CN107484783A - Edible apple fruit tree method for producing insecticide - Google Patents
Edible apple fruit tree method for producing insecticide Download PDFInfo
- Publication number
- CN107484783A CN107484783A CN201710537075.7A CN201710537075A CN107484783A CN 107484783 A CN107484783 A CN 107484783A CN 201710537075 A CN201710537075 A CN 201710537075A CN 107484783 A CN107484783 A CN 107484783A
- Authority
- CN
- China
- Prior art keywords
- parts
- fruit tree
- apple fruit
- insecticide
- edible
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N65/00—Biocides, pest repellants or attractants, or plant growth regulators containing material from algae, lichens, bryophyta, multi-cellular fungi or plants, or extracts thereof
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N31/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic oxygen or sulfur compounds
- A01N31/04—Oxygen or sulfur attached to an aliphatic side-chain of a carbocyclic ring system
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
- A01N63/10—Animals; Substances produced thereby or obtained therefrom
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N65/00—Biocides, pest repellants or attractants, or plant growth regulators containing material from algae, lichens, bryophyta, multi-cellular fungi or plants, or extracts thereof
- A01N65/40—Liliopsida [monocotyledons]
- A01N65/48—Zingiberaceae [Ginger family], e.g. ginger or galangal
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Plant Pathology (AREA)
- Dentistry (AREA)
- Agronomy & Crop Science (AREA)
- Environmental Sciences (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Pest Control & Pesticides (AREA)
- Mycology (AREA)
- Natural Medicines & Medicinal Plants (AREA)
- Virology (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Abstract
The invention discloses edible apple fruit tree method for producing insecticide, concretely comprise the following steps：Take the formula ratio tuber of stemona, tobacco leaf, Camellia Leaves, Chinese gall, frutus cnidii, Celastrus angulatus, garlic, ginger, pimiento, manaca, polygonum flaccidum, calabar bean, ultramicro grinding after just crushing, plus water and active peptides then, Microwave Extraction, it is then centrifuged for collecting supernatant, α terpinols will be added after gained supernatant distillation and concentration, be well mixed, it is filling to produce edible apple fruit tree insecticide.Have the beneficial effect that：Insecticide ingredient of the present invention derives from plant, drug residue free after sprinkling, directly edible after apple-picking, non-toxic to human body, and safe and efficient pesticide new variety is provided for the production of pollution-free food；The insecticide can quickly kill the most common insect of apple tree, without resistance to medical；Preparation method of the present invention is simple, and safety, energy-conservation, pollution-free, production equipment is simple, reduces investment outlay.
Description
Technical field
The present invention relates to technical field of insecticide, more particularly to edible apple fruit tree method for producing insecticide.
Background technology
Insecticide is mainly used for preventing a kind of agricultural chemicals of agricultural pests.At present, product variety is more, yield occupies insecticide
One and a most widely used insecticides are organophosphorus insecticideses, and this insecticides is typically with chemical synthesis process system
Into although it has the advantages of desinsection is quick, persticide residue is big, and the food that this insecticides was applied in long-term consumption can make
Human body produces the problems such as chronic toxicity, especially Delayed onset neurotoxic, and the living environment of the mankind is constituted a threat to.China is near
Economic rapid development over year, the food security meaning of common people is progressively strengthened, to the cry more and more higher of " pollution-free food ".Separately
Outside, China has joined WTO, and international grain and oil market is strict to the chemical insecticide residue detection in grain, it is allowed to which residual quantity is very low.
The cereal product in China will such as go abroad, and go to the world, and it is less toxic, efficient, low-residual new must just to find exploitation energetically
Insecticide.This provides wide prospect for the exploitation of plant insecticide.
