CN107432367A - Improve the feed of pirarucu survival rate - Google Patents

Improve the feed of pirarucu survival rate Download PDF

Info

Publication number
CN107432367A
CN107432367A CN201710500407.4A CN201710500407A CN107432367A CN 107432367 A CN107432367 A CN 107432367A CN 201710500407 A CN201710500407 A CN 201710500407A CN 107432367 A CN107432367 A CN 107432367A
Authority
CN
China
Prior art keywords
parts
pirarucu
powder
survival rate
feed
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN201710500407.4A
Other languages
Chinese (zh)
Inventor
刘宏汉
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Lanxi City Prince Sports Aquaculture Technology Co Ltd
Original Assignee
Lanxi City Prince Sports Aquaculture Technology Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Lanxi City Prince Sports Aquaculture Technology Co Ltd filed Critical Lanxi City Prince Sports Aquaculture Technology Co Ltd
Priority to CN201710500407.4A priority Critical patent/CN107432367A/en
Publication of CN107432367A publication Critical patent/CN107432367A/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K50/00Feeding-stuffs specially adapted for particular animals
    • A23K50/80Feeding-stuffs specially adapted for particular animals for aquatic animals, e.g. fish, crustaceans or molluscs
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/10Animal feeding-stuffs obtained by microbiological or biochemical processes
    • A23K10/16Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions
    • A23K10/18Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions of live microorganisms
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/20Animal feeding-stuffs from material of animal origin
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/20Animal feeding-stuffs from material of animal origin
    • A23K10/22Animal feeding-stuffs from material of animal origin from fish
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/20Animal feeding-stuffs from material of animal origin
    • A23K10/26Animal feeding-stuffs from material of animal origin from waste material, e.g. feathers, bones or skin
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/30Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/30Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
    • A23K10/37Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms from waste material
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/142Amino acids; Derivatives thereof
    • A23K20/147Polymeric derivatives, e.g. peptides or proteins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/158Fatty acids; Fats; Products containing oils or fats
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/174Vitamins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/20Inorganic substances, e.g. oligoelements
    • A23K20/28Silicates, e.g. perlites, zeolites or bentonites
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A40/00Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
    • Y02A40/80Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in fisheries management
    • Y02A40/81Aquaculture, e.g. of fish
    • Y02A40/818Alternative feeds for fish, e.g. in aquacultures
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02PCLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
    • Y02P60/00Technologies relating to agriculture, livestock or agroalimentary industries
    • Y02P60/80Food processing, e.g. use of renewable energies or variable speed drives in handling, conveying or stacking
    • Y02P60/87Re-use of by-products of food processing for fodder production

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Polymers & Plastics (AREA)
  • Engineering & Computer Science (AREA)
  • Food Science & Technology (AREA)
  • Animal Husbandry (AREA)
  • Zoology (AREA)
  • Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Physiology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Botany (AREA)
  • Mycology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Birds (AREA)
  • Insects & Arthropods (AREA)
  • Inorganic Chemistry (AREA)
  • Biochemistry (AREA)
  • Fodder In General (AREA)

Abstract

The present invention provides a kind of feed for improving pirarucu survival rate, and its composition and its parts by weight are:13 ~ 22 parts of shrimp med, 10 ~ 17 parts of earthworm powder, 22 ~ 35 parts of wheat flour, 1 ~ 4 part of lecithin, 8 ~ 13 parts of bone meal, 15 ~ 21 parts of spirulina powder, 5 ~ 9 parts of fairy shrimp powder, 6 ~ 11 parts of compound probiotic, 12 ~ 17 parts of fish protein hydrolyzate, 16 ~ 28 parts of bean cake powder, 3 ~ 8 parts of unrighted acid, 2 ~ 5 parts of immunopotentiator, 14 ~ 23 parts of Strong flour, this feed nutrition reasonable mixture ratio, meet needed for pirarucu juvenile growth, also meet needed for adult fish existence, and it can effectively strengthen the immunity of pirarucu, improve the Anti-bacterium ability of body, promote absorption and utilization of the enteron aisle to beneficiating ingredient, improve in vivo bioactivity, effectively increase the survival rate of pirarucu.

