia, and most of the existing shampoos for improving the scalp symptoms mainly adopt a designed surfactant system, have single bacteriostatic component and have limited effect of improving the scalp symptoms.
According to the antibacterial compound, shell micro powder which is formed into a loose porous structure through high-temperature calcination is used as a carrier, antibacterial polypeptide and a traditional Chinese medicine composition are loaded on the shell micro powder, the shell micro powder and the traditional Chinese medicine composition are cooperatively matched to exert the optimal antibacterial and itching relieving effects, the shell micro powder can release calcium ions to achieve the antibacterial effect, the antibacterial polypeptide has the advantages that the antibacterial effect is good, bacteria and fungi cannot generate drug resistance, the antibacterial polypeptide can form an ion channel on a cell membrane of pathogenic bacteria, at the moment, the shell micro powder releases the calcium ions outwards, a high-calcium ion environment is formed outside the cell membrane of the pathogenic bacteria, and then the high-calcium ion environment enters the cell membrane of the pathogenic bacteria to unbalance the calcium ions in the cells, disorder the cell metabolism and lose the viability; on the other hand, the effect of killing and inhibiting bacteria on improving the overall environment of the scalp is limited, so the traditional Chinese medicine composition provided by the invention has a bacteriostatic effect and can effectively improve the microcirculation of the scalp.
Specifically, the reason why the shell micro powder is selected is that: firstly, the shell micro powder has a loose, porous and multi-fold structure after being calcined at high temperature, so that the antibacterial polypeptide, the traditional Chinese medicine composition and the loading capacity are guaranteed; and secondly, even if the user operates improperly after using the method and does not wash the hair, the porous structure of the shell micro powder can not cause hair follicle blockage, but can be adhered to the scalp to continuously release calcium ions, so that the long-acting antibacterial effect is realized. Further, the particle size of the shell micro powder is preferably 8 to 12 μm.
Although all the antibacterial polypeptides have the bactericidal effect (generally refer to bacteria), not all the antibacterial polypeptides have the inhibitory effect on fungi (malassezia is a kind of fungi), the antibacterial polypeptides adopted by the invention are tea tree defensins, the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQSHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRR CFCTKHC, the broad-spectrum antibacterial effect is achieved, meanwhile, the antibacterial polypeptides also have the inhibitory effect on the malassezia, and the pertinence to scalp pathogenic bacteria is stronger.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 8-12 parts of turmeric, 8-15 parts of radix sophorae flavescentis, 8-10 parts of coral ginger, 1-2 parts of folium artemisiae argyi, 3-5 parts of rhizoma paridis, 3-8 parts of purslane, 3-5 parts of solidago decurrens, 8-12 parts of pseudo-ginseng, 3-5 parts of perfoliate knotweed herb, 2-5 parts of chenopodium ambrosioides, 3-5 parts of divaricate saposhnikovia root, 3-7 parts of gynostemma pentaphylla and 1-2 parts of fructus cnidii, and the raw materials are extracted by ethanol. The traditional Chinese medicine composition has a broad-spectrum antibacterial effect, has a certain inhibiting effect on malassezia, and has the main effects of making up the problem that the antibacterial polypeptide cannot improve the microcirculation of the scalp, promoting the metabolism of scalp cells, smoothing hair follicles, reducing the diameter of sebaceous glands and further reducing the secretion of grease.
Curcumin and radix sophorae flavescentis are used as monarch drugs, and the curcumin and radix sophorae flavescentis have remarkable effects of resisting oxidation, resisting bacteria, diminishing inflammation, killing insects and reducing fat; matched with coral ginger, pseudo-ginseng and polygonum perfoliatum which have the functions of dispelling cold, expelling wind, removing blood stasis and stopping bleeding as ministerial drugs; assisting with swelling and pain relieving, heat-clearing and detoxifying rhizoma paridis and goldenrod; and the chenopodium ambrosioides, the purslane, the gynostemma pentaphyllum and the fructus cnidii which have the effects of killing parasites, relieving itching, promoting blood circulation, removing blood stasis, removing dampness and relieving pain are taken as guiding drugs, and the folium artemisiae argyi which can nourish hair roots and the divaricate saposhnikovia root which has the effect of relieving pain are matched to relieve the pain of scalp inflammation, so that a reasonable traditional Chinese medicine compatibility formula is formed.
