CN107382452A - It is sustained the preparation method of foliar fertilizer - Google Patents
It is sustained the preparation method of foliar fertilizer Download PDFInfo
- Publication number
- CN107382452A CN107382452A CN201710536982.XA CN201710536982A CN107382452A CN 107382452 A CN107382452 A CN 107382452A CN 201710536982 A CN201710536982 A CN 201710536982A CN 107382452 A CN107382452 A CN 107382452A
- Authority
- CN
- China
- Prior art keywords
- parts
- preparation
- fertilizer
- solution
- mulberries
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C05—FERTILISERS; MANUFACTURE THEREOF
- C05B—PHOSPHATIC FERTILISERS
- C05B7/00—Fertilisers based essentially on alkali or ammonium orthophosphates
-
- C—CHEMISTRY; METALLURGY
- C05—FERTILISERS; MANUFACTURE THEREOF
- C05F—ORGANIC FERTILISERS NOT COVERED BY SUBCLASSES C05B, C05C, e.g. FERTILISERS FROM WASTE OR REFUSE
- C05F17/00—Preparation of fertilisers characterised by biological or biochemical treatment steps, e.g. composting or fermentation
- C05F17/20—Preparation of fertilisers characterised by biological or biochemical treatment steps, e.g. composting or fermentation using specific microorganisms or substances, e.g. enzymes, for activating or stimulating the treatment
-
- C—CHEMISTRY; METALLURGY
- C05—FERTILISERS; MANUFACTURE THEREOF
- C05G—MIXTURES OF FERTILISERS COVERED INDIVIDUALLY BY DIFFERENT SUBCLASSES OF CLASS C05; MIXTURES OF ONE OR MORE FERTILISERS WITH MATERIALS NOT HAVING A SPECIFIC FERTILISING ACTIVITY, e.g. PESTICIDES, SOIL-CONDITIONERS, WETTING AGENTS; FERTILISERS CHARACTERISED BY THEIR FORM
- C05G3/00—Mixtures of one or more fertilisers with additives not having a specially fertilising activity
-
- C—CHEMISTRY; METALLURGY
- C05—FERTILISERS; MANUFACTURE THEREOF
- C05G—MIXTURES OF FERTILISERS COVERED INDIVIDUALLY BY DIFFERENT SUBCLASSES OF CLASS C05; MIXTURES OF ONE OR MORE FERTILISERS WITH MATERIALS NOT HAVING A SPECIFIC FERTILISING ACTIVITY, e.g. PESTICIDES, SOIL-CONDITIONERS, WETTING AGENTS; FERTILISERS CHARACTERISED BY THEIR FORM
- C05G3/00—Mixtures of one or more fertilisers with additives not having a specially fertilising activity
- C05G3/90—Mixtures of one or more fertilisers with additives not having a specially fertilising activity for affecting the nitrification of ammonium compounds or urea in the soil
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02W—CLIMATE CHANGE MITIGATION TECHNOLOGIES RELATED TO WASTEWATER TREATMENT OR WASTE MANAGEMENT
- Y02W30/00—Technologies for solid waste management
- Y02W30/40—Bio-organic fraction processing; Production of fertilisers from the organic fraction of waste or refuse
Abstract
The present invention discloses a kind of preparation method for being sustained foliar fertilizer, including the extraction of mulberries anthocyanidin, the preparation of rich ferrous solution, the preparation of fertilizer, and sustained release foliar fertilizer consists of the following composition：Corn protein powder, urea, potassium dihydrogen phosphate, calcium carbonate, soya-bean oil, potassium nitrate, fermented bean dregs, dolomite, ammonium sulfate, mulberries anthocyanidin extract solution, plant ash, bittern, coated carbamide, EM bacteria agent, active peptides, rich ferrous solution, water, the fruit that the present invention can improve crop output in the mulberries anthocyanidin extract solution of fertilizer preparation process addition removes free radical, anti-oxidant and profit brain effect, be advantageous to improve the quality of output fruit, addition active peptides can improve the nutrition content of tunning, fermentation time can also be shortened, shorten the production cycle of fertilizer, be advantageous to improve the economic benefit of enterprise, the preparation method for being sustained foliar fertilizer is simple, raw material easily obtain, preparation time is short, it can be mass, high financial profit.