Description

Improve the feed of pirarucu survival rate
Technical field
The invention belongs to aquatic feeds field, and in particular to a kind of feed for improving pirarucu survival rate.
Background technology
Pirarucu life in the matto waters of most original, mainly using small fish as food, but is also caught once in a while in the world Food snake, tortoise, frog and insect, it even can also prey on small crocodile.Because weather is extremely hot, the slow river oxygen content of flow velocity reduces, Pirarucu, which needs to float on the surface of the water frequently, swallows air to breathe.In dry season, it, which also can lean against to get into the cave in silt, carrys out self-insurance.Jugu Tongue fish has powerful brute-force, by the use of tail as weapon, can knock down the male of adult easily, and smash bone and cause largely Internal injury.
If pirarucu is raised indoors, otherwise aquarium need to be suggested direct with " exhibition cylinder " the general size in aquarium The boiling water pond in courtyard.Pirarucu inherits the tradition of all original fish:One fish glue that can breathe air.This is just water The oxygen supply of body significantly reduces burden.Other pH value is slightly sour to neutral, 25 °C of temperature -30 °C it can receive.Pirarucu As long as the much the same ornamental fish of build can be raised together with it in the young.After subadult, pirarucu can build other roads Prey is treated as, it is therefore desirable to separately cultivation.
Such as, Chinese invention granted patent document, Authorization Notice No. CN101507465B, the invention belongs to a kind of to prior art The oxidation resisting feedstuff of sturgeon immunity is improved, it is related to a kind of oxidation resisting feedstuff.It is solved is propagated artificially using present feed Sturgeon immunity it is low, susceptible, be difficult to cure with common drug after ill and sturgeon be to the more sensitive problem of common drug. Improve sturgeon immunity oxidation resisting feedstuff by fish meal, dregs of beans, wheat-middlings, fish oil, soybean lecithin, aloe powder, cellulose, zeolite and Pre-mixing agent mixes.The oxidation resisting feedstuff that sturgeon immunity is improved in the present invention does not make significant difference to the production performance of sturgeon ;Sturgeon oxidation resisting feedstuff makes the blood plasma hepatocuprein vigor of sturgeon significantly raise (P < 0.05), blood in the present invention Slurry MDA vigor significantly reduces (P < 0.05), improves the immunity of sturgeon, avoids its infection ill.But the feed The nutritional ingredient that the long-term raising for pirarucu may cause pirarucu to be taken in is not comprehensive, may influence Jugu The growth and existence of tongue fish.
The content of the invention
It is an object of the invention to provide one kind can improve disease-resistant bacteria factor in pirarucu body, improves immunity, carries It high viability, and nutritional ingredient comprehensive and reasonable, can promote to grow, be adapted to juvenile fish and the survival of the raising pirarucu of adult fish rearing The feed of rate.
The technical scheme taken to achieve the above object of the present invention is:Improve pirarucu survival rate feed, its into Divide and its parts by weight are:13 ~ 22 parts of shrimp med, 10 ~ 17 parts of earthworm powder, 22 ~ 35 parts of wheat flour, 1 ~ 4 part of lecithin, bone meal 8 ~ 13 Part, 15 ~ 21 parts of spirulina powder, 5 ~ 9 parts of fairy shrimp powder, 6 ~ 11 parts of compound probiotic, 12 ~ 17 parts of fish protein hydrolyzate, bean cake powder 16 ~ 28 parts, 3 ~ 8 parts of unrighted acid, 2 ~ 5 parts of immunopotentiator, 14 ~ 23 parts of Strong flour, this feed nutrition reasonable mixture ratio, Meet needed for pirarucu juvenile growth, also meet the immunity that needed for adult fish existence, can effectively strengthen pirarucu, improve machine The Anti-bacterium ability of body, promote absorption and utilization of the enteron aisle to beneficiating ingredient, improve in vivo bioactivity, improve pirarucu Survival rate.