The inventor finds that the traditional Chinese medicine composition has excellent effects of inhibiting bacteria, relieving itching and reducing grease secretion on scalp, but has high irritation on scalp, can cause stabbing pain on local scalp with inflammation, and is poor in user experience, so that the inventor sprays mild vegetable oil on the surface of shell micro powder loaded with antibacterial polypeptide and traditional Chinese medicine composition, thereby reducing irritation of the traditional Chinese medicine composition on scalp.
The vegetable oil adopted by the invention is almond oil, has mild performance and certain anti-inflammatory effect, and is in accordance with the design thought of the invention. The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 0.5-1:10, the shell micro powder is put into the mixture to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to prepare the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The polypeptide sequence of the antibacterial polypeptide tea tree defensin is known, and can be synthesized by conventional chemical synthesis (liquid phase synthesis and solid phase synthesis) or biosynthesis (fermentation method, enzymolysis method, genetic engineering method and the like), the tea tree defensin is purchased in a customized mode, because the antibacterial polypeptide tea tree defensin is provided with a carrier, and can perform the functions of resisting bacteria, relieving itching and reducing oil secretion by cooperating with calcium ions and traditional Chinese medicine compositions, and the preparation method is the prior art, is not the key point of the invention, and is not repeated herein.
Further, the fragrance sustained-release microcapsules comprise a wall material and a core material, the ratio of the wall material to the core material is 1:1.5-2, the core material of the fragrance sustained-release microcapsules at least comprises essence, the essence is not specially limited, and the commercially available essence taste is selected according to the propaganda concept design of the product.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate and performing mechanical emulsification, spray drying and the like. The chitosan has unique cationic property, is beneficial to the attachment of the microcapsule to hair, and further releases a core material, the starch is used for ensuring the structural strength of the microcapsule, and the glyceryl monostearate is used as an erodible framework, so that the slow release effect of the invention is realized.
The invention also arranges glycolic acid to accelerate the metabolism speed of scalp cells, so that old waste keratinocytes around hair follicles can fall off, the hair follicles can be effectively prevented from being blocked, and hair follicle vessels can be unblocked.
Preferably, the fragrance sustained-release microcapsule also comprises plant essential oil, so that the fragrance sustained-release microcapsule not only can release fragrance for a long time, but also can release plant essential oil for nourishing and protecting hair.
Specifically, the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil, and has the functions of nourishing and protecting hair. The tea tree oil can assist in improving the sterilization and antibacterial effects of the antibacterial compound, but the pure tea tree oil is relatively irritant to the scalp with folliculitis, so that the mild almond oil is added and mixed with the pure tea tree oil, and the irritation of the tea tree oil to the scalp is reduced; the washed scalp is easy to lose water to form a dry state, and dandruff can be generated quickly, and the coconut oil has a moisturizing effect on the scalp and hair, so that the dandruff generating speed is slowed down.
Preferably, the cationic polymer is one or more of polyquaternium-7, polyquaternium-10 and polyquaternium-67 (Eimegao, USA). The polyquaternium has a plurality of cation positions and hydrocarbon chains in each molecule, can be firmly adsorbed on hair with negative charges after hair washing through the attraction of ion static electricity, so that the hydrocarbon chains with fat are remained on the surface of the cuticle of the hair, thereby having the conditioning effect and leading the hair to achieve the effects of smoothness and easy combing.