Description
Technical field
The invention belongs to technical field of fertilizers, especially implements to be related to a kind of preparation method for being sustained foliar fertilizer.
Background technology
Foliar fertilizer is a kind of foliage top dressing, by directly spraying in crop leaf surface, is absorbed by blade, nutrient is conveyed
Each several part in crop body.It, which is mainly played, makes up root system fertilizer deficiency, balance crop nutrition or in a certain fertility of crop
Period alleviates the provisional effect that supply falls short of demand.Leaf directly absorbs and using available nutrient, higher to the utilization rate of nutrient,
Can avoid due to fixation of the soil to some nutrients simultaneously and, existing foliar fertilizer on blade face is applied to after effective time it is short,
Fertilizer efficiency is easy to disappear after rain drop erosion, and part needs the preparation time of the foliar fertilizer through everfermentation to grow, ferment effect
Bad control, the fertilizer efficiency time for the foliar fertilizer for causing to prepare may shorten.
Prior art such as Chinese invention granted patent document, the B of Authorization Notice No. CN 101935241, the invention are related to one
Kind potassium calcium biological compound leaf fertilizer, by weight percentage, the foliar fertilizer is by following components for described potassium calcium biological compound leaf fertilizer
Composition：The Organic Ingredients of yeast containing bacterium：20-40%；Potassium nitrate：24.5-39.5%；Calcium ammonium nitrate：35-45%；Azone：It is remaining
Amount.The invention additionally provides the preparation method and application of potassium calcium biological compound leaf fertilizer.The invention provides for foliar fertilizer production
A kind of new raw material：Alone inorganic raw material production potassium, the traditional mode of calcium foliar fertilizer are broken, for by composite microbiological fertilizer
Technological improvement is that foliar fertilizer is found that a kind of new raw material, and it has cost cheap, turned waste into wealth, good water solubility, utilization rate
The features such as high, while foliar fertilizer production cost is reduced, product quality is also improved, but the foliar fertilizer utilizes micro- life
The time of thing fermentation may the long production cycle for extending fertilizer, and ferment effect less stable.
The content of the invention
Substantially shorten fermentation time, tunning nutrition by adding active peptides it is an object of the invention to provide one kind
Component content is high, and fertilizer preparation time is short, and preparation process is simple, and the Fertilizer nutrient element of preparation enriches, and dosage is few cost-effective,
Utilization rate is high, and leaching volatilization loss is few, can improve a kind of preparation side of sustained release foliar fertilizer of plant growth speed and fruit quality
Method.
The scheme taken to achieve the above object of the present invention is：It is sustained the preparation method of foliar fertilizer, including mulberries cyanine
Plain extraction, the preparation of rich ferrous solution, the preparation of fertilizer, sustained release foliar fertilizer are made up of following component and parts by weight：Corn protein powder
22-46 parts, urea 20-30 parts, potassium dihydrogen phosphate 18-21 parts, calcium carbonate 30-50 parts, soya-bean oil 8-16 parts, potassium nitrate 8-12 parts,
Fermented bean dregs 8-10 parts, dolomite 6-8 parts, ammonium sulfate 5-6 parts, mulberries anthocyanidin extract solution 15-20 parts, plant ash 5-6 parts, halogen
Water 4-10 parts, coated carbamide 3-4 parts, EM bacteria agent 3-4 parts, active peptides 0.3-0.4 parts, rich ferrous solution 3-7 parts, water 24-76 parts,
The present invention is using inorganic fertilizer as primary raw material, the perfect nutritional ingredient of fertilizer of addition probiotics, organic fertilizer, can improve the life of crop
Long speed, the mulberries anthocyanidin extract solution of addition can improve the fruit of crop output except free radical, anti-oxidant and profit brain effect,
Be advantageous to improve the quality of output fruit, addition active peptides can improve the nutrition content of tunning, can also shorten hair
The ferment time, shorten the production cycle of fertilizer, be advantageous to improve the economic benefit of enterprise, foliar fertilizer is caused by volatilization, leaching
It is lost in few, improves blade face and fertilizer is absorbed, save fertilising cost, it is simple to be sustained the preparation method of foliar fertilizer, raw material
Easily obtain, preparation time is short, can be mass, high financial profit.