In recent years, research enthusiasm of the domestic and international experts and scholars to plant insecticide only increases, and has determined that plant now
Middle many types have insecticidal activity, including pulse family, composite family, Celastraceae, Euphorbiaceae, Menispermaceae, Papaveraceae, Solanaceae, auspicious
Fragrant section, Juglandaceae, Salicaceae, Ranunculaceae, Apocynaceae, Amaryllidaceae, Araeceae, Carrot family, Verenaceae, Liliaceae,
10 kinds of plants of the numbers such as polygonaceae, Rutaceae, aster section, Labiatae, Annonaceae, Ericaceae, Magnoliaceae.Plant insecticide comes
Come from naturally, can be degraded in nature, have it is safer to people, animal and pest natural enemy, have multiple biological activities to insect, be right
Natural enemy influences small, degradable, the advantages that being not likely to produce the resistance to the action of a drug to insect.
Prior art such as Authorization Notice No. is the B of CN 103931686 Chinese invention patent, discloses a kind of plant source agriculture
Medicine and its preparation method and application, mainly including common pratia fruit, rhizoma zingiberis, dry green pepper, rheum officinale, peppermint, garlic and camphor.The insecticide by
Natural plants synthesize, and without any toxic chemical composition, after sprinkling, plant, fruit tree, vegetables do not have residual toxin, to people, environment
Water resource is harmless, the alternative existing chemical pesticide used, is a kind of new nuisanceless, environment-friendly insecticide, still
Method for producing insecticide can not fully discharge the active ingredient of each raw material, also have in terms of insecticide drug effect certain
Room for promotion.
The content of the invention
It is an object of the invention to provide a kind of raw material sources in plant, degraded can be completed, environmentally safe, desinsection effect
Fruit is good, drug residue free after sprinkling, edible apple fruit tree method for producing insecticide directly edible after apple-picking.
The present invention is directed to the problem of being mentioned in above-mentioned technology, and the technical scheme taken is：Edible apple fruit tree insecticide
Preparation method, including pretreatment of raw material, multistage microwave amplifier, finished product prepare, specifically include following steps：
Pretreatment of raw material：Raw material is taken by following parts by weight：Tuber of stemona 20-26 parts, tobacco leaf 18-24 parts, Camellia Leaves 18-24 parts, five times
Sub- 15-22 parts, frutus cnidii 13-18 parts, Celastrus angulatus 10-15 parts, garlic 1-2 parts, ginger 1-2 parts, pimiento 0.5-1.2 parts, kind
Lichee 0.7-1.4 parts, polygonum flaccidum 2-3 parts, calabar bean 2-3 parts, are just crushed to 20-30 mesh, then the Ultramicro-powder under 1.2-1.7MPa
4-7 μm is broken to, produces ultramicro medicine powder, standby, ultramicro grinding can destroy Chinese herbal medicine cell membrane in the step, and cell-wall breaking ratio is not
Less than 95%, intracellular effective drug ingedient is set fully to be exposed, less medicinal powder particle diameter can increase contact of the medicinal powder with water
Area, leaching rates are improved, shorten extraction time, reduce energy consumption, save processing cost；
Multistage microwave amplifier：Into ultramicro medicine powder using solid-liquid ratio as 1:9-12 adds water, adds ultramicro medicine powder weight 0.008-
0.011% active peptides, it is well mixed, the Microwave Extraction 12-18min in the case where microwave power is 200-250W, is cooled to room temperature,
Supernatant is collected by centrifugation, produces extract solution, the amino acid sequence of active peptides is
TDHKLCVCVNCFCSYKPFVVSWKYGVAGFYTHCGPNFCCCIS, the active peptides pass through electrostatic interaction and plant cell membrane
It is combined with each other, causes membrane structure disorderly, cell membrane is formed perforation, destroy the integrality of cell membrane, cause in cytoplasm
Effective active composition quickly overflow, shorten the multistage microwave amplifier time, and the active peptides have hydrophobic end and water-wet side, can rise
To emulsification, the addition of emulsifying agent can be reduced, Microwave Extraction can be such that cell interior temperature rises rapidly, and cellular stress exceedes thin
The ability to bear of cell wall expansion, makes cell membrane and cellular membrane disruption or dissolving, discharges the active ingredient of ultramicro medicine powder, the step
Extraction rate is fast, the time is short, greatly improves the recovery rate of ultramicro medicine powder active ingredient, can effectively protect the effective of ultramicro medicine powder
Composition, the purity of active ingredient is high, and safety, energy-conservation, pollution-free, production equipment is simple, reduces investment outlay；
It is prepared by finished product：50-60% by extract solution distillation and concentration to total dose, add medicine weight 0.2-0.3% alpha-terpineol, α-pine
The weight ratio of levogyrate alpha-terpineol and dextrorotation alpha-terpineol is 1 in oleyl alcohol:0.2-0.3, it is well mixed, it is filling to produce edible apple
Fruit fruit tree insecticide, the rational proportion of levogyrate alpha-terpineol and dextrorotation alpha-terpineol, can greatly enhance α-pine tar in alpha-terpineol
Alcohol has stronger synergistic effect to insecticide insecticidal effect of the present invention, is somebody's turn to do to the killing effect of a variety of apple tree insects and germ
Insecticide all the components in nature can degradable, drug residue free after sprinkling, it is directly edible after apple-picking, for green
The production of food provides safe and efficient pesticide new variety, and the insecticide compatibility is reasonable, can quickly kill the most common of apple tree
Insect for example leaf roller, red spider, aphid, litchi stink bug as etc., lasting medicine is strong, and without resistance to medical.
Compared with prior art, the advantage of the invention is that：The insecticide all the components of the present invention are all derived from plant,
It is cheap, in nature can degradable, drug residue free after sprinkling, it is directly edible after apple-picking, it is nontoxic to human body
Property, provide safe and efficient pesticide new variety for the production of pollution-free food；The insecticide compatibility is reasonable, can quickly kill apple tree
Most common insect for example leaf roller, red spider, aphid, litchi stink bug as etc., one time killing rate reaches more than 83%, lasting medicine
Property it is strong, and without resistance to medical, can be used continuously with 4-5；Preparation method of the present invention is simple, and extraction rate is fast, the time is short,
The recovery rate of active ingredient is high, can effectively protect the active ingredient of medicine, the purity of active ingredient is high, safety, saves, without dirt
Dye, production equipment are simple, reduce investment outlay.
Specific embodiment
The present invention program is described further below by embodiment：
Embodiment 1：
Edible apple fruit tree method for producing insecticide, including pretreatment of raw material, multistage microwave amplifier, finished product preparation, specific bag
Include following steps：
1）Pretreatment of raw material：Raw material is taken by following parts by weight：23 parts of the tuber of stemona, 21 parts of tobacco leaf, 21 parts of Camellia Leaves, 18 parts of Chinese gall,
15 parts of frutus cnidii, 13 parts of Celastrus angulatus, 1.5 parts of garlic, 1.5 parts of ginger, 0.8 part of pimiento, 1 part of manaca, 2.5 parts of polygonum flaccidum, poison
2.5 parts of French beans, 20-30 mesh just is crushed to through mechanical crusher, then ultramicro grinding to 4-7 μm, produces ultra micro under 1.5MPa
Medicinal powder, standby, ultramicro grinding can destroy Chinese herbal medicine cell membrane in the step, and cell-wall breaking ratio is not less than 95%, makes to have into the cell
The drug ingedient of effect is fully exposed, and less medicinal powder particle diameter can increase the contact area of medicinal powder and water, improves leaching rates,
Shorten extraction time, reduce energy consumption, save processing cost；
2）Multistage microwave amplifier：Into ultramicro medicine powder using solid-liquid ratio as 1:10 add water, add the work of ultramicro medicine powder weight 0.009%
Property polypeptide, mechanical agitation is well mixed, the Microwave Extraction 15min in the case where microwave power is 230W, is cooled to room temperature, Ran Hou
22min is centrifuged in 5000r/min centrifuge, supernatant is collected, produces extract solution, the amino acid sequence of active peptides is
TDHKLCVCVNCFCSYKPFVVSWKYGVAGFYTHCGPNFCCCIS, the active peptides pass through electrostatic interaction and plant cell membrane
It is combined with each other, causes membrane structure disorderly, cell membrane is formed perforation, destroy the integrality of cell membrane, cause in cytoplasm
Effective active composition quickly overflow, shorten the multistage microwave amplifier time, and the active peptides have hydrophobic end and water-wet side, can rise
To emulsification, the addition of emulsifying agent can be reduced, Microwave Extraction can be such that cell interior temperature rises rapidly, and cellular stress exceedes thin
The ability to bear of cell wall expansion, makes cell membrane and cellular membrane disruption or dissolving, discharges the active ingredient of ultramicro medicine powder, the step
Extraction rate is fast, the time is short, greatly improves the recovery rate of ultramicro medicine powder active ingredient, can effectively protect the effective of ultramicro medicine powder
Composition, the purity of active ingredient is high, and safety, energy-conservation, pollution-free, production equipment is simple, reduces investment outlay；
3）It is prepared by finished product：By extract solution distillation and concentration to total dose 55%, add medicine weigh 0.25% alpha-terpineol, alpha-terpineol
The weight ratio of middle levogyrate alpha-terpineol and dextrorotation alpha-terpineol is 1:0.25, it is well mixed, it is filling, seal and produce edible apple
Fruit tree insecticide, the rational proportion of levogyrate alpha-terpineol and dextrorotation alpha-terpineol, can greatly enhance alpha-terpineol in alpha-terpineol
To the killing effect of a variety of apple tree insects and germ, there is stronger synergistic effect to insecticide insecticidal effect of the present invention, this is killed
Worm agent all the components in nature can degradable, drug residue free after sprinkling, it is directly edible after apple-picking, for green food
The production of product provides safe and efficient pesticide new variety, and the insecticide compatibility is reasonable, can quickly kill the most common of apple tree
Insect for example leaf roller, red spider, aphid, litchi stink bug as etc., lasting medicine is strong, and without resistance to medical.
Embodiment 2：
Edible apple fruit tree method for producing insecticide, specifically includes following steps：
1）Raw material is taken by following parts by weight：22 parts of the tuber of stemona, 22 parts of tobacco leaf, 18 parts of Camellia Leaves, 22 parts of Chinese gall, 13 parts of frutus cnidii,
15 parts of Celastrus angulatus, 1.7 parts of garlic, 1.2 parts of ginger, 0.7 part of pimiento, 0.8 part of manaca, 2 parts of polygonum flaccidum, 3 parts of calabar bean, first powder
20-30 mesh is broken to, then ultramicro grinding to 4-7 μm, produces ultramicro medicine powder under 1.3MPa, standby, ultramicro grinding in the step
Chinese herbal medicine cell membrane can be destroyed, cell-wall breaking ratio is not less than 95%, intracellular effective drug ingedient is fully exposed,
Less medicinal powder particle diameter can increase the contact area of medicinal powder and water, improve leaching rates, shorten extraction time, reduce energy consumption, section
About processing cost；
2）Into ultramicro medicine powder using solid-liquid ratio as 1:9-12 adds water, adds the active peptides of ultramicro medicine powder weight 0.011%, mixes
Close uniformly, the Microwave Extraction 16min in the case where microwave power is 230W, be cooled to room temperature, supernatant is collected by centrifugation, produce extract solution,
The amino acid sequence of active peptides is TDHKLCVCVNCFCSYKPFVVSWKYGVAGFYTHCGPNFCCCIS, and the active peptides lead to
Cross electrostatic interaction to be combined with each other with plant cell membrane, cause membrane structure disorderly, cell membrane is formed perforation, destroy cell membrane
Integrality, cause intracytoplasmic effective active composition quickly to be overflowed, shorten the multistage microwave amplifier time, and the active peptides have