The polyquaternium-7 and the polyquaternium-10 can be well compatible with anionic surfactants and amphoteric surfactants. Compared with polyquaternium-10 and polyquaternium-7, the polyquaternium-67 has more excellent hair conditioning function, has excellent touch feeling for different hair qualities, has oleophylic property, and does not generate accumulation phenomenon, so more preferably, the cationic polymer is prepared by mixing the polyquaternium-7 polyquaternium-10 and the polyquaternium-67, and can achieve better hair conditioning effect by synergistic cooperation.
Preferably, the anionic surfactant is disodium laureth sulfosuccinate and/or sodium lauroyl sarcosinate, and has the advantages of mild performance, almost no stimulation to skin and eyes on the premise of ensuring that rich foam can be generated, capability of improving the use experience of users, excellent compounding performance and capability of compounding with various plant essential oils.
Still further, the amphoteric surfactant is disodium cocoamphodiacetate. Since the present invention is applied to the hair in the form of foam, but the foam generating means alone is not sufficient to generate a rich and stable foam, a foam stabilizing design must also be performed in the composition. The addition of the cationic polymer reacts with the anionic surfactant and the amphoteric surfactant, resulting in a decrease in the number of freely moving molecules of the two surfactants in the whole system, and thus fails to sufficiently exert their surface activities, resulting in a decrease in foam, but the smooth efficacy of the present invention is affected if the problem is solved by the decrease of the cationic polymer. The inventor finds that the synergistic combination of the disodium cocoyl amphodiacetate and one or two of disodium laureth sulfosuccinate and sodium lauroyl sarcosinate solves the problem to a certain extent, and can generate rich foam without reducing the dosage of the cationic polymer. In addition, the disodium cocoyl amphodiacetate can increase the viscosity of a system and reduce the size of generated foam, so that the shampoo provided by the invention has more dense foam, the effective ingredients fully contact with scalp and hair, and the use experience of a user is improved.
Considering that the invention is provided with a sterilization compound and a fragrance sustained-release microcapsule, in order to ensure that the two components can be uniformly distributed in the whole system, the suspension performance of the invention is particularly important, the inventor finds that disodium laureth sulfosuccinate and/or sodium lauroyl sarcosinate with a large head and a small tail molecular structure are/is mixed with disodium cocoyl amphodiacetate with a small head and a large tail molecular structure, which is beneficial to forming lamellar arrangement, namely forming a structured surfactant system, so that the invention has relatively excellent suspension performance, and further the microcapsules can be uniformly distributed in the system; the amphoteric surfactant also has the effect of reducing the irritativeness of the anionic surfactant.
Preferably, the thickener is an acrylic acid (ester) copolymer. The invention not only designs the structured surfactant to improve the suspension performance, but also arranges the acrylic acid (ester) copolymer to ensure the invention to have lasting and stable suspension property and good viscosity stability.
Preferably, the humectant is propylene glycol and/or glycerin to prevent the shampoo from carrying away excessive moisture from the scalp.
Preferably, the chelating agent is EDTA-2Na and/or EDTA, chelates alkaline earth metal ions or heavy metal ions, and softens the hardness of water.
Preferably, the pH regulator is one or more of citric acid, sodium citrate, tartaric acid and phosphoric acid, and is used for regulating acidity.
The flavoring agent is not specially limited, and is selected from commercially available essence, and can be consistent with the essence in the flavor sustained-release microcapsule or inconsistent with the essence, so that the effect of enriching flavor levels is achieved.
Preferably, the foam shampoo is prepared from the following raw materials in parts by weight:
preferably, the foam shampoo is prepared from the following raw materials in parts by weight:
preferably, the foam shampoo is prepared from the following raw materials in parts by weight:
the invention has the beneficial effects that: the anionic surfactant is arranged to provide cleaning and foaming capabilities, and the antibacterial compound can generate abundant foam by matching with a foam generating device, so that the antibacterial compound is more fully contacted with the scalp and the hair.