Mulberries anthocyanidin extract the step of be：It is beaten after fresh mulberries are cleaned, takes the mulberries slurries to be by liquid volume ratio（1:
8-12）Adding ethanol solution, the concentration of ethanol solution is 85-90%, and the value of the pH value of mulberries slurries is 1-1.2, stirring and leaching,
10-20min is centrifuged under 8500-10000r/min rotating speed, takes supernatant to be concentrated under reduced pressure, acetic acid second is added into concentrate
Ester, rear stratification is stirred, removes upper strata ethyl acetate, remove a layer mulberries anthocyanidin extract solution, mulberries anthocyanidin is carried
Take liquid to pass through macroporous resin adsorption post with 2-3 times of column volume/h flow velocity, then with 85% ethanol solution with 0.3-0.5 times of cylinder
Product/h flow velocity elution.Mulberries anthocyanidin have enrich blood, moisten brain, sharp liver, diuresis, profit just, it is anti-oxidant and eliminate the work such as free radical
With, added after making Foliage Absorption in fertilizer, be advantageous to strengthen crop output fruit except free radical, it is anti-oxidant and profit brain
Effect, improve output fruit quality.
The preparation of rich ferrous solution：Take by weight, cysteine 0.4-1 parts are put into 40-52 part water, are then heated to
80 DEG C, ferrous sulfate 2-5 parts, citric acid 0.3-0.7 parts and malic acid 0.5-1 parts are added after dissolving, stirs, uses 1mol/L
HCl solution regulation pH to 5.5, obtain rich ferrous solution, the rich ferrous solution of preparation adds in the preparation process of sustained release foliar fertilizer
Afterwards, fertilizer can be made to improve the iron content of crop output fruit after being absorbed on blade face, the iron content in fruit increases and then carried
The nutritive value of high fruit.
Sustained release foliar fertilizer preparation method be：By fermented bean dregs, corn protein powder, soya-bean oil, calcium carbonate, plant ash, halogen
Water is well mixed, and adds EM bacteria agent and active peptides, normal temperature aerobic fermentation 3-6 days, high temperature drying granulation, obtains material A after taking-up, living
The amino acid sequence of property polypeptide is：MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYQEVGHHCRRYRCCAIRA；
Add suitable quantity of water after urea, potassium dihydrogen phosphate, potassium nitrate, mulberries anthocyanidin extract solution, ammonium sulfate are mixed, stir into slurry, spray
Granulation is extruded after drying, obtains material B；By dolomite, coated carbamide, plant ash in pulverizer pulverization process, with rich ferrous solution
Mixing, obtains material C；Material A, B, C and leftover materials and water are mixed into the aqueous solution and produce sustained release foliar fertilizer.Pass through above-mentioned step
Suddenly the sustained release foliar fertilizer nutrient prepared enriches, and can promote absorption and conversion of the crop blade face to fertilizer, more by activity
Peptide can effectively shorten the fermentation time of fermentate, and the active peptides are rich in growth factor, can promote microorganism to nutritional ingredient
Absorption and utilization, promote the growth of microorganism, accelerate the reproduction speed of bacterium, shorten CDC, promote leavening
The breeding of middle mushroom, shorten fermentation time, ferment effect is good and stably, is advantageous to shortening fermentation time, improves the production of fertilizer
Efficiency, be advantageous to improve the economic benefit of fertilizer production, shorten the fertilizer production cycle, improve production economy benefit, the system of fertilizer
Standby simple production process, it is easy to use.
Compared with prior art, beneficial effects of the present invention are：1）The sustained release foliar fertilizer nutrient of the present invention enriches, and drenches
Molten volatilization loss is few, and dosage is few cost-effective, utilization rate of fertilizer and high conversion rate, can improve plant growth speed and fruit product
Matter, the fruit of crop output have the function that certain except free radical, anti-oxidant and profit brain；2）Pass through activity in preparation process
Polypeptide substantially shortens the fermentation time and ferment effect of fermentate, improves the production efficiency of fertilizer, shortens the production of fertilizer
In the cycle, be advantageous to improve the production economy benefit of fertilizer；3）Loss of the foliar fertilizer caused by volatilization, leaching is lacked, and improves blade face
Fertilizer is absorbed, saves fertilising cost；4）The preparation method step of the fruit tree incremental fertilizer of the present invention is simple, original used
Material is easy to get, and cost is low, and batch production can be achieved, have excellent economy and environmental benefit.
