CN111388374B - Shampoo - Google Patents

Abstract

The invention provides a bactericidal shampoo which contains specific bactericidal peptide. The shampoo disclosed by the invention is safe and effective, has the effects of resisting bacteria, sterilizing, relieving itching, effectively relieving scalp pruritus, promoting the propagation of scalp bacteria, increasing the moisture of the scalp, and is low in irritation and free from causing anaphylactic reaction.

Description

Shampoo

Technical Field

The invention relates to the field of bathing, in particular to a shampoo.

Background

With the improvement of the living standard of people, the consumption concept of people is changing continuously, which not only is embodied in skin care, but also is embodied in hair washing and hair care. From the market scale, the market scale of the Chinese hair washing and hair care industry is in a stable growth trend in recent years, the market scale reaches 511 million yuan in 2017, and the market scale of the Chinese hair washing and hair care industry is estimated to be about 549 million yuan in 2018.

The high-end washing and caring market becomes a new current competitive trend, the 'silicone oil-free' middle-end washing and caring suit is launched in the field of outsourced Jutoubaojie and union Li Hua disputes, and some domestic high-end washing and caring brands are also successively made to appear. In recent years, the high-end market proportion of the Chinese hair washing and hair care industry is improved year by year, and the high-end market proportion of the hair washing and hair care industry in 2018 is predicted to reach 10.7 percent. At present, the competition of the hair washing and care market in China has been promoted to various levels such as brands, channels and the like from the product level, and the hair washing and care industry in China can be roughly divided into three large forms: baojie company occupies the dominance in China hair washing and protecting market, and \40638lowerfour brands of Piaorou, Panting, Shaxuan, Haifeisi and Qingyang, Lishi and Shashilian under the combination Lihua flag form the first army group in China hair washing and protecting market; shifen of Huawang company, Shulei of Sibao group and the like occupy the second army; most domestic brands such as Haodi, Aunie, Rafang, Dihuazhixiu, Berlisi, etc. are in the third army. It follows that there is a long way for domestic brands to go.

Frizzy hair, greasy hair, scurf, split hair and dry hair are five main puzzlement factors of the existing hair-beautifying problem. The causes of these hair problems include air pollution, excessive staying up, high working pressure, frequent hair dyeing and perming, poor hair care habits, improper use of hair styling products, etc. In particular, the scalp is often disturbed by fungi and bacteria leading to problems with the scalp.

CN104825357A discloses a compound plant component shampoo for killing bacteria and mites, which comprises the following components, by mass, deionized water, fatty alcohol sodium sulfate, alkylolamide, coconut oil fatty acid monoethanolamide, ethylene glycol distearate, cocamidopropyl betaine, guar gum hydroxypropyl trimethyl ammonium oxide, zinc pyrithione, cationic cellulose, citric acid, hyaluronic acid, isothiazoline ketone, essence and compound plant mite-inhibiting essential oil. But the bactericidal effect is not particularly remarkable through verification, and the components are complex and require special essential oil.

CN109172494A discloses a sterilizing and itching-relieving aloe shampoo and a preparation process thereof, the shampoo is prepared by taking aloe barbadensis leaf extract, allantoin, panthenol, aminoterminal polydimethylsiloxane and ethylene diamine tetraacetic acid disodium as B components and compounding with an auxiliary agent. The aloe vera leaf extract is added to reduce and inhibit the development and the reproduction of pathogens, and fully utilizes the nutrition, the moistening, the whitening and the freckle removing effects of aloe polysaccharide and vitamins on human skin. Similarly, the aloe leaf extract can only play a role in inhibiting and cannot well kill fungi on the scalp, and the inhibiting effect needs to be further improved.

Based on the drawbacks of the prior art, it is an urgent need in the art to provide a shampoo with improved capability of killing harmful microorganisms on the scalp.

Disclosure of Invention

The present invention improves upon the prior art in order to overcome the deficiencies of the prior art.