The cationic polymer can form a coacervate to deposit and attach on the surface of hair, neutralizes hair with negative charges after hair washing, reduces repulsion between hairs, enables the hair to be smoother, and meanwhile, the fragrance slow-release microcapsules are entrained by the coacervate or automatically attach on the hair, so that fragrance can be continuously diffused after hair washing.
The antibacterial compound is arranged to inhibit malassezia, and the fragrance slow-release microcapsules are arranged to realize long-acting fragrance release, so that the problem that excessive sebum secretion causes smelly oil smell of hair is solved; on the other hand, the antibacterial compound is directly applied to the hair in a foam form, manual massage and foaming are not needed, the antibacterial compound can be more fully and uniformly contacted with the scalp and the hair, the antibacterial effect is maximally exerted, the symptoms such as excessive sebum secretion and scalp pruritus are effectively relieved, and the scalp is prevented from being stimulated due to overhigh local concentration of the antibacterial compound.
Detailed Description
The technical solutions of the present invention will be described clearly and completely with reference to the following embodiments of the present invention, and it should be understood that the described embodiments are only a part of the embodiments of the present invention, and not all of the embodiments. All other embodiments, which can be derived by a person skilled in the art from the embodiments given herein without making any creative effort, shall fall within the protection scope of the present invention.
Example 1
A bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the pH range of the foaming shampoo was 5.0, and the foaming shampoo was applied to the hair in the form of foam through a mousse pump head.
The antibacterial compound takes shell micro powder which is formed into a loose porous structure through high-temperature calcination as a carrier, and the shell micro powder is loaded with antibacterial polypeptide and a traditional Chinese medicine composition.
The antibacterial polypeptide is tea tree defensin, and the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQ SHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRRCFCTKHC.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 8 parts of turmeric, 8 parts of radix sophorae flavescentis, 8 parts of coral ginger, 1 part of folium artemisiae argyi, 3 parts of rhizoma paridis, 3 parts of purslane, 3 parts of solidago decurrens, 8 parts of pseudo-ginseng, 3 parts of perfoliate knotweed herb, 2 parts of chenopodium ambrosioides, 3 parts of radix sileris, 3 parts of gynostemma pentaphylla and 1 part of fructus cnidii.
The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 0.5:10, the shell micro powder is put into the mixture to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to prepare the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The fragrance sustained-release microcapsules comprise a wall material and a core material, the proportion of the wall material to the core material is 1:1.5, the core material of the fragrance sustained-release microcapsules comprises essence (rosemary type) and plant essential oil, and the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil in a weight ratio of 1:2: 1.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate according to the weight ratio of 2:2:1 and adopting a mechanical emulsification method.
Example 2
A bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the pH range of the foaming shampoo was 5.5, and the foaming shampoo was applied to the hair in the form of foam through a mousse pump head.
The antibacterial compound takes shell micro powder which is formed into a loose porous structure through high-temperature calcination as a carrier, and the shell micro powder is loaded with antibacterial polypeptide and a traditional Chinese medicine composition.
The antibacterial polypeptide is tea tree defensin, and the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQ SHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRRCFCTKHC.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 9 parts of turmeric, 9 parts of radix sophorae flavescentis, 8 parts of coral ginger, 1 part of folium artemisiae argyi, 3 parts of rhizoma paridis, 4 parts of purslane, 3 parts of solidago decurrens, 9 parts of pseudo-ginseng, 3 parts of perfoliate knotweed herb, 3 parts of chenopodium ambrosioides, 3 parts of radix sileris, 4 parts of gynostemma pentaphylla and 1 part of fructus cnidii.
The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 0.6:10, the shell micro powder is put into the mixture to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to prepare the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The fragrance sustained-release microcapsules comprise a wall material and a core material, the proportion of the wall material to the core material is 1:2, the core material of the fragrance sustained-release microcapsules comprises essence (rosemary type) and plant essential oil, and the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil in a weight ratio of 1:2: 1.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate according to the weight ratio of 2:2:1 and adopting a mechanical emulsification method.