Embodiment
It is described in further detail with reference to embodiments：
Embodiment 1：
It is sustained the preparation method of foliar fertilizer, including the extraction of mulberries anthocyanidin, the preparation of rich ferrous solution, the preparation of fertilizer, specific behaviour
It is as step：
（1）Mulberries anthocyanidin extract the step of be：It is beaten after fresh mulberries are cleaned, takes the mulberries slurries to be by liquid volume ratio（1:
10）Ethanol solution is added, the concentration of ethanol solution is 88%, and the value of the pH value of mulberries slurries is 1.1, stirring and leaching, in
14min is centrifuged under 10000r/min rotating speed, takes supernatant to be concentrated under reduced pressure, ethyl acetate is added into concentrate, is stirred
Stratification afterwards, upper strata ethyl acetate is removed, a layer mulberries anthocyanidin extract solution is removed, by mulberries anthocyanidin extract solution with 3 times of posts
Volume/h flow velocity passes through macroporous resin adsorption post, then is eluted with 85% ethanol solution with 0.4 times of column volume/h flow velocity.
（2）The preparation of rich ferrous solution：Take by weight, 0.6 part of cysteine is put into 44 parts of water, is then heated to 80
DEG C, 0.7 part of 3 parts of ferrous sulfate, 0.6 part of citric acid and malic acid are added after dissolving, is stirred, it is molten with 1mol/L HCl
Liquid adjusts pH to 5.5, obtains rich ferrous solution.
（3）Sustained release foliar fertilizer preparation method be：By weight, by 8 parts of fermented bean dregs, 37 parts of corn protein powder,
12 parts of soya-bean oil, 32 parts of calcium carbonate, 5.2 parts of plant ash, 7 parts of bittern are well mixed, add 3.3 parts of EM bacteria agent and active peptides 0.37
Part, normal temperature aerobic fermentation 3 days, high temperature drying granulation, obtains material A, the amino acid sequence of active peptides is after taking-up：
MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYQEVGHHCRRYRCCAIRA；By 22 parts of urea, biphosphate
Add suitable quantity of water after 5.4 parts of 19 parts of potassium, 11 parts of potassium nitrate, 16 parts of mulberries anthocyanidin extract solution, ammonium sulfate mixing, stir into slurry, spray
Mist extrudes granulation after drying, and obtains material B；By 7 parts of dolomite, 3 parts of coated carbamide, 5.2 parts of plant ash in pulverizer at crushing
Reason, mixes with rich 4 parts of ferrous solution, obtains material C；Material A, B, C and leftover materials and water are mixed into the aqueous solution and produce sustained release
Foliar fertilizer.
Embodiment 2：
It is sustained the preparation method of foliar fertilizer, including the extraction of mulberries anthocyanidin, the preparation of rich ferrous solution, the preparation of fertilizer, specific behaviour
It is as step：
Mulberries anthocyanidin extract the step of be：It is beaten after fresh mulberries are cleaned, takes the mulberries slurries to be by liquid volume ratio（1:11）
Ethanol solution is added, the concentration of ethanol solution is 90%, and the value of the pH value of mulberries slurries is 1.2, stirring and leaching, in 9000r/min
Rotating speed under centrifuge 18min, take supernatant to be concentrated under reduced pressure, ethyl acetate added into concentrate, be stirred rear stratification,
Upper strata ethyl acetate is removed, a layer mulberries anthocyanidin extract solution is removed, by mulberries anthocyanidin extract solution with 2 times of column volume/h flow velocity
Eluted by macroporous resin adsorption post, then with 85% ethanol solution with 0.4 times of column volume/h flow velocity.Mulberries anthocyanidin has
Enrich blood, moisten brain, sharp liver, diuresis, profit just, it is anti-oxidant and eliminate the effect such as free radical, added makes Foliage Absorption in fertilizer
Afterwards, be advantageous to strengthen the quality removed free radical, anti-oxidant and profit brain effect, improve output fruit of crop output fruit.