Preferably, immunopotentiator is made up of following component and parts by weight:2 ~ 5 parts of radix glycyrrhizae, 4 ~ 9 parts of the bighead atractylodes rhizome, ginkgo 3 ~ 6 Part, 1.4 ~ 3.5 parts of medical stone powder, 2.2 ~ 4.3 parts of complex vitamin premix, 0.8 ~ 2.4 part of active peptides, Radix Isatidis 8 ~ 12 Part, 1 ~ 3 part of garlic powder, complex vitamin premix are that market is routinely bought, and the addition of immunopotentiator can effectively strengthen serum Middle lysozyme activity, lifts the activity of living organism property albumen, effective to improve that pirarucu is antiviral and the ability of bacterium, also increases Strong anti-oxidation, by removing harmful free radicals in human body, impaired cell is repaired, recover the immunologic function of cell to improve people The immunity of body.
Preferably, the amino acid sequence of active peptides is HSHACKLCVCVNCFCCGAYLCVLHPGKLCVCVNCSK, The addition of active peptides promotes absorption and utilization of the goldbeater's skin to calcium, iron, zinc, selenium as inorganic ionic carriers, effectively prevents The metal ion of dissolving small intestine is neutral or slight alkali environment in combined with phosphate radical and formed it is harmful precipitate, be effectively increased simultaneously The holdup time of mineral matter in vivo, the absorption to feed nutrient is not only increased, also reduce pirarucu stomach Sick hair rate, physiologically there is prominent performance immune.
Preferably, it by trash fish is raw material that fish protein hydrolyzate, which is, it is made using tryptose Hydrolyze method, fish protein hydrolyzate With high functionality and high nutritive value, contribute to the digestion to micro-granulated feed of pirarucu and its juvenile fish digestive system and then Absorb, avoid the risk of bacterium infection pirarucu that the direct feeding of biological feedstuff causes to carry, effectively improve Jugu tongue The speed of growth and survival rate of fish.
Preferably, unrighted acid is made up of linoleic acid, fish oil, arachidonic acid one or more therein, The addition of unrighted acid maintains the relative flow of cell membrane, improves blood microcirculation, promotes digestive function, effectively increases The strong immunocompetence of pirarucu, improves survival rate.
The preparation method of the feed of pirarucu survival rate is improved, its preparation process is:
1)Prepare acidifying bone meal:By weight, take bone meal to add the glacial acetic acid that concentration is 93 ~ 98%, bone meal and glacial acetic acid according to 3~5:1 volume ratio amount mixes, and after stirring, stands reaction, and acidifying bone meal is made, standby;The acidified processing of bone meal Afterwards, be advantageous to improve free phosphate content therein, have significant effect to catfish body weight increase;
2)Prepare compound probiotic:Solution of photosynthetic bacteria, bacillus subtilis, lactic acid bacteria is taken uniformly to mix, solution of photosynthetic bacteria, withered grass Bacillus, the volume ratio successively of lactic acid bacteria are 1:0.8~1.1:1.2 ~ 1.5, it is placed in the environment that temperature is 28 ~ 36 DEG C and stands It is 20 ~ 40 minutes, standby;
3)Mixing:Take step 1 and step 2 product, by proportional quantity add shrimp med, earthworm powder, wheat flour, lecithin, spirulina powder, Through adjusting after the uniform mixing of fairy shrimp powder, fish protein hydrolyzate, bean cake powder, unrighted acid, immunopotentiator, Strong flour The feed for the raising pirarucu survival rate that matter, expanded obtained particle diameter are 0.2 ~ 0.6 millimeter, the preparation method letter of this feed Single, cost is cheap, is adapted to use of large-scale production.
Compared with prior art, beneficial effects of the present invention are:This Feed Energy effectively improves lyase in pirarucu body Bacterium activity, improves the antiviral and ability of bacterium;This feed can effectively facilitate pirarucu to inorganic ions and mineral matter member Element absorbs, and reduces intestines problem;This feed can improve blood microcirculation, promote digestive function, effectively enhance huge The immunocompetence of osteoglossid, improve survival rate;This feed nutrition proportioning is perfect, is adapted to the raising of juvenile fish and adult fish, cutting is for mistake Journey is simple, and cost is cheap, is adapted to large-scale promotion.