Example 3
A bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the pH range of the foaming shampoo was 6.0, and the foaming shampoo was applied to the hair in the form of foam through a mousse pump head.
The antibacterial compound takes shell micro powder which is formed into a loose porous structure through high-temperature calcination as a carrier, and the shell micro powder is loaded with antibacterial polypeptide and a traditional Chinese medicine composition.
The antibacterial polypeptide is tea tree defensin, and the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQ SHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRRCFCTKHC.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 10 parts of turmeric, 11 parts of radix sophorae flavescentis, 9 parts of coral ginger, 1.5 parts of folium artemisiae argyi, 4 parts of rhizoma paridis, 5 parts of purslane, 4 parts of solidago decurrens, 10 parts of pseudo-ginseng, 4 parts of perfoliate knotweed herb, 3 parts of chenopodium ambrosioides, 4 parts of divaricate saposhnikovia root, 5 parts of gynostemma pentaphylla and 1.5 parts of fructus cnidii.
The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 0.7:10, the shell micro powder is put into the mixture to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to prepare the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The fragrance sustained-release microcapsules comprise a wall material and a core material, the proportion of the wall material to the core material is 1:2, the core material of the fragrance sustained-release microcapsules comprises essence (rosemary type) and plant essential oil, and the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil in a weight ratio of 1:2: 1.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate according to the weight ratio of 2:2:1 and adopting a mechanical emulsification method.
Example 4
A bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the pH range of the foaming shampoo was 6.0, and the foaming shampoo was applied to the hair in the form of foam through a mousse pump head.
The antibacterial compound takes shell micro powder which is formed into a loose porous structure through high-temperature calcination as a carrier, and the shell micro powder is loaded with antibacterial polypeptide and a traditional Chinese medicine composition.
The antibacterial polypeptide is tea tree defensin, and the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQ SHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRRCFCTKHC.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 10 parts of turmeric, 12 parts of radix sophorae flavescentis, 9 parts of coral ginger, 1.5 parts of folium artemisiae argyi, 4 parts of rhizoma paridis, 6 parts of purslane, 4 parts of solidago decurrens, 10 parts of pseudo-ginseng, 4 parts of perfoliate knotweed herb, 4 parts of chenopodium ambrosioides, 4 parts of divaricate saposhnikovia root, 5 parts of gynostemma pentaphylla and 1.5 parts of fructus cnidii.
The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 0.8:10, the shell micro powder is put into the mixture to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to prepare the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The fragrance sustained-release microcapsules comprise a wall material and a core material, the proportion of the wall material to the core material is 1:2, the core material of the fragrance sustained-release microcapsules comprises essence (rosemary type) and plant essential oil, and the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil in a weight ratio of 1:2: 1.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate according to the weight ratio of 2:2:1 and adopting a mechanical emulsification method.
Example 5
A bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the pH range of the foaming shampoo was 6.5, and the foaming shampoo was applied to the hair in the form of foam through a mousse pump head.
The antibacterial compound takes shell micro powder which is formed into a loose porous structure through high-temperature calcination as a carrier, and the shell micro powder is loaded with antibacterial polypeptide and a traditional Chinese medicine composition.
The antibacterial polypeptide is tea tree defensin, and the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQ SHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRRCFCTKHC.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 11 parts of turmeric, 14 parts of radix sophorae flavescentis, 10 parts of coral ginger, 2 parts of folium artemisiae argyi, 5 parts of rhizoma paridis, 7 parts of purslane, 5 parts of solidago decurrens, 11 parts of pseudo-ginseng, 5 parts of perfoliate knotweed herb, 4 parts of chenopodium ambrosioides, 5 parts of radix sileris, 6 parts of gynostemma pentaphylla and 2 parts of fructus cnidii.