The preparation of rich ferrous solution：Taking by weight, 0.6 part of cysteine is put into 46 parts of water, is then heated to 80 DEG C,
0.7 part of 3 parts of ferrous sulfate, 0.5 part of citric acid and malic acid are added after dissolving, is stirred, is adjusted with 1mol/L HCl solution
PH to 5.5 is saved, obtains rich ferrous solution, the rich ferrous solution of preparation after addition, can make fertilizer exist in the preparation process of sustained release foliar fertilizer
The iron content of crop output fruit is improved on blade face after being absorbed, the iron content in fruit increases and then improves the nutriture value of fruit
Value.
Sustained release foliar fertilizer preparation method be：By weight, by 9 parts of fermented bean dregs, 40 parts of corn protein powder, soya-bean oil
12 parts, 30 parts of calcium carbonate, 5 parts of plant ash, 7 parts of bittern it is well mixed, add 0.3 part of 3 parts of EM bacteria agent and active peptides, normal temperature has
Aerobe fermentation 3-6 days, high temperature drying granulation, obtains material A, the amino acid sequence of active peptides is after taking-up：
MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYQEVGHHCRRYRCCAIRA；By urea, potassium dihydrogen phosphate 19
Add suitable quantity of water after 5 parts of part, 10 parts of potassium nitrate, 18 parts of mulberries anthocyanidin extract solution, ammonium sulfate mixing, stir into slurry, be spray-dried
Extruding granulation afterwards, obtains material B；By 5 parts of 8 parts of dolomite, 3 parts of coated carbamide, plant ash pulverization process in pulverizer, with rich iron
7 parts of mixing of solution, obtain material C；Material A, B, C and leftover materials and water are mixed into the aqueous solution and produce sustained release foliar fertilizer.It is logical
The sustained release foliar fertilizer nutrient for crossing above-mentioned steps preparation enriches, and can promote absorption and conversion of the crop blade face to fertilizer, leads to
The fermentation time of fermentate can effectively be shortened by crossing active peptides, and the active peptides are rich in growth factor, can promote microorganism pair
The absorption and utilization of nutritional ingredient, promote the growth of microorganism, accelerate the reproduction speed of bacterium, shorten CDC, promote
Enter the breeding of mushroom in leavening, shorten fermentation time, ferment effect is good and stably, is advantageous to shorten fermentation time, improves fertile
The production efficiency of material, be advantageous to improve the economic benefit of fertilizer production, shorten the fertilizer production cycle, improve production economy benefit,
The preparation simple production process of fertilizer, it is easy to use.
Embodiment 3：
To prove the present invention manurial value and effect that prepare, inventor is by fertility, sunshine, water source identical apple tree experimental plot
10 mu are divided into 2 parts, and 5 mu of fertilizer that the present invention is used as experimental group, 5 mu are sustained using the common blade face of tradition as a control group
Fertilizer, it is as follows using identical plantation gimmick, experimental result during crop grows up：
| Group | Yield（Kg/ mus） | Survival rate（%） | Sugariness | Head |
| Control group（Conventional fertilizers） | 435 | 95.2 | 13.6 | Head is smaller |
| Experimental group（The fertilizer of the present invention） | 496 | 99.2 | 16.7 | Head is larger |
As can be seen from the above table, the chemical fertilizer prepared compared to traditional preparation method is compared, the sustained release blade face prepared by the present invention
Fertilizer has good economic prospect.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme is described in detail embodiment described above, it should be understood that it is described above only
For the specific embodiment of the present invention, it is not intended to limit the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should be included in the scope of the protection.
SEQUENCE LISTING
<110>Close big vast gardening research and development Co., Ltd in Pujiang County
<120>It is sustained the preparation method of foliar fertilizer
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 57
<212> PRT
<213>It is artificial synthesized
<400> 1
Met Lys Gly Leu Ser Phe Val Leu Leu Val Leu Leu Leu Met Met Pro
1 5 10 15
Asp Gly Glu Gly Thr Asp Pro Glu Met Gln Tyr Trp Thr Cys Gly Tyr
20 25 30
Arg Gly Leu Cys Arg Arg Phe Tyr Gln Glu Val Gly His His Cys Arg
35 40 45
Arg Tyr Arg Cys Cys Ala Ile Arg Ala
50 55
Claims (6)
1. the preparation method of foliar fertilizer is sustained, including the extraction of mulberries anthocyanidin, the preparation of rich ferrous solution, the preparation of fertilizer, it is special
Sign is：Described sustained release foliar fertilizer is made up of following component and parts by weight：Corn protein powder 22-46 parts, urea 20-30 parts,
Potassium dihydrogen phosphate 18-21 parts, calcium carbonate 30-50 parts, soya-bean oil 8-16 parts, potassium nitrate 8-12 parts, fermented bean dregs 8-10 parts, dolomite
6-8 parts, ammonium sulfate 5-6 parts, mulberries anthocyanidin extract solution 15-20 parts, plant ash 5-6 parts, bittern 4-10 parts, coated carbamide 3-4
Part, EM bacteria agent 3-4 parts, active peptides 0.3-0.4 parts, rich ferrous solution 3-7 parts, water 24-76 parts.