The invention provides a shampoo with a bactericidal effect, and the specific preparation method comprises the following steps:

(1) adding deionized water into a vacuum homogenizing emulsifying preparation pot, starting stirring, mixing carbomer 1.0-2.0% with water, and stirring to fully disperse carbomer; adding 0.03-0.06% of tetrasodium EDTA, 10.0-12.0% of lauryl glucoside, 6.0-9.0% of decyl glucoside, 6.0-9.0% of sodium lauroamphoacetate and 4.0-6.0% of cocamidopropyl betaine in turn under stirring, heating and mixing under stirring to 80 ℃, adding 2.0-4.0% of cocamide MEA, 1-3% of glycerol, 1-1.5% of ethylene glycol distearate, 0.2-0.4% of cetyl alcohol, 0.5-1.0% of PEG-150 distearate, 0.2-0.5% of chitosan, 0.2-0.5% of hydroxypropyl trimethyl chloride starch, 1.0-2.0% of butanediol, 210.5-1.0% of polysorbate and 0.2-0.5% of octyldodecanol in turn under stirring, keeping the temperature at 80 ℃ for 40-50 minutes, fully stirring and dissolving evenly.

(2) Cooling the materials in the pot to 45 ℃, then adding 3-5% of hydrolyzed wheat protein and 3-5% of black sesame extract, 3-8% of hyaluronic acid and 1-5% of citric acid in sequence, stirring for about 30 minutes, vacuumizing, homogenizing for 4-5 minutes, and fully and uniformly mixing.

(3) Cooling the materials in the pot to 40 ℃, adding 0.5% of cecropin and 0.5% -1% of sunflower seed oil, adjusting viscosity by sodium chloride, and stirring for 30-40 minutes to completely and uniformly mix the materials;

(4) and then cooling the materials in the pan to 30 ℃, then sampling and taking sensory and physicochemical indexes according to QB/T2660: and (5) detecting the appearance, viscosity, smell and pH value, and discharging to obtain a semi-finished product when the product is qualified.

(5) Standing for 24 hr, sampling, testing by QB/T2660, and packaging to obtain shampoo.

Further to the present invention, the black sesame extract and wheat hydrolyzed protein are commercially available products well known in the art.

Furthermore, the cecropin is a cecropin with better bactericidal property developed by the inventor in the previous period, and can cause thalli to be killed by increasing the cell membrane permeability, and the sequence of the cecropin is as follows: SGDEHLGRNSYCQWTSSQWTQSLYFAAMRFPRLFIVDHY is added.

Further, black sesame extract, LMAI Bio, cat No.: LM1398, Shanghai Lianmai bioengineering, Inc. Wheat protein hydrolysate, CAS:70084-87-6, Shenzhen Sendi Biotech limited.

Furthermore, the invention provides a shampoo, which comprises the following components: carbomer 1.0%, hyaluronic acid 3%, citric acid 1%, tetrasodium EDTA 0.03%, lauryl glucoside 10.0%, decyl glucoside 8.0%, sodium lauroamphoacetate 8.0%, cocamidopropyl betaine 6.0%, cocamide MEA 4.0%, glycerol 3%, ethylene glycol distearate 1.5%, cetyl alcohol 0.4%, PEG-150 distearate 1.0%, chitosan 0.5%, hydroxypropyl trimethyl chloride starch 0.5%, butylene glycol 2.0%, polysorbate-211.0%, octyldodecanol 0.5%, hydrolyzed wheat protein 5%, black sesame extract 5%, cecropin 0.5%, sunflower seed oil 1%, sodium chloride to adjust viscosity, and ultrapure water for complement.

The bactericidal shampoo of the invention can also be prepared by adopting the conventional method of shampoo in the field.

The sterilizing shampoo disclosed by the invention is safe and effective, has the effects of resisting bacteria, sterilizing, relieving itching, effectively relieving scalp itching, increasing scalp moisture due to scalp fungus reproduction, and is low in irritation and free from causing anaphylaxis.

Compared with the prior art, the technical scheme of the invention has the following advantages:

1. the shampoo of the invention has no carcinogenic substance and toxic chemicals such as silicone oil, essence, pigment and the like. But still has the functions of scalp surface activity cleaning, itching relieving, inflammation diminishing and fungus killing, thus really ensuring the health of users.

2. The bactericidal peptide has good bactericidal and bacteriostatic effects, and can effectively inhibit scalp bacteria and fungi and prevent scalp bacteria pollution after being prepared into shampoo.

Drawings

FIG. 1 is a graph showing the effect of shampoo on scalp moisture

Detailed Description

Embodiments of the present application will be described in detail below with reference to examples, but those skilled in the art will appreciate that the following examples are only illustrative of the present application and should not be construed as limiting the scope of the present application. The examples, in which specific conditions are not specified, were conducted under conventional conditions or conditions recommended by the manufacturer. The reagents or instruments used are conventional products available on the market, not indicated by the manufacturer.

EXAMPLE 1 preparation of germicidal shampoo

(1) Adding deionized water into a vacuum homogenizing emulsifying preparation pot, starting stirring, mixing carbomer 1.0% and water, stirring, and fully dispersing carbomer; 0.03 percent of tetrasodium EDTA, 10.0 percent of lauryl glucoside, 8.0 percent of decyl glucoside, 8.0 percent of sodium lauroamphoacetate and 6.0 percent of cocamidopropyl betaine are added in turn while stirring, then the mixture is heated and mixed while stirring to reach the temperature of 80 ℃, 4.0 percent of cocamide MEA, 3 percent of glycerol, 1.5 percent of ethylene glycol distearate, 0.4 percent of cetyl alcohol, 1.0 percent of PEG-150 distearate, 0.5 percent of chitosan, 0.5 percent of hydroxypropyl trimethyl chloride starch, 2.0 percent of butanediol, 211.0 percent of polysorbate-211.0 percent and 0.5 percent of octyl dodecanol are added in turn, the temperature is kept at 80 ℃, the mixture is stirred for 40 to 50 minutes, and the mixture is fully stirred and dissolved uniformly.

(2) Cooling the materials in the pan to 45 deg.C, sequentially adding hydrolyzed wheat protein 5% and semen Sesami Niger extract 5%, stirring for about 30 min, vacuumizing, homogenizing for 4-5 min, and mixing well.

(3) Cooling the materials in the cooling pot to 40 ℃, adding 0.5% of cecropin and 1% of sunflower seed oil, adjusting viscosity by sodium chloride, adding essence, stirring for 30-40 minutes to completely and uniformly mix the materials;

(4) and then cooling the materials in the pot to 30 ℃, sampling, and taking QB/T2660 as sensory and physicochemical indexes: and (5) detecting the appearance, viscosity, smell and pH value, and discharging to obtain a semi-finished product when the product is qualified.

(5) Standing for 24 hr, sampling, testing by QB/T2660, and packaging to obtain shampoo.

Example 2 verification of the Sterilization Effect

24h fresh slant cultures of Escherichia coli ATCC8099, Staphylococcus aureus ATCC6538, Pseudomonas aeruginosa ATCC15442 and Candida albicans ATCC10231 were taken, washed with 10g/L peptone Phosphate Buffer (PBS) to prepare experimental bacterial suspensions for use. The strain is provided by institute of microbial epidemic of military medical academy of sciences.

Malassezia furfur ATCC44344 is activated, cultured by using a pityrosporum culture medium and prepared into experimental bacteria suspension for later use. Wherein the formula of the pityrosporum culture medium is as follows: wort agar 60.0g, bilis Bovina (dried) 20.0g, Tween 4010.0g, Glycerol mono-oleate (mono-coconut glyceride) 2.5g, and distilled water 1.0L. 121 ℃ for 15 min.

Preparing the shampoo into a diluent containing 5g/L of the shampoo, placing the diluent in a water bath at 20 ℃ for constant temperature, taking 4.5ml of the diluent to expand into a sterile test tube (a positive control is PBS), respectively adding test bacterial suspensions, uniformly mixing, respectively taking action time of 1min and 5min, taking out 1ml of an inoculation plate, pouring a corresponding agar culture medium, culturing at 37 ℃ for 48h, performing viable bacteria technology, and calculating the sterilization rate. Natural Zingiber officinale L.Don shampoo is used as the control shampoo (the control shampoos in the following examples are all natural Zingiber officinale L.Don shampoos). The results are shown in table 1 below.

TABLE 1 percent of the kill rate of the antibacterial shampoo of the present invention to different bacteria after 5min

The control shampoo has the killing rate of less than 40% on the 5 bacteria, particularly on malassezia furfur, the killing rate of 5min is only 20.33%, and the effect is poor. The control PBS treatment did not have any killing effect.

The results show that the shampoo disclosed by the invention has a better effect of inhibiting the growth of fungi under the use condition of 5min, and has a better effect than a control shampoo.

Example 3 Hair Friction test

The average friction force (Fpre) of the hair tresses combed before the sample treatment was measured, and the hair tresses were treated separately with the control shampoo, taking the group of samples of the shampoo of the present invention. The average friction (Fpost) of the combing of the sample hair tresses after the tresses had been dried was measured. The percent reduction in average friction before and after treatment was calculated: Δ F ═ Fpost-Fpre)/Fpre 100%. The results are shown in table 2:

TABLE 2 Hair tress Friction test values

As can be seen from the results in table 2, the shampoo of the present invention also has a better effect of reducing the friction force of hair bundles, and the effect is significant, which is more significant than that of the control shampoo.

EXAMPLE 4 Effect of shampoo on scalp moisture

When the testee washes hair, the shampoo is uniformly kneaded, directly coated on wet hair and scalp, gently massaged for 5min, and then washed off with clear water, with the use frequency of 2-3 d/time. The scalp was subjected to moisture measurement using a skin moisture meter Corneometer at 0d, 14d, and 28d, respectively. Results as shown in fig. 1, the study evaluated the change in moisture of the stratum corneum of the scalp, and the higher the measurement, the higher the moisture content of the stratum corneum of the scalp. As can be seen from fig. 1, the moisture content of the scalp increased after one week of product application compared to before application, with significant improvement in the third and fourth weeks compared to before product application, whereas the control shampoo improved less than the shampoo of the present invention (P < 0.05).

Example 5 safety test

The antibacterial shampoo prepared in example 1 was evaluated for skin irritation and allergy according to the guidelines of the toxicological research of novel drugs, and the results are shown in Table 3.

TABLE 3 safety test results for antibacterial shampoos of the invention

Group of	Phenomenon(s)	Conclusion
			Example 1	No erythema and edema	No irritation and sensitization
Control shampoo	No erythema and edema	Has no irritation or sensitization

The results show that the antibacterial shampoo prepared in example 1 of the present invention has no irritation to the skin, does not cause allergic reactions, and has high safety.

It is to be understood that the invention is not necessarily limited in its application to the details of construction and the arrangement of components set forth in the following description and/or illustrated in the drawings. The invention is capable of embodiments in addition to those described and of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.

As such, those skilled in the art will appreciate that the conception, upon which this disclosure is based, may readily be utilized as a basis for the designing of other structures, methods and systems for carrying out the several purposes of the present invention. It is important, therefore, that the claims be regarded as including such equivalent constructions insofar as they do not depart from the spirit and scope of the present invention.

Sequence listing

<110> Shanxi Si Tu-Mu Biotech Co Ltd

<120> shampoo

<160> 1

<170> SIPOSequenceListing 1.0

<210> 1

<211> 39

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 1

Ser Gly Asp Glu His Leu Gly Arg Asn Ser Tyr Cys Gln Trp Thr Ser

1 5 10 15

Ser Gln Trp Thr Gln Ser Leu Tyr Phe Ala Ala Met Arg Phe Pro Arg

20 25 30

Leu Phe Ile Val Asp His Tyr

35

Claims (5)

1. A shampoo with bactericidal effect is characterized by comprising the following components: carbomer 1.0%, hyaluronic acid 3%, citric acid 1%, tetrasodium EDTA 0.03%, lauryl glucoside 10.0%, decyl glucoside 8.0%, sodium lauroamphoacetate 8.0%, cocamidopropyl betaine 6.0%, cocamide MEA 4.0%, glycerol 3%, ethylene glycol distearate 1.5%, cetyl alcohol 0.4%, PEG-150 distearate 1.0%, chitosan 0.5%, hydroxypropyl trimethyl chloride starch 0.5%, butylene glycol 2.0%, 1.0% polysorbate-21, octyldodecanol 0.5%, hydrolyzed wheat protein 5%, black sesame extract 5%, cecropin 0.5%, sunflower seed oil 1%, adjusting viscosity with sodium chloride, and supplementing with ultrapure water; wherein the sequence of the cecropin is as follows: SGDEHLGRNSYCQWTSSQWTQSLYFAAMRFPRLFIVDHY are provided.

2. A shampoo with bactericidal effect is characterized in that: the preparation method comprises the following steps:

(1) adding deionized water into a vacuum homogenizing and emulsifying preparation pot, starting stirring, mixing 1.0-2.0% of carbomer with water, and stirring to fully disperse carbomer; adding 0.03-0.06% of tetrasodium EDTA, 10.0-12.0% of lauryl glucoside, 6.0-9.0% of decyl glucoside, 6.0-9.0% of sodium lauroamphoacetate and 4.0-6.0% of cocamidopropyl betaine in turn under stirring, heating and mixing under stirring to 80 ℃, adding 2.0-4.0% of cocamide MEA, 1-3% of glycerol, 1-1.5% of ethylene glycol distearate, 0.2-0.4% of cetyl alcohol, 0.5-1.0% of PEG-150 distearate, 0.2-0.5% of chitosan, 0.2-0.5% of hydroxypropyl trimethyl chloride starch, 1.0-2.0% of butanediol, 0.5-1.0% of polysorbate-21, 0.2-0.5% of lauryl alcohol, keeping the temperature at 80 ℃, stirring for 40-50 minutes, fully stirring and dissolving uniformly;

(2) cooling the materials in the pot to 45 ℃, then adding 3-5% of hydrolyzed wheat protein and 3-5% of black sesame extract, 3-8% of hyaluronic acid and 1-5% of citric acid in sequence, stirring for 30 minutes, vacuumizing, homogenizing for 4-5 minutes, and fully and uniformly mixing;

(3) cooling the materials in the cooling pot to 40 ℃, adding 0.5% of cecropin and 0.5% -1% of sunflower seed oil, adjusting the viscosity by sodium chloride, and stirring for 30-40 minutes to completely and uniformly mix the materials;

(4) and then cooling the materials in the pot to 30 ℃, sampling, and taking QB/T2660 as sensory and physicochemical indexes: detecting appearance, viscosity, smell and pH value, and discharging to obtain a semi-finished product if the product is qualified;

(5) standing for 24 hr, sampling, checking according to QB/T2660, and packaging to obtain shampoo product;

the sequence of the cecropin is as follows: SGDEHLGRNSYCQWTSSQWTQSLYFAAMRFPRLFIVDHY is added.

3. A cecropin having the sequence: SGDEHLGRNSYCQWTSSQWTQSLYFAAMRFPRLFIVDHY are provided.

4. Use of the cecropin of claim 3 in the preparation of an antibacterial shampoo.

5. The use according to claim 4, wherein said shampoo further comprises other conventional antibacterial substances.

Images