The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 0.9:10, the shell micro powder is put into the mixture to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to prepare the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The fragrance sustained-release microcapsules comprise a wall material and a core material, the proportion of the wall material to the core material is 1:2, the core material of the fragrance sustained-release microcapsules comprises essence (rosemary type) and plant essential oil, and the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil in a weight ratio of 1:2: 1.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate according to the weight ratio of 2:2:1 and adopting a mechanical emulsification method.
Example 6
A bacteriostatic itching-relieving foam shampoo is prepared from the following raw materials in parts by weight:
the pH range of the foaming shampoo was 7.0, and the foaming shampoo was applied to the hair in the form of foam through a mousse pump head.
The antibacterial compound takes shell micro powder which is formed into a loose porous structure through high-temperature calcination as a carrier, and the shell micro powder is loaded with antibacterial polypeptide and a traditional Chinese medicine composition.
The antibacterial polypeptide is tea tree defensin, and the polypeptide sequence is MGRSVSFVSTILVVLMLLLVTEMGSGPNGMVAEARTCESQSHKFKGPCVSSTNCGSVCKTEGFTGGNCRGFRRRCFCTKHC.
The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 12 parts of turmeric, 15 parts of radix sophorae flavescentis, 10 parts of coral ginger, 2 parts of folium artemisiae argyi, 5 parts of rhizoma paridis, 8 parts of purslane, 5 parts of solidago decurrens, 12 parts of pseudo-ginseng, 5 parts of perfoliate knotweed herb, 5 parts of chenopodium ambrosioides, 5 parts of radix sileris, 7 parts of gynostemma pentaphylla and 2 parts of fructus cnidii.
The antibacterial polypeptide and the traditional Chinese medicine composition are uniformly mixed according to the weight ratio of 1:10, the shell micro powder is placed to be adsorbed to be balanced, the mixture is dried at low temperature, almond oil is sprayed on the surface of the shell micro powder, the mixture is dried at low temperature to obtain the antibacterial compound, and the antibacterial compound is uniformly mixed with other components according to the set weight part.
The fragrance sustained-release microcapsules comprise a wall material and a core material, the proportion of the wall material to the core material is 1:1.5, the core material of the fragrance sustained-release microcapsules comprises essence (rosemary type) and plant essential oil, and the plant essential oil is prepared by mixing tea tree oil, almond oil and coconut oil in a weight ratio of 1:2: 1.
The wall material is prepared by mixing chitosan, starch and glyceryl monostearate according to the weight ratio of 2:2:1 and adopting a mechanical emulsification method.
It should be noted that all of the exemplary suspending agents used are acrylic copolymers sold by east stamen chemical Co., Ltd, Guangzhou, and that, for the particular choice, only the suspending agents sold by this company in combination with the surfactant system of the present invention achieve a uniform distribution of the two microcapsules throughout the system. The others are all conventional raw materials which are purchased from the market.
Viscosity test:
examples 1-6 were left at room temperature 25 ℃ for 24 hours for viscosity testing. Using an instrument: NDJ-8S type viscometer; and (3) testing conditions are as follows: the stable viscosity data were read after 0.5 minute rotation using rotor No. 4 at 30rpm and the test results were as follows:
examples | 1 | 2 | 3 | 4 | 5 | 6 |
Viscosity of the oil | 8430 | 8210 | 7730 | 7450 | 6620 | 6490 |
(II) stability test:
the hair rinse compositions of examples 1-6 were stored at 50 ℃ for 1 month, at 25 ℃ for 1 month, at-15 ℃ for 1 month, and under sunlight for one month, and returned to room temperature for appearance observation, with test results: in examples 1 to 6, no delamination occurred and foaming was normal.
(III) bacteriostasis test:
1. 20g of each of examples 1 to 6 were weighed and added to the suspension mixed with Malassezia (2.0X 10)6cfu/g), fully and uniformly shaking, and culturing at the temperature of 35-37 ℃;
samples were taken on days 0, 7, 14, 21 and 28 after inoculation and the number of microorganisms was determined by plate counting. The determination criteria were that Malassezia did not appear on days 7, 14, 21, and 28.