2. the preparation method of sustained release page fertilizer according to claim 1, it is characterised in that：Work in the sustained release foliar fertilizer
The amino acid sequence of property polypeptide is：MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYQEVGHHCRRYRCCAIRA.
3. the preparation method of sustained release page fertilizer according to claim 1, it is characterised in that：The mulberries anthocyanidin extraction
Step is：It is beaten after fresh mulberries are cleaned, takes the mulberries slurries to be by liquid volume ratio（1:8-12）Add ethanol solution, stirring leaching
Carry, centrifuge 10-20min under 8500-10000r/min rotating speed, take supernatant to be concentrated under reduced pressure, acetic acid is added into concentrate
Ethyl ester, rear stratification is stirred, removes upper strata ethyl acetate, a layer mulberries anthocyanidin extract solution is removed, by mulberries anthocyanidin
Extract solution passes through macroporous resin adsorption post with 2-3 times of column volume/h flow velocity, then with 85% ethanol solution with 0.3-0.5 times of post
Volume/h flow velocity elution.
4. the preparation method of sustained release page fertilizer according to claim 1, it is characterised in that：The mulberries anthocyanidin extraction step
The concentration of ethanol solution in rapid is 85-90%, and the value of the pH value of mulberries slurries is 1-1.2.
5. the preparation method of sustained release page fertilizer according to claim 1, it is characterised in that：The preparation of the rich ferrous solution
Method is：Take by weight, cysteine 0.4-1 parts are put into 40-52 part water, are then heated to 80 DEG C, are added after dissolving
Ferrous sulfate 2-5 parts, citric acid 0.3-0.7 parts and malic acid 0.5-1 parts, stir, and are adjusted with 1mol/L HCl solution
PH to 5.5, obtain rich ferrous solution.
6. the preparation method of sustained release page fertilizer according to claim 1, it is characterised in that：The preparation process of the fertilizer
For：
1）Fermented bean dregs, corn protein powder, soya-bean oil, calcium carbonate, plant ash, bittern are well mixed, add EM bacteria agent and activity
Polypeptide, normal temperature aerobic fermentation 3-6 days, high temperature drying granulation, obtains material A after taking-up；
2）Add suitable quantity of water after urea, potassium dihydrogen phosphate, potassium nitrate, mulberries anthocyanidin extract solution, ammonium sulfate are mixed, stir into
Slurry, granulation is extruded after spray drying, obtains material B；
3）By dolomite, coated carbamide, plant ash in pulverizer pulverization process, mixed with rich ferrous solution, obtain material C；
4）Material A, B, C and leftover materials and water are mixed into the aqueous solution and produce sustained release foliar fertilizer.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710536982.XA CN107382452A (en) | 2017-07-04 | 2017-07-04 | It is sustained the preparation method of foliar fertilizer |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710536982.XA CN107382452A (en) | 2017-07-04 | 2017-07-04 | It is sustained the preparation method of foliar fertilizer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107382452A true CN107382452A (en) | 2017-11-24 |
Family
ID=60335089
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710536982.XA Pending CN107382452A (en) | 2017-07-04 | 2017-07-04 | It is sustained the preparation method of foliar fertilizer |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107382452A (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108794172A (en) * | 2018-06-29 | 2018-11-13 | 贵州关岭阿依苗生态农业发展有限公司 | A kind of selenium-rich grape foliar fertilizer and preparation method thereof |
| CN109180365A (en) * | 2018-11-22 | 2019-01-11 | 南通正天农业科技有限公司 | A kind of foliage fertilizer formulation improving rosaceous plant fruit iron content |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102432389A (en) * | 2011-09-30 | 2012-05-02 | 浙江师范大学 | Iron-rich foliar fertilizer for fruit trees |
| CN104151097A (en) * | 2014-07-02 | 2014-11-19 | 马鞍山市四季果业有限公司 | Multifunctional fruit tree fertilizer and preparation method thereof |
| CN105494886A (en) * | 2015-12-03 | 2016-04-20 | 王金光 | Hydrolyzed protein powder and preparation method thereof |
| CN105949164A (en) * | 2016-06-08 | 2016-09-21 | 句容市东方紫酒业有限公司 | Mulberry anthocyanin extracting method |
-
2017
- 2017-07-04 CN CN201710536982.XA patent/CN107382452A/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102432389A (en) * | 2011-09-30 | 2012-05-02 | 浙江师范大学 | Iron-rich foliar fertilizer for fruit trees |
| CN104151097A (en) * | 2014-07-02 | 2014-11-19 | 马鞍山市四季果业有限公司 | Multifunctional fruit tree fertilizer and preparation method thereof |
| CN105494886A (en) * | 2015-12-03 | 2016-04-20 | 王金光 | Hydrolyzed protein powder and preparation method thereof |
| CN105949164A (en) * | 2016-06-08 | 2016-09-21 | 句容市东方紫酒业有限公司 | Mulberry anthocyanin extracting method |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108794172A (en) * | 2018-06-29 | 2018-11-13 | 贵州关岭阿依苗生态农业发展有限公司 | A kind of selenium-rich grape foliar fertilizer and preparation method thereof |
| CN109180365A (en) * | 2018-11-22 | 2019-01-11 | 南通正天农业科技有限公司 | A kind of foliage fertilizer formulation improving rosaceous plant fruit iron content |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103058771B (en) | Controlled-release and slow-release compound fertilizer specialized for kiwi fruit | |
| CN100577611C (en) | Organic-inorganic liquid compound fertilizer and producing method thereof | |
| CN104030859A (en) | Special biological multieffect fertilizer for grapes and preparation method thereof | |
| CN103274829A (en) | Special compound microbial fertilizer for tomatoes and preparation method thereof | |
| CN103708973B (en) | Preparation method of a kind of soil remediation active organic fertilizer and products thereof and application | |
| CN103819286A (en) | Special biological multi-effect fertilizer for grapes and preparation method thereof | |
| CN107324946A (en) | The preparation method of grape compound organic fertilizer | |
| CN104725140B (en) | A kind of amino acid fertilizer synergist with ammonia volatilization inhibitory action and preparation method thereof | |
| CN104030825A (en) | Mixed fertilizer for grapes and preparation method thereof | |
| CN106045642A (en) | Fertilizer specially used for planting watermelons | |
| CN105000993A (en) | High-permeability liquid fertilizer and preparing method thereof | |
| CN107445726A (en) | A kind of organic water-soluble fertilizer and preparation method | |
| CN104541981B (en) | A kind of method using biogas residue and biogas slurry cultivation spring sowing Lentinus Edodes | |
| CN103396240A (en) | Multi-element microcapsule microbial fertilizer controlling Chinese cabbage soft rot | |
| CN104151098A (en) | Grape special fertilizer for soil improvement and preparation method thereof | |
| CN104193534A (en) | Biological salt-relieving activator and agricultural application thereof | |
| CN105016848A (en) | Chlorine-based gamma-biological compound fertilizer and preparation method thereof | |
| CN105801283A (en) | Environment-friendly organic biomass fertilizer special for oil peonies | |
| CN108184585B (en) | Method for increasing content of essential amino acid in rice | |
| CN105016882A (en) | Liquid fertilizer resisting transpiration and preparation method thereof | |
| CN107382452A (en) | It is sustained the preparation method of foliar fertilizer | |
| CN100372814C (en) | Organic fertilizer prepared by using waste blackfungus culture medium and its preparation method and use | |
| CN106748245A (en) | Se rich tea plants nutrient special | |
| CN104496603A (en) | Selenium-rich green pepper liquid fertilizer and preparation method thereof | |
| CN106045655A (en) | Special fertilizer capable of reinforcing photosynthesis for flat peach |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171124 |