Embodiment
It is described in further detail with reference to embodiments:
Embodiment 1:
Improve the feed of pirarucu survival rate, it is characterised in that composition and its parts by weight are:13 ~ 22 parts of shrimp med, earthworm powder 10 ~ 17 parts, it is 22 ~ 35 parts of wheat flour, 1 ~ 4 part of lecithin, 8 ~ 13 parts of bone meal, 15 ~ 21 parts of spirulina powder, 5 ~ 9 parts of fairy shrimp powder, compound 6 ~ 11 parts of probiotics, 12 ~ 17 parts of fish protein hydrolyzate, 16 ~ 28 parts of bean cake powder, 3 ~ 8 parts of unrighted acid, immunopotentiator 2 ~ 5 parts, 14 ~ 23 parts of Strong flour, this feed nutrition reasonable mixture ratio, meet needed for pirarucu juvenile growth, also meet that adult fish gives birth to It needed for depositing, can effectively strengthen the immunity of pirarucu, improve the Anti-bacterium ability of body, promote suction of the enteron aisle to beneficiating ingredient Receive and utilize, improve in vivo bioactivity, improve the survival rate of pirarucu.
Immunopotentiator is made up of following component and parts by weight:2 ~ 5 parts of radix glycyrrhizae, 4 ~ 9 parts of the bighead atractylodes rhizome, 3 ~ 6 parts of ginkgo, medical stone 1.4 ~ 3.5 parts of powder, 2.2 ~ 4.3 parts of complex vitamin premix, 0.8 ~ 2.4 part of active peptides, 8 ~ 12 parts of Radix Isatidis, garlic powder 1 ~ 3 parts, complex vitamin premix is that market is routinely bought, and the addition of immunopotentiator can effectively strengthen bacteriolyze enzyme activity in serum Property, lift the activity of living organism property albumen, it is effective to improve that pirarucu is antiviral and the ability of bacterium, also strengthen anti-oxidant Property, by removing harmful free radicals in human body, impaired cell is repaired, recovers the immunologic function of cell to improve the immune of human body Power.
The amino acid sequence of active peptides is HSHACKLCVCVNCFCCGAYLCVLHPGKLCVCVNCSK, active peptides Addition promotes absorption and utilization of the goldbeater's skin to calcium, iron, zinc, selenium as inorganic ionic carriers, effectively prevents the metal of dissolving Ion small intestine is neutral or slight alkali environment in combined with phosphate radical and formed it is harmful precipitate, while effectively increase mineral matter and exist The internal holdup time, the absorption to feed nutrient is not only increased, also reduce pirarucu enterogastritis hair rate, exempting from Epidemic disease physiologically has prominent performance.
It by trash fish is raw material that fish protein hydrolyzate, which is, is made using tryptose Hydrolyze method, fish protein hydrolyzate has Gao Gong Energy property and high nutritive value, contribute to the digestion and then absorption of pirarucu and its juvenile fish digestive system to micro-granulated feed, keep away Exempt from the risk of bacterium infection pirarucu that the direct feeding of biological feedstuff causes to carry, effectively improve the growth of pirarucu Speed and survival rate.
Unrighted acid is made up of fish oil and arachidonic acid, and the addition of unrighted acid maintains cell membrane Relative flow, improve blood microcirculation, promote digestive function, effectively enhance the immunocompetence of pirarucu, raising survives Rate.
The preparation method of the feed of pirarucu survival rate is improved, its preparation process is:
1)Prepare acidifying bone meal:By weight, take bone meal to add the glacial acetic acid that concentration is 93 ~ 98%, bone meal and glacial acetic acid according to 3~5:1 volume ratio amount mixes, and after stirring, stands reaction, and acidifying bone meal, standby, the acidified processing of bone meal is made Afterwards, be advantageous to improve free phosphate content therein, have significant effect to catfish body weight increase;
2)Prepare compound probiotic:Solution of photosynthetic bacteria, bacillus subtilis, lactic acid bacteria is taken uniformly to mix, solution of photosynthetic bacteria, withered grass Bacillus, the volume ratio successively of lactic acid bacteria are 1:0.8~1.1:1.2 ~ 1.5, it is placed in the environment that temperature is 28 ~ 36 DEG C and stands It is 20 ~ 40 minutes, standby;
3)Mixing:Take step 1 and step 2 product, by proportional quantity add shrimp med, earthworm powder, wheat flour, lecithin, spirulina powder, Through adjusting after the uniform mixing of fairy shrimp powder, fish protein hydrolyzate, bean cake powder, unrighted acid, immunopotentiator, Strong flour The feed for the raising pirarucu survival rate that matter, expanded obtained particle diameter are 0.2 ~ 0.6 millimeter, the preparation method letter of this feed Single, cost is cheap, is adapted to use of large-scale production.
Embodiment 2:
Improve the feed of pirarucu survival rate, it is characterised in that composition and its parts by weight are:18 parts of shrimp med, 14 parts of earthworm powder, 33 parts of wheat flour, 3 parts of lecithin, 11 parts of bone meal, 19 parts of spirulina powder, 7 parts of fairy shrimp powder, 8 parts of compound probiotic, Fish protein water Solve 16 parts of thing, 25 parts of bean cake powder, 6 parts of unrighted acid, 4 parts of immunopotentiator, 21 parts of Strong flour, this feed nutrition proportioning Rationally, meet needed for pirarucu juvenile growth, also meet the immunity that needed for adult fish existence, can effectively strengthen pirarucu, The Anti-bacterium ability of body is improved, promotes absorption and utilization of the enteron aisle to beneficiating ingredient, improves in vivo bioactivity, improve huge The survival rate of osteoglossid.
Immunopotentiator is made up of following component and parts by weight:4 parts of radix glycyrrhizae, 7 parts of the bighead atractylodes rhizome, 5 parts of ginkgo, medical stone powder 2.4 Part, 3.3 parts of complex vitamin premix, 1.7 parts of active peptides, 10 parts of Radix Isatidis, 2 parts of garlic powder, complex vitamin premix Routinely bought for market, the addition of immunopotentiator can effectively strengthen lysozyme activity in serum, lifting living organism property albumen Activity, it is effective to improve that pirarucu is antiviral and the ability of bacterium, also strengthen inoxidizability, by remove be harmful in human body from By base, impaired cell is repaired, recovers the immunologic function of cell to improve the immunity of human body.
The amino acid sequence of active peptides is HSHACKLCVCVNCFCCGAYLCVLHPGKLCVCVNCSK, active peptides Addition promotes absorption and utilization of the goldbeater's skin to calcium, iron, zinc, selenium as inorganic ionic carriers, effectively prevents the metal of dissolving Ion small intestine is neutral or slight alkali environment in combined with phosphate radical and formed it is harmful precipitate, while effectively increase mineral matter and exist The internal holdup time, the absorption to feed nutrient is not only increased, also reduce pirarucu enterogastritis hair rate, exempting from Epidemic disease physiologically has prominent performance.
It by trash fish is raw material that fish protein hydrolyzate, which is, is made using tryptose Hydrolyze method, fish protein hydrolyzate has Gao Gong Energy property and high nutritive value, contribute to the digestion and then absorption of pirarucu and its juvenile fish digestive system to micro-granulated feed, keep away Exempt from the risk of bacterium infection pirarucu that the direct feeding of biological feedstuff causes to carry, effectively improve the growth of pirarucu Speed and survival rate.
Unrighted acid is made up of linoleic acid, fish oil, arachidonic acid one or more therein, unsaturated fat The addition of acid maintains the relative flow of cell membrane, improves blood microcirculation, promotes digestive function, effectively enhances Jugu tongue The immunocompetence of fish, improve survival rate.
The preparation method of the feed of pirarucu survival rate is improved, its preparation process is:
1)Prepare acidifying bone meal:By weight, take bone meal to add the glacial acetic acid that concentration is 97%, bone meal and glacial acetic acid according to 3.6:1 volume ratio amount mixes, and after stirring, stands reaction, and acidifying bone meal, standby, the acidified processing of bone meal is made Afterwards, be advantageous to improve free phosphate content therein, have significant effect to catfish body weight increase;
2)Prepare compound probiotic:By weight, solution of photosynthetic bacteria, bacillus subtilis, lactic acid bacteria is taken uniformly to mix, it is photosynthetic Bacterium liquid, bacillus subtilis, the volume ratio successively of lactic acid bacteria are 1:1:1.2, it is placed in the environment that temperature is 33 DEG C and stands 25 Minute, it is standby;
3)Mixing:Take step 1 and step 2 product, by proportional quantity add shrimp med, earthworm powder, wheat flour, lecithin, spirulina powder, Through adjusting after the uniform mixing of fairy shrimp powder, fish protein hydrolyzate, bean cake powder, unrighted acid, immunopotentiator, Strong flour The feed for the raising pirarucu survival rate that matter, expanded obtained particle diameter are 0.4 millimeter, the preparation method of this feed is simple, Cost is cheap, is adapted to use of large-scale production.
This Feed Energy effectively improves lyase bacterium activity in pirarucu body, improves the antiviral and ability of bacterium;This feeding Material can effectively facilitate pirarucu and inorganic ions and mineral matter element are absorbed, and reduce intestines problem;This Feed Energy Enough improve blood microcirculation, promote digestive function, effectively enhance the immunocompetence of pirarucu, improve survival rate;This feed Nutrition-allocated proportion is perfect, is adapted to the raising of juvenile fish and adult fish, cuts that preparation process is simple, and cost is cheap, is adapted to large-scale promotion.
Embodiment 3:
The preparation method of the feed of pirarucu survival rate is improved, its preparation process is:
1)By weight, 12 parts of bone meal is taken to add the glacial acetic acid that concentration is 99%, bone meal is with glacial acetic acid according to 4:1 proportional quantities Mixing, after being sufficiently stirred 30 minutes with mixer, stand 1 hour and react, acidifying bone meal, standby, the acidified processing of bone meal is made Afterwards, be advantageous to improve free phosphate content therein, have significant effect to catfish body weight increase;
2)By weight, the uniformly mixing of 10 parts of solution of photosynthetic bacteria, 9 parts of bacillus subtilis, 13 parts of lactic acid bacteria is taken, is placed on temperature To stand reaction 38 minutes in 30 DEG C of environment, compound probiotic is obtained, it is standby;
3)Step 1 and step 2 product are taken, 15 parts of shrimp med, 13 parts of earthworm powder, 30 parts of wheat flour, lecithin 3.5 are added by proportional quantity Part, 20 parts of spirulina powder, 6 parts of fairy shrimp powder, 16 parts of fish protein hydrolyzate, 22 parts of bean cake powder, 4 parts of unrighted acid, it is immunized Quenched 1 hour after 3.6 parts of reinforcing agent, the uniform mixing of 17 parts of Strong flour, it is put into feed extruder straight through expanded obtained particle The feed for the raising pirarucu survival rate that footpath is 0.5 millimeter, the preparation method of this feed is simple, and cost is cheap, is adapted to big rule Mould production and application.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein State.
Specific embodiment described herein is only to present invention explanation for example.The technical field of the invention Technical staff can be made various modifications or supplement to described specific embodiment or be substituted using similar mode, but Without departing from the present invention's or surmount scope defined in appended claims.
SEQUENCE LISTING
<110>Lanxi City Pu Run Si aquaculture technologies Co., Ltd
<120>Improve the feed of pirarucu survival rate
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 36
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ala Cys Lys Leu Cys Val Cys Val Asn Cys Phe Cys Cys
1 5 10 15
Gly Ala Tyr Leu Cys Val Leu His Pro Gly Lys Leu Cys Val Cys Val
20 25 30
Asn Cys Ser Lys
35

Claims (6)

1. improve the feed of pirarucu survival rate, it is characterised in that composition and its parts by weight are:13 ~ 22 parts of shrimp med, earthworm powder 10 ~ 17 parts, it is 22 ~ 35 parts of wheat flour, 1 ~ 4 part of lecithin, 8 ~ 13 parts of bone meal, 15 ~ 21 parts of spirulina powder, 5 ~ 9 parts of fairy shrimp powder, multiple Close 6 ~ 11 parts of probiotics, 12 ~ 17 parts of fish protein hydrolyzate, 16 ~ 28 parts of bean cake powder, 3 ~ 8 parts of unrighted acid, immunopotentiator 2 ~ 5 parts, 14 ~ 23 parts of Strong flour.
2. the feed according to claim 1 for improving pirarucu survival rate, it is characterised in that:The immunopotentiator by Following component and parts by weight composition:2 ~ 5 parts of radix glycyrrhizae, 4 ~ 9 parts of the bighead atractylodes rhizome, 3 ~ 6 parts of ginkgo, 1.4 ~ 3.5 parts of medical stone powder, compound dimension life Plain 2.2 ~ 4.3 parts of premix, 0.8 ~ 2.4 part of active peptides, 8 ~ 12 parts of Radix Isatidis, 1 ~ 3 part of garlic powder.
3. immunopotentiator according to claim 2, it is characterised in that:The amino acid sequence of the active peptides is HSHACKLCVCVNCFCCGAYLCVLHPGKLCVCVNCSK。
4. the feed according to claim 1 for improving pirarucu survival rate, it is characterised in that:The fish protein hydrolyzate It by trash fish is raw material to be, is made using tryptose Hydrolyze method.
5. the feed according to claim 1 for improving pirarucu survival rate, it is characterised in that:The unrighted acid It is made up of linoleic acid, fish oil, arachidonic acid one or more therein.
6. the feed according to claim 1 for improving pirarucu survival rate, it is characterised in that:The raising pirarucu The operating procedure of the preparation method of the feed of survival rate is:
1)Prepare acidifying bone meal:By weight, take bone meal to add the glacial acetic acid that concentration is 93 ~ 98%, bone meal and glacial acetic acid according to 3~5:1 volume ratio amount mixes, and after stirring, stands reaction, and acidifying bone meal is made, standby;
2)Prepare compound probiotic:Solution of photosynthetic bacteria, bacillus subtilis, lactic acid bacteria is taken uniformly to mix, solution of photosynthetic bacteria, withered grass Bacillus, the volume ratio successively of lactic acid bacteria are 1:0.8~1.1:1.2 ~ 1.5, it is placed in the environment that temperature is 28 ~ 36 DEG C and stands It is 20 ~ 40 minutes, standby;
3)Mixing:Take step 1 and step 2 product, by proportional quantity add shrimp med, earthworm powder, wheat flour, lecithin, spirulina powder, Through adjusting after the uniform mixing of fairy shrimp powder, fish protein hydrolyzate, bean cake powder, unrighted acid, immunopotentiator, Strong flour The feed for the raising pirarucu survival rate that matter, expanded obtained particle diameter are 0.2 ~ 0.6 millimeter.
CN201710500407.4A 2017-06-27 2017-06-27 Improve the feed of pirarucu survival rate Pending CN107432367A (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201710500407.4A CN107432367A (en) 2017-06-27 2017-06-27 Improve the feed of pirarucu survival rate

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201710500407.4A CN107432367A (en) 2017-06-27 2017-06-27 Improve the feed of pirarucu survival rate

Publications (1)

Publication Number Publication Date
CN107432367A true CN107432367A (en) 2017-12-05

Family

ID=60458651

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201710500407.4A Pending CN107432367A (en) 2017-06-27 2017-06-27 Improve the feed of pirarucu survival rate

Country Status (1)

Country Link
CN (1) CN107432367A (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111642620A (en) * 2020-07-08 2020-09-11 漯河医学高等专科学校 Compound probiotic preparation and preparation method and application thereof

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103494043A (en) * 2013-10-17 2014-01-08 丹阳市现代生态水产养殖场 Grass carp feed
CN105104793A (en) * 2015-07-27 2015-12-02 通威股份有限公司 Coregonus peled juvenile fish feed
CN105104894A (en) * 2015-09-28 2015-12-02 中海渔(福建)生物科技有限公司 Color improving compound feed for koi carp
CN105660477A (en) * 2016-01-28 2016-06-15 中国水产科学研究院长江水产研究所 Healthy breeding method of Ietalurus punetaus

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103494043A (en) * 2013-10-17 2014-01-08 丹阳市现代生态水产养殖场 Grass carp feed
CN105104793A (en) * 2015-07-27 2015-12-02 通威股份有限公司 Coregonus peled juvenile fish feed
CN105104894A (en) * 2015-09-28 2015-12-02 中海渔(福建)生物科技有限公司 Color improving compound feed for koi carp
CN105660477A (en) * 2016-01-28 2016-06-15 中国水产科学研究院长江水产研究所 Healthy breeding method of Ietalurus punetaus

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
李福秀: "骨粉酸化喂鱼效果好", 《农家科技》 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111642620A (en) * 2020-07-08 2020-09-11 漯河医学高等专科学校 Compound probiotic preparation and preparation method and application thereof

Similar Documents

Publication Publication Date Title
CN102940151B (en) Feed for improving egg laying performance of laying duck
CN107602663B (en) Tartary buckwheat active peptide and application thereof
CN103027187A (en) Anti-stress fermentation protein feed and producing method thereof
CN102754753A (en) Feed for improving growth performances of broiler chickens and preparation method thereof
CN105124230A (en) Taihu sheep feed and production method thereof
CN103598426A (en) Feed additive and feed for improving growth performance of chicks
CN102845632B (en) Safe environmentally-friendly healthy pig feed additive
CN107259212A (en) Snakeheaded fish Chinese herbal medicine health feed
CN106490333A (en) A kind of refined fish meal
KR100887334B1 (en) Feed additive for fish or crustacean breeding containing arazyme as effective ingredient
CN102491810A (en) Cordyceps militaris medium
CN105878397A (en) Composition capable of regulating transportation stress of cattle and sheep
CN109601695A (en) A kind of method that activated protein exempts from digesting protein with soybean protein for raw material preparation
CN107361243A (en) A kind of feed addictive for promoting cold water fish growth and application thereof
CN107432367A (en) Improve the feed of pirarucu survival rate
CN106107070A (en) A kind of Chinese herbal medicine feed for goat and preparation method thereof
CN106071303A (en) A kind of egg feedstuff containing lactic acid bacteria
CN105876186A (en) Donkey feed additive
CN105558435A (en) Feed additive for preventing and treating silver carp hemorrhagic disease
CN109043325A (en) A kind of edible composite bacterium powder
CN111418712A (en) Feed additive for improving survival rate of weever and preparation method thereof
CN106135746A (en) A kind of chicken bar halberd feedstuff
CN106333068A (en) Piglet feed
CN106072088A (en) Thallus Laminariae (Thallus Eckloniae) Ganoderma mycelium is prepared for culture medium with Thallus Laminariae (Thallus Eckloniae)
CN106260497A (en) A kind of giant salamander nourishing egg albumen powder production technology

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
RJ01 Rejection of invention patent application after publication
RJ01 Rejection of invention patent application after publication

Application publication date: 20171205