2. Reference is made to the American society for cosmetics, perfumes, and detergents (CTFA) recommended preservative challenge standards and their recommended test strains.
20g of each of examples 1 to 6 were weighed and added to the suspension mixed with the test bacteria (3.0X 10)7cfu/g), fully and uniformly shaking, and culturing at the temperature of 35-37 ℃; 20g of each of examples 1 to 6 were weighed out and added to the suspension mixed with the mold to be tested (5.0X 10)5cfu/g), fully and uniformly shaking, and culturing at the temperature of 27-29 ℃;
samples were taken on days 0, 7, 14, 21 and 28 after inoculation and the number of microorganisms was determined by plate counting. The determination criterion was that the total number of mixed bacterial colonies was reduced by 99.9% on day 7, while continuing to decrease on days 14, 21, and 28, and no mold was present on days 7, 14, 21, and 28.
The results of the bacteriostatic test are shown in the following table:
(IV) sensory evaluation:
1. screening 90 volunteers aged 18-50 years and having different degrees of scalp pruritus and seborrheic dermatitis;
2. dividing the volunteers into 6 groups, respectively testing examples 1-6, wherein each group comprises different age groups and sexes, and detecting and recording the scalp state of each volunteer through a skin mirror;
3. each volunteer was asked to wash their hair every 2 days, and the scalp itching level, oil secretion, fragrance release were fed back every three days for 3 weeks.
After 4.3 weeks, the scalp state of each volunteer was again recorded by examination with a dermoscope, and thus, whether the scalp state was improved or not was judged.
The results show that examples 1-6 have different degrees of improvement effects on the scalp states of 87 volunteers, so that the problems of scalp pruritus and seborrheic dermatitis are greatly improved, and meanwhile, all the volunteers show the effects of long-acting fragrance release and smooth and easy hair combing.
It should be noted that for pathological diseases of the scalp, the patient should go to a hospital for examination and be in compliance with medical advice.
Variations and modifications to the above-described embodiments may occur to those skilled in the art, which fall within the scope and spirit of the above description. Therefore, the present invention is not limited to the specific embodiments disclosed and described above, and some modifications and variations of the present invention should fall within the scope of the claims of the present invention. Furthermore, although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
Claims (10)
2. The foam shampoo of claim 1 wherein the cationic polymer is one or more of polyquaternium-7, polyquaternium-10, and polyquaternium-67.
3. The foam shampoo of claim 1 wherein the flavor-extended microcapsules further comprise a plant essential oil.
4. The foam shampoo according to claim 3 wherein the anionic surfactant is disodium laureth sulfosuccinate and/or sodium lauroyl sarcosinate.