There are hydrophobic end and water-wet side, emulsification can be played, the addition of emulsifying agent can be reduced, Microwave Extraction can make cell interior temperature fast
Speed rises, and cellular stress exceedes the ability to bear of cell wall expansion, makes cell membrane and cellular membrane disruption or dissolving, discharges ultra micro
The active ingredient of medicinal powder, the step extraction rate is fast, the time is short, greatly improves the recovery rate of ultramicro medicine powder active ingredient, can have
The active ingredient of effect ground protection ultramicro medicine powder, the purity of active ingredient is high, and safety, energy-conservation, pollution-free, production equipment is simple, section
Investment-saving；
3）By extract solution distillation and concentration to total dose 50%, add the alpha-terpineol that medicine weighs 0.3%, left-handed α-pine in alpha-terpineol
The weight ratio of oleyl alcohol and dextrorotation alpha-terpineol is 1:0.2, it is well mixed, it is filling to produce edible apple fruit tree insecticide, α-pine
The rational proportion of levogyrate alpha-terpineol and dextrorotation alpha-terpineol, can greatly enhance alpha-terpineol to a variety of apple tree insects in oleyl alcohol
With the killing effect of germ, there is stronger synergistic effect to insecticide insecticidal effect of the present invention, the insecticide all the components are certainly
In right boundary can degradable, drug residue free after sprinkling, it is directly edible after apple-picking, provided safely for the production of pollution-free food
Efficient pesticide new variety, the insecticide compatibility is reasonable, can quickly kill most common the insect such as leaf roller, red spider of apple tree
Spider, aphid, litchi stink bug as etc., lasting medicine is strong, and without resistance to medical.
Embodiment 3：
Edible apple fruit tree method for producing insecticide, is concretely comprised the following steps：Take 25 parts of the tuber of stemona, 19 parts of tobacco leaf, 23 parts of Camellia Leaves,
17 parts of Chinese gall, 17 parts of frutus cnidii, 10 parts of Celastrus angulatus, 2 parts of garlic, 1 part of ginger, 0.5 part of pimiento, 1.4 parts of manaca, polygonum flaccidum
2.6 parts, 2.2 parts of calabar bean, are just crushed to 20-30 mesh, and then ultramicro grinding to 4-7 μm, produces ultramicro medicine powder under 1.7MPa,
Into ultramicro medicine powder using solid-liquid ratio as 1:12 add water, add the active peptides of ultramicro medicine powder weight 0.008%, are well mixed,
Microwave power is Microwave Extraction 18min under 200W, is cooled to room temperature, supernatant is collected by centrifugation, produce extract solution；Then will extraction
Liquid distillation and concentration adds the alpha-terpineol that medicine weighs 0.2% to the 60% of total dose, and levogyrate alpha-terpineol and dextrorotation α in alpha-terpineol-
The weight ratio of terpinol is 1:0.3, it is well mixed, it is filling to produce degradable green insecticide.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme is described in detail embodiment described above, it should be understood that it is described above only
For the specific embodiment of the present invention, it is not intended to limit the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should be included in the scope of the protection.
SEQUENCE LISTING
<110>Close big vast gardening research and development Co., Ltd in Pujiang County
<120>Edible apple fruit tree method for producing insecticide
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 42
<212> PRT
<213>It is artificial synthesized
<400> 1
Thr Asp His Lys Leu Cys Val Cys Val Asn Cys Phe Cys Ser Tyr Lys
1 5 10 15
Pro Phe Val Val Ser Trp Lys Tyr Gly Val Ala Gly Phe Tyr Thr His
20 25 30
Cys Gly Pro Asn Phe Cys Cys Cys Ile Ser
35 40
Claims (9)
1. edible apple fruit tree method for producing insecticide, including pretreatment of raw material, multistage microwave amplifier, finished product preparation, it is special
Sign is：The multistage microwave amplifier step is：Add water and active peptides into ultramicro medicine powder, be well mixed, Microwave Extraction, cooling
To room temperature, supernatant is collected by centrifugation, produces extract solution.
2. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The microwave method
The solid-liquid ratio of ultramicro medicine powder and water is 1 in extraction step:9-12.
3. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The microwave method
The addition of active peptides is the 0.008-0.011% of ultramicro medicine powder weight in extraction step, and its amino acid sequence is
TDHKLCVCVNCFCSYKPFVVSWKYGVAGFYTHCGPNFCCCIS。
4. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The microwave method
Microwave power is 200-250W in extraction step, and the Microwave Extraction time is 12-18min.
5. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The raw material is pre-
The composition of raw material and its parts by weight are in processing step：Tuber of stemona 20-26 parts, tobacco leaf 18-24 parts, Camellia Leaves 18-24 parts, Chinese gall
15-22 parts, frutus cnidii 13-18 parts, Celastrus angulatus 10-15 parts, garlic 1-2 parts, ginger 1-2 parts, pimiento 0.5-1.2 parts, kind litchi
Branch 0.7-1.4 parts, polygonum flaccidum 2-3 parts, calabar bean 2-3 parts.
6. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The raw material is pre-
Just 20-30 mesh is crushed in processing step.
7. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The raw material is pre-
The pressure of ultramicro grinding is 1.2-1.7MPa in processing step, and the particle diameter of ultramicro medicine powder is 4-7 μm.
8. edible apple fruit tree method for producing insecticide according to claim 1, it is characterised in that：The finished product system
It is for step：50-60% by extract solution distillation and concentration to total dose, alpha-terpineol is added, be well mixed, it is filling to produce green
Degradable insecticide.
9. edible apple fruit tree method for producing insecticide according to claim 8, it is characterised in that：The finished product system
The addition of standby step alpha-terpineol is the 0.2-0.3% of medicine weight, levogyrate alpha-terpineol and dextrorotation alpha-terpineol in alpha-terpineol
Weight ratio is 1:0.2-0.3.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710537075.7A CN107484783A (en) | 2017-07-04 | 2017-07-04 | Edible apple fruit tree method for producing insecticide |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710537075.7A CN107484783A (en) | 2017-07-04 | 2017-07-04 | Edible apple fruit tree method for producing insecticide |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107484783A true CN107484783A (en) | 2017-12-19 |
Family
ID=60644584
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710537075.7A Withdrawn CN107484783A (en) | 2017-07-04 | 2017-07-04 | Edible apple fruit tree method for producing insecticide |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107484783A (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108164341A (en) * | 2018-02-06 | 2018-06-15 | 金华市众鑫农业科技有限公司 | Fruit tree containing fungicide expands the preparation method of fertilizer |
| CN110999707A (en) * | 2019-12-24 | 2020-04-14 | 昭通学院 | Crop interplanting method for preventing Indian Miyaya fasciata aphid pests in apple forest |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102754667A (en) * | 2011-06-27 | 2012-10-31 | 孙伟年 | High-efficiency composite botanical pesticide |
| CN103535389A (en) * | 2013-10-27 | 2014-01-29 | 莫晟琼 | Plant source fruit tree insecticide |
| CN103609618A (en) * | 2013-10-30 | 2014-03-05 | 桂平市西山茶场 | Tea pollution-free pesticide |
| CN103875734A (en) * | 2014-03-14 | 2014-06-25 | 内蒙古帅旗生物科技股份有限公司 | Botanical pesticide prepared by combined extraction of Chinese herbal medicines |
| CN105941500A (en) * | 2016-05-05 | 2016-09-21 | 张小霞 | High efficiency composite biological green insecticide and preparation method thereof |
| CN106577876A (en) * | 2015-10-19 | 2017-04-26 | 重庆安尚园农业科技发展有限公司 | Green pesticide and preparation method thereof |
-
2017
- 2017-07-04 CN CN201710537075.7A patent/CN107484783A/en not_active Withdrawn
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102754667A (en) * | 2011-06-27 | 2012-10-31 | 孙伟年 | High-efficiency composite botanical pesticide |
| CN103535389A (en) * | 2013-10-27 | 2014-01-29 | 莫晟琼 | Plant source fruit tree insecticide |
| CN103609618A (en) * | 2013-10-30 | 2014-03-05 | 桂平市西山茶场 | Tea pollution-free pesticide |
| CN103875734A (en) * | 2014-03-14 | 2014-06-25 | 内蒙古帅旗生物科技股份有限公司 | Botanical pesticide prepared by combined extraction of Chinese herbal medicines |
| CN106577876A (en) * | 2015-10-19 | 2017-04-26 | 重庆安尚园农业科技发展有限公司 | Green pesticide and preparation method thereof |
| CN105941500A (en) * | 2016-05-05 | 2016-09-21 | 张小霞 | High efficiency composite biological green insecticide and preparation method thereof |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108164341A (en) * | 2018-02-06 | 2018-06-15 | 金华市众鑫农业科技有限公司 | Fruit tree containing fungicide expands the preparation method of fertilizer |
| CN110999707A (en) * | 2019-12-24 | 2020-04-14 | 昭通学院 | Crop interplanting method for preventing Indian Miyaya fasciata aphid pests in apple forest |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103875722B (en) | Chinese herbal medicine merges the botanical fungicide extracted | |
| CN102754667B (en) | High-efficiency composite botanical pesticide | |
| CN105557779A (en) | Compound Chinese herbal medicine insecticide preparation method | |
| CN107484783A (en) | Edible apple fruit tree method for producing insecticide | |
| CN108260608A (en) | A kind of plant source growth regulator and its application in promoting crop growth long side | |
| CN110465040A (en) | A kind of degradation agent and its preparation and application of farm-forestry crop pesticide residue of degrading | |
| CN104604962B (en) | A kind of composition of prevention Bradysia fungus gnat larva | |
| CN106561743A (en) | Plant source medicament for preventing and treating mycetophilids | |
| CN106508996A (en) | Greenhouse pesticide and preparation method thereof | |
| CN104814048A (en) | Method for processing Chinese herbal medicine plant composited expelling-killing-type nuisance-free pesticide preparation | |
| CN106106541A (en) | A kind of Fructus Pruni pseudocerasi Biocidal liquid and preparation method thereof | |
| CN107494629A (en) | A kind of Fruit fly plant lures composition and preparation method thereof | |
| CN106342916A (en) | Termite control spray | |
| CN107410390A (en) | Degradable green insecticide | |
| Aditama et al. | Optimizing of maseration with ethanol and water solvents against the toxicity of extract of wuluh starfruit (Averrhoa bilimbi L.) in controlling larva of Aedes aegypti. | |
| CN110973164A (en) | Ginkgolic acid soluble solution and preparation method thereof | |
| CN106259515A (en) | A kind of mango insecticide and preparation method thereof | |
| CN107980806B (en) | Plant insect repellant and application thereof | |
| CN106135319A (en) | A kind of Fructus Fragariae Ananssae common pests herbal control agent and preparation method thereof | |
| CN105901022A (en) | Muscardine insecticide suitable for diseases and pests of Chinese cabbage and preparation method of muscardine insecticide | |
| CN105961460A (en) | Botanical pesticide for preventing and controlling Bradysia odoriphaga | |
| CN105901019A (en) | Special botanical insecticide with radix angelicae pubescentis extract for paddy rice in saline and alkaline lands and method for preparing special botanical insecticide | |
| CN107347945A (en) | Degradable green method for producing insecticide | |
| CN1292998A (en) | 'Junchongjing' as natural agricultural chemical and its preparing process | |
| CN110663707A (en) | Biological pesticide for tea and preparation method thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20171219 |