5. The foam shampoo of claim 4 wherein the amphoteric surfactant is disodium cocoamphodiacetate.
6. The foam shampoo of claim 5 wherein the thickener is an acrylic acid (ester) copolymer.
7. The foam shampoo according to any one of claims 1 to 6, characterized in that the humectant is propylene glycol and/or glycerin, the chelating agent is EDTA-2Na and/or EDTA, and the pH regulator is one or more of citric acid, sodium citrate, tartaric acid and phosphoric acid.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202111545239.3A CN114159352A (en) | 2021-12-16 | 2021-12-16 | Bacteriostatic and itching-relieving foam shampoo |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202111545239.3A CN114159352A (en) | 2021-12-16 | 2021-12-16 | Bacteriostatic and itching-relieving foam shampoo |
Publications (1)
Publication Number | Publication Date |
---|---|
CN114159352A true CN114159352A (en) | 2022-03-11 |
Family
ID=80487034
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202111545239.3A Pending CN114159352A (en) | 2021-12-16 | 2021-12-16 | Bacteriostatic and itching-relieving foam shampoo |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN114159352A (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101269175A (en) * | 2008-05-20 | 2008-09-24 | 杨文龙 | Quality control method for comfortable wash liquid for hemorrhoids |
CN104940887A (en) * | 2015-07-20 | 2015-09-30 | 任明 | Application of drug combination |
CN112675119A (en) * | 2021-01-09 | 2021-04-20 | 合肥贝壳派创新科技有限公司 | Antibacterial infant wash-free bubble hand sanitizer and preparation method thereof |
-
2021
- 2021-12-16 CN CN202111545239.3A patent/CN114159352A/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101269175A (en) * | 2008-05-20 | 2008-09-24 | 杨文龙 | Quality control method for comfortable wash liquid for hemorrhoids |
CN104940887A (en) * | 2015-07-20 | 2015-09-30 | 任明 | Application of drug combination |
CN112675119A (en) * | 2021-01-09 | 2021-04-20 | 合肥贝壳派创新科技有限公司 | Antibacterial infant wash-free bubble hand sanitizer and preparation method thereof |
Non-Patent Citations (2)
Title |
---|
广州温雅日用化妆品有限公司: "彩吧控油清爽洗发泡沫", pages 2, Retrieved from the Internet <URL:https://hzpba.nmpa.gov.cn/gccx/chakan.html?prodId=976114307987144704&gb=G> * |
广州温雅日用化妆品有限公司: "神州草本生姜洗发泡沫", pages 2, Retrieved from the Internet <URL:https://hzpba.nmpa.gov.cn/gccx/chakan.html?prodId=969984086208675840&gb=G> * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN102697670B (en) | Foaming agent type shampoo | |
CN105748354B (en) | A kind of facial mask liquid and preparation method thereof | |
CN102697668B (en) | Hair washing method of foaming agent type shampoo | |
CN112656732B (en) | Dandruff-removing and itching-relieving shampoo and preparation method thereof | |
CN110934783B (en) | Dandruff-removing and itching-relieving composition containing Chinese herbal medicines, silicone oil-free amino acid shampoo containing composition, and preparation method and application of silicone oil-free amino acid shampoo | |
KR101509608B1 (en) | Composition for improving scalp and hair condition | |
CN106074315A (en) | A kind of facial mask liquid with multiple skin-care effect and preparation method thereof | |
CN103520053B (en) | Hair and body bathing powder | |
CN112754985A (en) | Composition containing bacillus fermentation product and shampoo containing composition | |
CN109431912B (en) | Skin oil balancing composition and application thereof | |
CN111265439A (en) | Oil-control, dandruff-removing and itching-relieving shampoo and preparation method thereof | |
CN107998028A (en) | A kind of shower cream and preparation method thereof | |
CN107308057B (en) | Nontoxic hair softening cream capable of softening and nourishing hair and preparation method thereof | |
CN113171329A (en) | Plant multi-effect anti-hair loss hair-growing hair-nourishing compound composition and preparation method thereof | |
CN110974771A (en) | Scalp care composition and application thereof | |
US20200397689A1 (en) | Compositions and methods for hair and scalp treatment | |
CN105327339A (en) | Chitosan gel particle lotion and preparation method thereof | |
CN105434232A (en) | Shampoo containing folium artemisiae argyi and having anti-itch effect | |
CN116509774B (en) | Anti-dandruff shampoo preparation containing sweet wormwood herb extract and preparation method thereof | |
CN112618463A (en) | Bacteriostatic skin-care bath foam containing traditional Chinese medicine extract | |
CN109620758B (en) | Double-layer scalp care composition and preparation method thereof | |
CN114159352A (en) | Bacteriostatic and itching-relieving foam shampoo | |
CN108158921B (en) | Plant composition containing tea bran and rosemary as well as preparation method and application of plant composition | |
CN108553384B (en) | Hair-care shampoo | |
CN114099386A (en) | Bacteriostatic and fragrance-releasing foam shampoo |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |